Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1420.31761769511e-133
Kwal_33.155221761767641e-105
ACL127W1801767301e-100
YJR025C (BNA1)1771777055e-96
Scas_666.2248446661.1
AER347W48939641.8
Kwal_26.859062153614.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1420.3
         (176 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1420.3 YJR025C, Contig c1420 1151-1681                           370   e-133
Kwal_33.15522                                                         298   e-105
ACL127W [922] [Homologous to ScYJR025C (BNA1) - SH] complement(1...   285   e-100
YJR025C (BNA1) [2925] chr10 complement(471052..471585) 3-hydroxy...   276   5e-96
Scas_666.22                                                            30   1.1  
AER347W [2848] [Homologous to ScYMR215W - SH] complement(1273251...    29   1.8  
Kwal_26.8590                                                           28   4.8  

>Sklu_1420.3 YJR025C, Contig c1420 1151-1681
          Length = 176

 Score =  370 bits (951), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 176/176 (100%), Positives = 176/176 (100%)

Query: 1   MLNTTPINIPKWLEENSHLLQPPVNNYCLHRGGFTVMIIGGPNERTDYHVNPTPEWFHQR 60
           MLNTTPINIPKWLEENSHLLQPPVNNYCLHRGGFTVMIIGGPNERTDYHVNPTPEWFHQR
Sbjct: 1   MLNTTPINIPKWLEENSHLLQPPVNNYCLHRGGFTVMIIGGPNERTDYHVNPTPEWFHQR 60

Query: 61  KGSMTLRVVDESLTDASKFKDVIINEGDSYLLPANVPHNPVRYENTVGIVVEQDRPDGAH 120
           KGSMTLRVVDESLTDASKFKDVIINEGDSYLLPANVPHNPVRYENTVGIVVEQDRPDGAH
Sbjct: 61  KGSMTLRVVDESLTDASKFKDVIINEGDSYLLPANVPHNPVRYENTVGIVVEQDRPDGAH 120

Query: 121 DKLRWYCFKCKEVVCELDFQMVDLGTQVKEGIMLFENDMEKRTCKNCGTLNYSKPQ 176
           DKLRWYCFKCKEVVCELDFQMVDLGTQVKEGIMLFENDMEKRTCKNCGTLNYSKPQ
Sbjct: 121 DKLRWYCFKCKEVVCELDFQMVDLGTQVKEGIMLFENDMEKRTCKNCGTLNYSKPQ 176

>Kwal_33.15522
          Length = 176

 Score =  298 bits (764), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 137/176 (77%), Positives = 154/176 (87%)

Query: 1   MLNTTPINIPKWLEENSHLLQPPVNNYCLHRGGFTVMIIGGPNERTDYHVNPTPEWFHQR 60
           MLNTTPINI KWL+EN HLLQPPVNN+CLHRGGFTVMI+GGPNERTDYHVNPTPEWF+Q+
Sbjct: 1   MLNTTPINIEKWLQENGHLLQPPVNNFCLHRGGFTVMIVGGPNERTDYHVNPTPEWFYQK 60

Query: 61  KGSMTLRVVDESLTDASKFKDVIINEGDSYLLPANVPHNPVRYENTVGIVVEQDRPDGAH 120
           KG MTL+VVDE+L    KFKDV I EGDS+LLPANVPHNPVRY +TVGIVVEQDRP+G H
Sbjct: 61  KGYMTLKVVDETLQGELKFKDVTIEEGDSFLLPANVPHNPVRYADTVGIVVEQDRPEGQH 120

Query: 121 DKLRWYCFKCKEVVCELDFQMVDLGTQVKEGIMLFENDMEKRTCKNCGTLNYSKPQ 176
           DK RWYC KC+EVVCE +FQM+DLGTQVKEGI  F++D   R CK+CGT N+S PQ
Sbjct: 121 DKQRWYCSKCREVVCEFEFQMLDLGTQVKEGIQKFDSDKNFRICKHCGTENFSSPQ 176

>ACL127W [922] [Homologous to ScYJR025C (BNA1) - SH]
           complement(127228..127770) [543 bp, 180 aa]
          Length = 180

 Score =  285 bits (730), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 148/176 (84%)

Query: 1   MLNTTPINIPKWLEENSHLLQPPVNNYCLHRGGFTVMIIGGPNERTDYHVNPTPEWFHQR 60
           MLNTTPINI  WL ENSHLLQPPVNN+CLHRGGFTVM++GGPNERTDYHVNPTPEWF+Q+
Sbjct: 1   MLNTTPINIDAWLAENSHLLQPPVNNFCLHRGGFTVMLVGGPNERTDYHVNPTPEWFYQK 60

Query: 61  KGSMTLRVVDESLTDASKFKDVIINEGDSYLLPANVPHNPVRYENTVGIVVEQDRPDGAH 120
            G+MTLR+VDE L+ A++F+DV I EGDS+LLPANVPHNPVRY +TVGIVVEQDRP G  
Sbjct: 61  TGAMTLRIVDEQLSGAARFRDVTIREGDSFLLPANVPHNPVRYADTVGIVVEQDRPAGHF 120

Query: 121 DKLRWYCFKCKEVVCELDFQMVDLGTQVKEGIMLFENDMEKRTCKNCGTLNYSKPQ 176
           D+LRWYC  C+E+VC+ +F M DL +QV+EGI  F    E R CK+CGTLNY  PQ
Sbjct: 121 DQLRWYCRGCRELVCKYEFYMSDLSSQVREGIERFAASAEDRVCKHCGTLNYPTPQ 176

>YJR025C (BNA1) [2925] chr10 complement(471052..471585)
           3-hydroxyanthranilate 3,4-dioxygenase, involved in
           biosynthesis of nicotinic acid from tryptophan [534 bp,
           177 aa]
          Length = 177

 Score =  276 bits (705), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 153/177 (86%), Gaps = 3/177 (1%)

Query: 1   MLNTTPINIPKWLEENSHLLQPPVNNYCLHRGGFTVMIIGGPNERTDYHVNPTPEWFHQR 60
           M NTTPINI KWL+EN  LL+PPVNNYCLH+GGFTVMI+GGPNERT YH+NPTPEWF+Q+
Sbjct: 1   MFNTTPINIDKWLKENEGLLKPPVNNYCLHKGGFTVMIVGGPNERTGYHINPTPEWFYQK 60

Query: 61  KGSMTLRVVDESLTDAS-KFKDVIINEGDSYLLPANVPHNPVRYENTVGIVVEQDRPDGA 119
           KGSM L+VVDE  TDA  KF D+IINEGDSYLLP NVPH+PVR+ +TVGIVVEQDRP G 
Sbjct: 61  KGSMLLKVVDE--TDAEPKFIDIIINEGDSYLLPGNVPHSPVRFADTVGIVVEQDRPGGE 118

Query: 120 HDKLRWYCFKCKEVVCELDFQMVDLGTQVKEGIMLFENDMEKRTCKNCGTLNYSKPQ 176
           +DK+RWYC  C++VV E + QM+DLGTQVKE I+ FEND+EKRTC +C TLNY++PQ
Sbjct: 119 NDKIRWYCSHCRQVVHESELQMLDLGTQVKEAILDFENDVEKRTCFHCKTLNYARPQ 175

>Scas_666.22
          Length = 484

 Score = 30.0 bits (66), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 11/46 (23%), Positives = 26/46 (56%)

Query: 79  FKDVIINEGDSYLLPANVPHNPVRYENTVGIVVEQDRPDGAHDKLR 124
            KD++++E D+YL  A +    + Y+    +++ + + D +H  +R
Sbjct: 272 LKDILLDEVDAYLYIAGLDQLVIGYDARDSLLINKVKQDNSHKNIR 317

>AER347W [2848] [Homologous to ScYMR215W - SH]
           complement(1273251..1274720) [1470 bp, 489 aa]
          Length = 489

 Score = 29.3 bits (64), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 22/39 (56%)

Query: 84  INEGDSYLLPANVPHNPVRYENTVGIVVEQDRPDGAHDK 122
           I + D+ ++PA V ++P  ++N++G VV    P     +
Sbjct: 420 IYDSDNKVVPATVSYDPANFQNSLGTVVSVSAPSSTQSE 458

>Kwal_26.8590
          Length = 621

 Score = 28.1 bits (61), Expect = 4.8,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 14  EENSHLLQPPVNNYCLHRG--GFTVMIIGG--PNERTDYHVNPTPEWFHQRKG 62
           EE+  +++ P++NY L RG   FT        P E +   + P+P W   ++G
Sbjct: 418 EEDEEVVETPMDNYLLTRGIQSFTKNRYSNILPYEHSRVKLEPSPIWPDNKQG 470

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.138    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,664,775
Number of extensions: 290200
Number of successful extensions: 593
Number of sequences better than 10.0: 8
Number of HSP's gapped: 592
Number of HSP's successfully gapped: 8
Length of query: 176
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 81
Effective length of database: 13,307,399
Effective search space: 1077899319
Effective search space used: 1077899319
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 58 (26.9 bits)