Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1471.229829713760.0
Kwal_14.17935472958901e-117
AAR166C5853068591e-112
YBR220C5602968431e-109
CAGL0K06809g5673048241e-107
Scas_686.215963027941e-102
KLLA0F09581g5172885972e-73
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1471.2
         (298 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1471.2 YBR220C, Contig c1471 1586-2478 reverse complement        534   0.0  
Kwal_14.1793                                                          347   e-117
AAR166C [354] [Homologous to ScYBR220C - SH] (640457..642214) [1...   335   e-112
YBR220C (YBR220C) [401] chr2 complement(662952..664634) Protein ...   329   e-109
CAGL0K06809g complement(663435..665138) highly similar to sp|P38...   322   e-107
Scas_686.21                                                           310   e-102
KLLA0F09581g complement(879983..881536) similar to sp|P38318 Sac...   234   2e-73

>Sklu_1471.2 YBR220C, Contig c1471 1586-2478 reverse complement
          Length = 298

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/297 (89%), Positives = 265/297 (89%)

Query: 1   MSSNYKPSQQLAKHDVPQFYLLVCLYFLQGIPVGLAFGTVPFLLKSVASTTSFTRLGLFS 60
           MSSNYKPSQQLAKHDVPQFYLLVCLYFLQGIPVGLAFGTVPFLLKSVASTTSFTRLGLFS
Sbjct: 1   MSSNYKPSQQLAKHDVPQFYLLVCLYFLQGIPVGLAFGTVPFLLKSVASTTSFTRLGLFS 60

Query: 61  MATYPYSLKILWSPIVDSFYIKKTGRRRSWIIPVQLVSGIMLWALGWCINHNIIFAGVDD 120
           MATYPYSLKILWSPIVDSFYIKKTGRRRSWIIPVQLVSGIMLWALGWCINHNIIFAGVDD
Sbjct: 61  MATYPYSLKILWSPIVDSFYIKKTGRRRSWIIPVQLVSGIMLWALGWCINHNIIFAGVDD 120

Query: 121 AYYPHRATTSHANLNXXXXXXXXXXXXXXXXXQDIAVDGWALTILSKRSLSYASTAQTVG 180
           AYYPHRATTSHANLN                 QDIAVDGWALTILSKRSLSYASTAQTVG
Sbjct: 121 AYYPHRATTSHANLNISALTLCFLLLIFLCATQDIAVDGWALTILSKRSLSYASTAQTVG 180

Query: 181 LNTGYFLSFTIFLTFNSSDFMNRYLRNEPLDYGLISFGGYLKLAGXXXXXXXXXXXXXXX 240
           LNTGYFLSFTIFLTFNSSDFMNRYLRNEPLDYGLISFGGYLKLAG               
Sbjct: 181 LNTGYFLSFTIFLTFNSSDFMNRYLRNEPLDYGLISFGGYLKLAGIIYIIATIYVIWYTT 240

Query: 241 EHPAANNRPLPLSMKKDDEKSTAIEYNEDVTSGNTSLLHVYRSFFKILRLPSVKSLI 297
           EHPAANNRPLPLSMKKDDEKSTAIEYNEDVTSGNTSLLHVYRSFFKILRLPSVKSLI
Sbjct: 241 EHPAANNRPLPLSMKKDDEKSTAIEYNEDVTSGNTSLLHVYRSFFKILRLPSVKSLI 297

>Kwal_14.1793
          Length = 547

 Score =  347 bits (890), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 174/295 (58%), Positives = 209/295 (70%), Gaps = 3/295 (1%)

Query: 6   KPSQQLAKHDVPQFYLLVCLYFLQGIPVGLAFGTVPFLLKSVASTTSFTRLGLFSMATYP 65
           +P++QLAKHD     LL+ LYFLQGIPVGLAFGT+PFLLKS    T+FT+LG F+MATYP
Sbjct: 3   EPTRQLAKHDYKPLALLIALYFLQGIPVGLAFGTIPFLLKSTVKDTTFTQLGFFAMATYP 62

Query: 66  YSLKILWSPIVDSFYIKKTGRRRSWIIPVQLVSGIMLWALGWCINHNIIFAGVDDAYYPH 125
           YSLKILWSPIVDS Y KKTGRRRSWIIP+Q  SG++LW LG C++HN++FAG+DDAY   
Sbjct: 63  YSLKILWSPIVDSIYNKKTGRRRSWIIPIQFASGVILWILGLCVSHNLVFAGIDDAYKTG 122

Query: 126 RATTSH--ANLNXXXXXXXXXXXXXXXXXQDIAVDGWALTILSKRSLSYASTAQTVGLNT 183
                H  ++LN                 QDIAVDGWAL ILSK SLSYASTAQTVGLNT
Sbjct: 123 VPVVPHDPSSLNITTLTACFLLLVFLCATQDIAVDGWALEILSKDSLSYASTAQTVGLNT 182

Query: 184 GYFLSFTIFLTFNSSDFMNRYLRNEPLDYGLISFGGYLKLAGXXXXXXXXXXXXXXXEHP 243
           GYFLSFT+FLTFNSSDFMN+Y+RN P ++GLIS GGYLK AG               E P
Sbjct: 183 GYFLSFTVFLTFNSSDFMNKYIRNVPQEHGLISLGGYLKFAGTVYLLVTLYVAYFTTERP 242

Query: 244 AANNRPLPLSMKKDDEK-STAIEYNEDVTSGNTSLLHVYRSFFKILRLPSVKSLI 297
                 LP + KK DEK S    Y+ D+++ +TSL  VY SF ++L+LP+V+SL+
Sbjct: 243 YETAIVLPTTTKKSDEKLSHEALYDPDISAASTSLKSVYSSFLRVLKLPNVQSLM 297

>AAR166C [354] [Homologous to ScYBR220C - SH] (640457..642214) [1758
           bp, 585 aa]
          Length = 585

 Score =  335 bits (859), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 182/306 (59%), Positives = 209/306 (68%), Gaps = 15/306 (4%)

Query: 5   YKPSQQLAKHDVPQFYLLVCLYFLQGIPVGLAFGTVPFLLKSVASTTSFTRLGLFSMATY 64
           +K S QLA HDVPQFYLLV LYFLQGIPVGLAFGTVPFLLKS+A  TSFT+L LF +ATY
Sbjct: 38  HKASSQLAAHDVPQFYLLVALYFLQGIPVGLAFGTVPFLLKSIAKDTSFTKLRLFGIATY 97

Query: 65  PYSLKILWSPIVDSFYIKKTGRRRSWIIPVQLVSGIMLWALGWCINHNIIFAGVDDAYYP 124
           PYSLKI WSP+VDSF+ KK GRRRSWIIPVQL SG+MLW +G  +    +F GV DA Y 
Sbjct: 98  PYSLKIHWSPLVDSFFSKKIGRRRSWIIPVQLASGVMLWCVGHAVAQGWVFEGV-DASYG 156

Query: 125 HRATTSHANLNXXXXXXXXXXXXXXXXXQDIAVDGWALTILSKRSLSYASTAQTVGLNTG 184
             +    A +N                 QDIAVDGWALTILS++SLSYASTAQTVGLNTG
Sbjct: 157 APSLGDGAKINITSLTVCFLVLVFFCATQDIAVDGWALTILSRQSLSYASTAQTVGLNTG 216

Query: 185 YFLSFTIFLTFNSSDFMNRYLRNEPLDYGLISFGGYLKLAGXXXXXXXXXXXXXXXEHPA 244
           YFLSF+IFL FNS DF+NRY R  PLD+G+ISF  YLKL+G               E+P 
Sbjct: 217 YFLSFSIFLAFNSGDFVNRYFRALPLDHGIISFSSYLKLSGWMYLILTAYVVFFTQEYPY 276

Query: 245 ANNRPLPL---SMKKDDEK----------STAIEYNEDVTSGNTSLLHVYRSFFKILRLP 291
           A++  LP+     K DDEK          S  IEYNED +   TSL  VYRSF K+LRLP
Sbjct: 277 AHSG-LPVVSTKPKDDDEKGHIVTSTTKNSAHIEYNEDSSISKTSLGAVYRSFVKVLRLP 335

Query: 292 SVKSLI 297
           +V+SLI
Sbjct: 336 AVRSLI 341

>YBR220C (YBR220C) [401] chr2 complement(662952..664634) Protein
           with similarity to human acetyl coenzyme A transporter,
           E. coli ampG protein, and other acetyl-CoA transporter
           proteins [1683 bp, 560 aa]
          Length = 560

 Score =  329 bits (843), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 171/296 (57%), Positives = 204/296 (68%), Gaps = 6/296 (2%)

Query: 6   KPSQQLAKHDVPQFYLLVCLYFLQGIPVGLAFGTVPFLLKSVASTTSFTRLGLFSMATYP 65
           + S  LAKHD+PQFYLL+ LY  QGIPVGLAFGTVPFLLKS+A  TSFT LG+FSMATYP
Sbjct: 5   RKSGSLAKHDLPQFYLLIMLYLAQGIPVGLAFGTVPFLLKSLAKETSFTSLGIFSMATYP 64

Query: 66  YSLKILWSPIVDSFYIKKTGRRRSWIIPVQLVSGIMLWALGWCINHNIIFAGVDDAYYPH 125
           YSLKI+WSPIVDS Y K+ GRRRSWIIPVQ VSG +LWALGWCI+  IIF GVDDA++  
Sbjct: 65  YSLKIIWSPIVDSLYNKRIGRRRSWIIPVQFVSGFVLWALGWCISQGIIFDGVDDAFHNR 124

Query: 126 RATTSHANLNXXXXXXXXXXXXXXXXXQDIAVDGWALTILSKRSLSYASTAQTVGLNTGY 185
              T H+ ++                 QDIAVDGWALTILSK SLSYASTAQT+GLN GY
Sbjct: 125 GNGTLHS-VSIKNLTWWFGLLVFLCATQDIAVDGWALTILSKESLSYASTAQTIGLNIGY 183

Query: 186 FLSFTIFLTFNSSDFMNRYLRNEPLDYGLISFGGYLKLAGXXXXXXXXXXXXXXXEHPAA 245
           F+SFTIFL+ NSSDF N+Y RN PLD+G IS GGY+K +G               E P  
Sbjct: 184 FMSFTIFLSLNSSDFANKYFRNIPLDHGFISLGGYMKFSGMLYIVITIYIIFCTKEKPYV 243

Query: 246 NNRPL--PLSMKKDDEKSTAIEYNE-DV--TSGNTSLLHVYRSFFKILRLPSVKSL 296
              P   P++      K  +IEY++ DV  T   +S+ ++YR F K+L+L SV+SL
Sbjct: 244 EYLPKVEPINTSDGGSKPISIEYDDGDVVSTQNTSSIKYIYRCFIKVLKLKSVRSL 299

>CAGL0K06809g complement(663435..665138) highly similar to sp|P38318
           Saccharomyces cerevisiae YBR220c, hypothetical start
          Length = 567

 Score =  322 bits (824), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 167/304 (54%), Positives = 210/304 (69%), Gaps = 15/304 (4%)

Query: 7   PSQQLAKHDVPQFYLLVCLYFLQGIPVGLAFGTVPFLLKSVASTTSFTRLGLFSMATYPY 66
           P++ LAK D+PQFYLL+CLYFLQGIPVGLAFGTVPFLLKS+A  T+FT+LG+FSMATYPY
Sbjct: 4   PAKTLAKRDIPQFYLLICLYFLQGIPVGLAFGTVPFLLKSMAKETTFTQLGIFSMATYPY 63

Query: 67  SLKILWSPIVDSFYIKKTGRRRSWIIPVQLVSGIMLWALGWCINHNIIFAGVDDAYYPHR 126
           SLKILWSP+VDS Y KK GRRRSWIIP+QLVSG+ML+ LG CI+   +F GVDDA++   
Sbjct: 64  SLKILWSPLVDSVYFKKIGRRRSWIIPIQLVSGVMLFFLGTCISRGKVFNGVDDAFHGRN 123

Query: 127 ATTSHANLNXXXXXXXXXXXXXXXXXQDIAVDGWALTILSKRSLSYASTAQTVGLNTGYF 186
           +   H N+N                 QDIAVDGWALTILS+ S+SY+STAQT+GLN GYF
Sbjct: 124 SGGLH-NVNVPFLTWCFGTLVFLCATQDIAVDGWALTILSRDSISYSSTAQTIGLNMGYF 182

Query: 187 LSFTIFLTFNSSDFMNRYLRNEPLDYGLISFGGYLKLAGXXXXXXXXXXXXXXXEHP-AA 245
           LSFT+F+  NSS+F N+Y+RN PL +GLIS GGY+K AG               E P + 
Sbjct: 183 LSFTVFIALNSSEFANKYVRNMPLPHGLISLGGYMKTAGALYVLLTLYVIFFTKEVPNSV 242

Query: 246 NNRPLPLSMKKDDEKSTA----------IEYNEDV---TSGNTSLLHVYRSFFKILRLPS 292
            + P+   +K+ D + +A          IEY + V   T   +S+ +VYR F KIL+L S
Sbjct: 243 YDLPITDKVKEKDRELSADKALSPTITNIEYPDHVTIKTENTSSIAYVYRGFLKILKLRS 302

Query: 293 VKSL 296
           V++L
Sbjct: 303 VRTL 306

>Scas_686.21
          Length = 596

 Score =  310 bits (794), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 156/302 (51%), Positives = 201/302 (66%), Gaps = 8/302 (2%)

Query: 3   SNYKPSQQLAKHDVPQFYLLVCLYFLQGIPVGLAFGTVPFLLKSVASTTSFTRLGLFSMA 62
           SN    + +AKHD+PQF+LL+ LYF+QG+PVGLAFGT+PFLLKS+A  TSF  LG+FS+A
Sbjct: 26  SNSNRDKSIAKHDLPQFFLLIALYFVQGVPVGLAFGTIPFLLKSMAKETSFASLGVFSIA 85

Query: 63  TYPYSLKILWSPIVDSFYIKKTGRRRSWIIPVQLVSGIMLWALGWCINHNIIFAGVDDAY 122
           TYPYSLKILWSPIVDSFY KK GRRRSWIIP+QL SGIML+ LG CI+   IF GVD A+
Sbjct: 86  TYPYSLKILWSPIVDSFYSKKIGRRRSWIIPIQLTSGIMLYTLGLCISKGYIFQGVDAAF 145

Query: 123 YPHRATTSHANLNXXXXXXXXXXXXXXXXXQDIAVDGWALTILSKRSLSYASTAQTVGLN 182
           +   ++    N+N                 QDIAVDGWALTILS +SLSYASTAQTVGLN
Sbjct: 146 HSGESSEKIHNVNILTLAWYFGSLVFLCATQDIAVDGWALTILSTQSLSYASTAQTVGLN 205

Query: 183 TGYFLSFTIFLTFNSSDFMNRYLRNEPLDYGLISFGGYLKLAGXXXXXXXXXXXXXXXEH 242
            GYFLSFT+FL+ NS++F+N+Y R  P +YG +S GGY+K +G               E+
Sbjct: 206 MGYFLSFTVFLSLNSNEFINKYFRKIPQNYGWVSLGGYMKFSGLVYILVTIYVVFATREN 265

Query: 243 PAANNRPLPLSMKKDDEKSTAIEYNED--------VTSGNTSLLHVYRSFFKILRLPSVK 294
           P  +NR +  S  K+ EK   +   E               +++++YR F K+L+L +V+
Sbjct: 266 PFNSNRNILPSFDKEHEKKQEMIIVEHGGGGDDDYDNDKTRNIMYIYRCFIKVLQLKTVR 325

Query: 295 SL 296
           +L
Sbjct: 326 TL 327

>KLLA0F09581g complement(879983..881536) similar to sp|P38318
           Saccharomyces cerevisiae YBR220c singleton, hypothetical
           start
          Length = 517

 Score =  234 bits (597), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 142/288 (49%), Positives = 171/288 (59%), Gaps = 22/288 (7%)

Query: 11  LAKHDVPQFYLLVCLYFLQGIPVGLAFGTVPFLLKSVASTTSFTRLGLFSMATYPYSLKI 70
           L  HD  QFYLLV LY LQGIPVGL FGT+PF+LKS    TSF  +GLFSMATYPYS KI
Sbjct: 3   LPPHDRKQFYLLVVLYLLQGIPVGLTFGTIPFILKSSQRQTSFVTIGLFSMATYPYSFKI 62

Query: 71  LWSPIVDSFYIKKTGRRRSWIIPVQLVSGIMLWALGWCINHNIIFAGVDDAYYPHRATTS 130
           LWSPIVDS+Y +K GRRRSWIIPVQ V+GI L  LG+CI+ + I    D +    +A TS
Sbjct: 63  LWSPIVDSWYSQKVGRRRSWIIPVQFVTGITLLTLGYCISKDKILPK-DVSKVDMKALTS 121

Query: 131 HANLNXXXXXXXXXXXXXXXXXQDIAVDGWALTILSKRSLSYASTAQTVGLNTGYFLSFT 190
                                 QDIAVDGWAL ILSK SLSYASTAQT+GLN GYF+SFT
Sbjct: 122 -----------VFLFLVILCSTQDIAVDGWALNILSKESLSYASTAQTIGLNIGYFMSFT 170

Query: 191 IFLTFNSSDFMNRYLRNEPLDYGLISFGGYLKLAGXXXXXXXXXXXXXXXEHPAANNRPL 250
           IFL+ +S +FM +Y   +     L     YL   G               E         
Sbjct: 171 IFLSLSSDEFMQKYFHRDR----LFQLSSYLTFTGLLYLAVTFYVSLFTSEKVHVETHS- 225

Query: 251 PLSMKKDDEKSTAIEYNEDVTSGNTS--LLHVYRSFFKILRLPSVKSL 296
              +KKDD++   IEY  D    N S  L+++YR F K+++LPSV++L
Sbjct: 226 --HIKKDDDEK-MIEYQPDEEEDNESHDLINIYRLFIKVMKLPSVQTL 270

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.137    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,766,146
Number of extensions: 329703
Number of successful extensions: 757
Number of sequences better than 10.0: 9
Number of HSP's gapped: 744
Number of HSP's successfully gapped: 9
Length of query: 298
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 197
Effective length of database: 13,099,691
Effective search space: 2580639127
Effective search space used: 2580639127
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 61 (28.1 bits)