Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1267.227327314410.0
Kwal_33.1545324524511461e-160
Scas_647.724624611331e-158
YGR195W (SKI6)24624611061e-154
CAGL0G09317g24624610961e-153
KLLA0D09625g24524510931e-152
ACR035W24624310761e-150
Sklu_1989.12231411318e-09
KLLA0D14993g2251491272e-08
Scas_716.302281371254e-08
YGR095C (RRP46)2231411202e-07
CAGL0G03113g2331381167e-07
Sklu_1879.12381881168e-07
KLLA0F18304g2361401122e-06
Kwal_23.39692241391113e-06
AFR109W2371391105e-06
Scas_621.172391291025e-05
AAR035C25297850.007
CAGL0E03223g248147730.21
YGR158C (MTR3)25084671.4
KLLA0C08976g91153628.3
Scas_720.83d915536110.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1267.2
         (273 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1267.2 YGR195W, Contig c1267 529-1350                            559   0.0  
Kwal_33.15453                                                         446   e-160
Scas_647.7                                                            441   e-158
YGR195W (SKI6) [2145] chr7 (888885..889625) Component of the exo...   430   e-154
CAGL0G09317g complement(890158..890898) highly similar to sp|P46...   426   e-153
KLLA0D09625g complement(813773..814510) highly similar to sp|P46...   425   e-152
ACR035W [1083] [Homologous to ScYGR195W (SKI6) - SH] complement(...   419   e-150
Sklu_1989.1 YGR095C, Contig c1989 348-1019                             55   8e-09
KLLA0D14993g complement(1266752..1267429) similar to sp|P53256 S...    54   2e-08
Scas_716.30                                                            53   4e-08
YGR095C (RRP46) [2055] chr7 complement(675673..676344) Protein c...    51   2e-07
CAGL0G03113g complement(289747..290448) similar to sp|P53256 Sac...    49   7e-07
Sklu_1879.1 YGR158C, Contig c1879 329-1045 reverse complement          49   8e-07
KLLA0F18304g complement(1689187..1689897) similar to sp|P48240 S...    48   2e-06
Kwal_23.3969                                                           47   3e-06
AFR109W [3301] [Homologous to ScYGR158C (MTR3) - SH] complement(...    47   5e-06
Scas_621.17                                                            44   5e-05
AAR035C [221] [Homologous to ScYGR095C (RRP46) - SH] (406091..40...    37   0.007
CAGL0E03223g complement(297800..298546) similar to sp|P48240 Sac...    33   0.21 
YGR158C (MTR3) [2112] chr7 complement(805272..806024) Protein in...    30   1.4  
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    28   8.3  
Scas_720.83d                                                           28   10.0 

>Sklu_1267.2 YGR195W, Contig c1267 529-1350
          Length = 273

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/273 (100%), Positives = 273/273 (100%)

Query: 1   MKNFDTGKRSSHQSLGPVEFERRILRTMSRLEIYSPEGLRLDGRRWNELRRFDCSINTHP 60
           MKNFDTGKRSSHQSLGPVEFERRILRTMSRLEIYSPEGLRLDGRRWNELRRFDCSINTHP
Sbjct: 1   MKNFDTGKRSSHQSLGPVEFERRILRTMSRLEIYSPEGLRLDGRRWNELRRFDCSINTHP 60

Query: 61  NAADGSSYLEQGNNKIITLVNGPQEPALRSQTNPSHATMNVTVNITKFSKMERSKSSHKN 120
           NAADGSSYLEQGNNKIITLVNGPQEPALRSQTNPSHATMNVTVNITKFSKMERSKSSHKN
Sbjct: 61  NAADGSSYLEQGNNKIITLVNGPQEPALRSQTNPSHATMNVTVNITKFSKMERSKSSHKN 120

Query: 121 ERRVLEMQTSLVRTFEKNVMLQLYPRTLIDIQIHVLQQDGGIMGALINGITLALIDAGIA 180
           ERRVLEMQTSLVRTFEKNVMLQLYPRTLIDIQIHVLQQDGGIMGALINGITLALIDAGIA
Sbjct: 121 ERRVLEMQTSLVRTFEKNVMLQLYPRTLIDIQIHVLQQDGGIMGALINGITLALIDAGIA 180

Query: 181 MYDYISGVSIGLYDTTPLLDLNSLEENAMSSITLGVVGKSEKLSLLLVEDKVPLDRFESV 240
           MYDYISGVSIGLYDTTPLLDLNSLEENAMSSITLGVVGKSEKLSLLLVEDKVPLDRFESV
Sbjct: 181 MYDYISGVSIGLYDTTPLLDLNSLEENAMSSITLGVVGKSEKLSLLLVEDKVPLDRFESV 240

Query: 241 LAIGIAGAHIIRDLMDKELRRHGEKRLTNASSK 273
           LAIGIAGAHIIRDLMDKELRRHGEKRLTNASSK
Sbjct: 241 LAIGIAGAHIIRDLMDKELRRHGEKRLTNASSK 273

>Kwal_33.15453
          Length = 245

 Score =  446 bits (1146), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 213/245 (86%), Positives = 232/245 (94%)

Query: 28  MSRLEIYSPEGLRLDGRRWNELRRFDCSINTHPNAADGSSYLEQGNNKIITLVNGPQEPA 87
           MSRLEIYSPEGLR+DGRRWNELRR +C+INTH NA+DGSSYLEQGNNKIITLVNGPQEP 
Sbjct: 1   MSRLEIYSPEGLRVDGRRWNELRRLECAINTHANASDGSSYLEQGNNKIITLVNGPQEPK 60

Query: 88  LRSQTNPSHATMNVTVNITKFSKMERSKSSHKNERRVLEMQTSLVRTFEKNVMLQLYPRT 147
           LRSQ N + AT++V VNIT+FSK+ERSKSSHKNERRVLEMQT+LVRTFEKNVML LYPRT
Sbjct: 61  LRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERRVLEMQTALVRTFEKNVMLHLYPRT 120

Query: 148 LIDIQIHVLQQDGGIMGALINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSLEEN 207
            IDIQIHVLQQDGG+MG+LINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNS+EEN
Sbjct: 121 QIDIQIHVLQQDGGLMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSVEEN 180

Query: 208 AMSSITLGVVGKSEKLSLLLVEDKVPLDRFESVLAIGIAGAHIIRDLMDKELRRHGEKRL 267
           AMSS+TLGVVGKSEKLSLLLVEDK+PLDR ESVLAIGIAG+H IR+LMD+ELR+HGEKRL
Sbjct: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLESVLAIGIAGSHRIRELMDQELRKHGEKRL 240

Query: 268 TNASS 272
            N SS
Sbjct: 241 ANKSS 245

>Scas_647.7
          Length = 246

 Score =  441 bits (1133), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 207/246 (84%), Positives = 231/246 (93%)

Query: 28  MSRLEIYSPEGLRLDGRRWNELRRFDCSINTHPNAADGSSYLEQGNNKIITLVNGPQEPA 87
           MSRLEIYSPEGLRLDGRRWNELRRF+CSINTH +A+DGSSYLEQGNNK+ITLV GP+EP 
Sbjct: 1   MSRLEIYSPEGLRLDGRRWNELRRFECSINTHSHASDGSSYLEQGNNKVITLVKGPKEPT 60

Query: 88  LRSQTNPSHATMNVTVNITKFSKMERSKSSHKNERRVLEMQTSLVRTFEKNVMLQLYPRT 147
           LRSQ +   A + ++VNIT+FSK ERSKSSHKNERRVLEMQT+L+RTFEKNVML +YPRT
Sbjct: 61  LRSQMDTEKAILKISVNITQFSKFERSKSSHKNERRVLEMQTALIRTFEKNVMLNIYPRT 120

Query: 148 LIDIQIHVLQQDGGIMGALINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSLEEN 207
           LIDI++HVLQQDGGIMG+LINGITLALIDAGIAMYDYISGVSIGLYDTTPLLD+NSLEEN
Sbjct: 121 LIDIEVHVLQQDGGIMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDVNSLEEN 180

Query: 208 AMSSITLGVVGKSEKLSLLLVEDKVPLDRFESVLAIGIAGAHIIRDLMDKELRRHGEKRL 267
           AMSS+TLGVVGKSEKLSLLLVEDK+PLDR E+VLAIGIAGAH +RDLMD+ELR+H EKR+
Sbjct: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLETVLAIGIAGAHRVRDLMDEELRKHAEKRV 240

Query: 268 TNASSK 273
            NASSK
Sbjct: 241 ANASSK 246

>YGR195W (SKI6) [2145] chr7 (888885..889625) Component of the
           exosome 3'-5' exoribonuclease complex involved in 3'
           processing of ribosomal 5.8S rRNA, of snoRNAs and of U4
           snRNA, and in degradation of poly(A)- mRNAs, confers
           antiviral activity by repressing replication of
           double-stranded RNA viruses [741 bp, 246 aa]
          Length = 246

 Score =  430 bits (1106), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 202/246 (82%), Positives = 232/246 (94%)

Query: 28  MSRLEIYSPEGLRLDGRRWNELRRFDCSINTHPNAADGSSYLEQGNNKIITLVNGPQEPA 87
           MSRLEIYSPEGLRLDGRRWNELRRF+ SINTHP+AADGSSY+EQGNNKIITLV GP+EP 
Sbjct: 1   MSRLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPR 60

Query: 88  LRSQTNPSHATMNVTVNITKFSKMERSKSSHKNERRVLEMQTSLVRTFEKNVMLQLYPRT 147
           L+SQ + S A +NV+VNITKFSK ERSKSSHKNERRVLE+QTSLVR FEKNVML +YPRT
Sbjct: 61  LKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPRT 120

Query: 148 LIDIQIHVLQQDGGIMGALINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSLEEN 207
           +IDI+IHVL+QDGGIMG+LINGITLALIDAGI+M+DYISG+S+GLYDTTPLLD NSLEEN
Sbjct: 121 VIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGISVGLYDTTPLLDTNSLEEN 180

Query: 208 AMSSITLGVVGKSEKLSLLLVEDKVPLDRFESVLAIGIAGAHIIRDLMDKELRRHGEKRL 267
           AMS++TLGVVGKSEKLSLLLVEDK+PLDR E+VLAIGIAGAH +RDLMD+ELR+H +KR+
Sbjct: 181 AMSTVTLGVVGKSEKLSLLLVEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRV 240

Query: 268 TNASSK 273
           +NAS++
Sbjct: 241 SNASAR 246

>CAGL0G09317g complement(890158..890898) highly similar to sp|P46948
           Saccharomyces cerevisiae YGR195w SKI6 3-5
           exoribonuclease required for 3 end formation of 5.8S
           rRNA, start by similarity
          Length = 246

 Score =  426 bits (1096), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 199/246 (80%), Positives = 227/246 (92%)

Query: 28  MSRLEIYSPEGLRLDGRRWNELRRFDCSINTHPNAADGSSYLEQGNNKIITLVNGPQEPA 87
           MSR+EIYSPEGLRLDGRRWNELRRF+ +INTHP+AADGSSYLEQGNNK+ITLV GP+EP 
Sbjct: 1   MSRVEIYSPEGLRLDGRRWNELRRFESAINTHPHAADGSSYLEQGNNKVITLVKGPKEPT 60

Query: 88  LRSQTNPSHATMNVTVNITKFSKMERSKSSHKNERRVLEMQTSLVRTFEKNVMLQLYPRT 147
           L+SQ +   A + VTVNITKFSK ERSKSSHKNERRVLEMQT+LVRTFEKNVML +YPRT
Sbjct: 61  LKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERRVLEMQTALVRTFEKNVMLHVYPRT 120

Query: 148 LIDIQIHVLQQDGGIMGALINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSLEEN 207
           LIDI+IHVLQQDGGIMG L+NGI+LALIDAGIAMYDY+SG+S+GLYDTTPLLD+NSLEEN
Sbjct: 121 LIDIEIHVLQQDGGIMGTLLNGISLALIDAGIAMYDYVSGISVGLYDTTPLLDINSLEEN 180

Query: 208 AMSSITLGVVGKSEKLSLLLVEDKVPLDRFESVLAIGIAGAHIIRDLMDKELRRHGEKRL 267
           AMS++TLGVVGKSEKLSLL +EDK+PLDR E+VLAIGIAGAH IRDLM++E+R H EKR+
Sbjct: 181 AMSAVTLGVVGKSEKLSLLQIEDKIPLDRIENVLAIGIAGAHRIRDLMEQEIRAHAEKRV 240

Query: 268 TNASSK 273
            NAS +
Sbjct: 241 ANASKQ 246

>KLLA0D09625g complement(813773..814510) highly similar to sp|P46948
           Saccharomyces cerevisiae YGR195w SKI6 3 -5
           exoribonuclease required for 3 end formation of 5.8S
           rRNA singleton, start by similarity
          Length = 245

 Score =  425 bits (1093), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 197/245 (80%), Positives = 224/245 (91%)

Query: 28  MSRLEIYSPEGLRLDGRRWNELRRFDCSINTHPNAADGSSYLEQGNNKIITLVNGPQEPA 87
           MSR EIYSPEGLR+DGRRWNELR F+CSINTHPNAADGSSYLEQGNNKIITLV GPQEP+
Sbjct: 1   MSRFEIYSPEGLRVDGRRWNELRSFNCSINTHPNAADGSSYLEQGNNKIITLVAGPQEPS 60

Query: 88  LRSQTNPSHATMNVTVNITKFSKMERSKSSHKNERRVLEMQTSLVRTFEKNVMLQLYPRT 147
            RSQ N   AT++VT+N+TKF+KMERSKSSHKNERR LE Q SLVRTFEKN+ML LYPRT
Sbjct: 61  SRSQVNTKQATLSVTINLTKFAKMERSKSSHKNERRTLEWQASLVRTFEKNLMLHLYPRT 120

Query: 148 LIDIQIHVLQQDGGIMGALINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSLEEN 207
            ID+Q+H LQ DGGI+GA++NGITLALIDAGIAMYD++SGVS+GLYDTTPLLDLNSLEEN
Sbjct: 121 SIDVQVHALQLDGGILGAMLNGITLALIDAGIAMYDFVSGVSVGLYDTTPLLDLNSLEEN 180

Query: 208 AMSSITLGVVGKSEKLSLLLVEDKVPLDRFESVLAIGIAGAHIIRDLMDKELRRHGEKRL 267
           AMSS+T+G +GKSEKLSLL+VEDKVPLDR ESV+AIGIAG H IRDLMDKELR+HG+ R+
Sbjct: 181 AMSSVTIGTIGKSEKLSLLMVEDKVPLDRLESVMAIGIAGTHRIRDLMDKELRKHGKTRV 240

Query: 268 TNASS 272
            N+S+
Sbjct: 241 ENSSN 245

>ACR035W [1083] [Homologous to ScYGR195W (SKI6) - SH]
           complement(422233..422973) [741 bp, 246 aa]
          Length = 246

 Score =  419 bits (1076), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 194/243 (79%), Positives = 220/243 (90%)

Query: 28  MSRLEIYSPEGLRLDGRRWNELRRFDCSINTHPNAADGSSYLEQGNNKIITLVNGPQEPA 87
           M + EIYSPEGLRLDGRRWNELRRF+CSINTHP AADGSSYLEQGNNK+ITLV GP EPA
Sbjct: 1   MFKTEIYSPEGLRLDGRRWNELRRFECSINTHPTAADGSSYLEQGNNKLITLVTGPHEPA 60

Query: 88  LRSQTNPSHATMNVTVNITKFSKMERSKSSHKNERRVLEMQTSLVRTFEKNVMLQLYPRT 147
           LRSQ NPS AT+ VTVN+TKF+  ERSK+ HKNERR+LEMQT+LVRTFEKNVMLQLYPRT
Sbjct: 61  LRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERRILEMQTALVRTFEKNVMLQLYPRT 120

Query: 148 LIDIQIHVLQQDGGIMGALINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSLEEN 207
            ID+Q+HVLQ DGG++G++INGITLALIDAGIAMY+YISG+S+GLYDTTPLLDLN LEE 
Sbjct: 121 AIDVQVHVLQNDGGVLGSMINGITLALIDAGIAMYEYISGISVGLYDTTPLLDLNRLEEQ 180

Query: 208 AMSSITLGVVGKSEKLSLLLVEDKVPLDRFESVLAIGIAGAHIIRDLMDKELRRHGEKRL 267
           AMS  TLGVVGKSEKLSLLLVEDKVPLDR ESV+++GIAG H +RD+MDK LR+HG+ RL
Sbjct: 181 AMSCFTLGVVGKSEKLSLLLVEDKVPLDRLESVMSLGIAGTHRVRDMMDKVLRQHGKIRL 240

Query: 268 TNA 270
            N+
Sbjct: 241 ENS 243

>Sklu_1989.1 YGR095C, Contig c1989 348-1019
          Length = 223

 Score = 55.1 bits (131), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 59/141 (41%), Gaps = 18/141 (12%)

Query: 61  NAADGSSYLEQGNNKIITLVNGPQEPALRSQTNPSHATMNVTVNITKFSKMERSKSSHKN 120
           +  DGSS +E    K+I  V GP EP  R Q  P+   + + V  +K     R K     
Sbjct: 10  DQVDGSSQVECSATKVICSVTGPVEPKAR-QELPTQLALEIVVRPSKGVPNTREKLMEDK 68

Query: 121 ERRVLEMQTSLVRTFEKNVMLQLYPRTLIDIQIHVL-------QQDGGIMGALINGITLA 173
            R VL     LVR         LYPR L  +   VL       Q     +G  IN   LA
Sbjct: 69  IRGVLT--PVLVRY--------LYPRQLCQLTFQVLESGESEEQYTVKELGCCINAAYLA 118

Query: 174 LIDAGIAMYDYISGVSIGLYD 194
           L+DAGIA+      V I + +
Sbjct: 119 LVDAGIALKSSFVSVPICILE 139

>KLLA0D14993g complement(1266752..1267429) similar to sp|P53256
           Saccharomyces cerevisiae YGR095c RRP46 involved in rRNA
           processing singleton, hypothetical start
          Length = 225

 Score = 53.5 bits (127), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 66/149 (44%), Gaps = 17/149 (11%)

Query: 63  ADGSSYLEQGNNKIITLVNGPQEPALRSQTNPSHATMNVTVNITKFSKMERSKSSHKNER 122
            DGSS +     K+I  V+GP EP  R Q  P+   + + V   +  +  R K      R
Sbjct: 11  VDGSSVVSNSGTKVICSVSGPMEPKSR-QELPTQLALEIIVKPAEGVQSTREKLMEDQIR 69

Query: 123 RVLEMQTSLVRTFEKNVMLQLYPRTLIDIQIHVLQ----QDGGI--MGALINGITLALID 176
            VL   T ++  +       L+PR  + I + VL+    +D  +  +   +N   LAL+D
Sbjct: 70  SVL---TPVLARY-------LHPRQFVQICLQVLEAGESRDYTVKEVSVCVNAAVLALVD 119

Query: 177 AGIAMYDYISGVSIGLYDTTPLLDLNSLE 205
           AG+ +    SG  IG+      L +N  E
Sbjct: 120 AGVPLLSMCSGTCIGITTEGKQLVVNPTE 148

>Scas_716.30
          Length = 228

 Score = 52.8 bits (125), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 56/137 (40%), Gaps = 18/137 (13%)

Query: 63  ADGSSYLEQGNNKIITLVNGPQEPALRSQTNPSHATMNVTVNITKFSKMERSKSSHKNER 122
            DGSS +E    KII  V GP EP  R Q  P+   + + +         R  +   N R
Sbjct: 13  VDGSSLIESKQTKIICSVTGPIEPKSR-QELPTQLALEIII---------RPAAGVPNTR 62

Query: 123 RVLEMQTSLVRTFEKNVMLQLYPRTLIDIQIHVLQQDGG-------IMGALINGITLALI 175
             L M+  L       +   LYPR L  I + +L             +   IN   +ALI
Sbjct: 63  EKL-MEDKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIALI 121

Query: 176 DAGIAMYDYISGVSIGL 192
           DAGIA+    + V I L
Sbjct: 122 DAGIALNSMCACVPIAL 138

>YGR095C (RRP46) [2055] chr7 complement(675673..676344) Protein
           component of the exosome 3'-5' exoribonuclease complex
           involved in 3'end processing of multiple small RNA
           species [672 bp, 223 aa]
          Length = 223

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 57/141 (40%), Gaps = 18/141 (12%)

Query: 63  ADGSSYLEQGNNKIITLVNGPQEPALRSQTNPSHATMNVTVNITKFSKMERSKSSHKNER 122
            DGSS     + K+I  V GP EP  R Q  P+   + + V   K     R K      R
Sbjct: 13  VDGSSEFVSQDTKVICSVTGPIEPKAR-QELPTQLALEIIVRPAKGVATTREKVLEDKLR 71

Query: 123 RVLEMQTSLVRTFEKNVMLQLYPRTLIDIQIHVLQ--QDGGI-----MGALINGITLALI 175
            VL   T L+           YPR L  I   +L+  +D        +   IN   LAL+
Sbjct: 72  AVL---TPLITR-------HCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALV 121

Query: 176 DAGIAMYDYISGVSIGLYDTT 196
           DAGIA+    + + I +   T
Sbjct: 122 DAGIALNSMCASIPIAIIKDT 142

>CAGL0G03113g complement(289747..290448) similar to sp|P53256
           Saccharomyces cerevisiae YGR095c RRP46 involved in rRNA
           processing, hypothetical start
          Length = 233

 Score = 49.3 bits (116), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 59/138 (42%), Gaps = 18/138 (13%)

Query: 64  DGSSYLEQGNNKIITLVNGPQEPALRSQTNPSHATMNVTVNITKFSKMERSKSSHKNERR 123
           DGS+ L   +  ++  V GP EP  R Q  P+   + V V   K     R K      R 
Sbjct: 16  DGSAKLLMNSTNVLCAVTGPVEPKAR-QELPTEMALEVIVRPAKGVPTPREKYLEDKIRA 74

Query: 124 VLEMQTSLVRTFEKNVMLQLYPRTLIDIQIHVLQ-------QDGGIMGALINGITLALID 176
           +    T L+   +       YPR L  I   +++        +   + A +N   LAL++
Sbjct: 75  IF---TPLITRHK-------YPRQLCQITCQIMEAGENEQLHNQKELSACVNSALLALVN 124

Query: 177 AGIAMYDYISGVSIGLYD 194
           AG+A+ D  + V+I + D
Sbjct: 125 AGVALNDLAAAVTIAVID 142

>Sklu_1879.1 YGR158C, Contig c1879 329-1045 reverse complement
          Length = 238

 Score = 49.3 bits (116), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 84/188 (44%), Gaps = 41/188 (21%)

Query: 17  PVEFERRILRTMSRLEIYSPEGLRLDGRRWNELRRFDCSINTHPNAADGSSYLE------ 70
           P++F    + T S+ E  +P+   L           +  + ++ N   GSSYLE      
Sbjct: 17  PIQFSSSTMETTSKEESTTPDKESL---------FIESGLISNSN---GSSYLEVTDENK 64

Query: 71  -QGNNKIITLVNGPQEPALRSQTNPSHATMNVT-VNITKFSKMERSKSSHKNERRVLEMQ 128
            Q +  +IT V GP+ P   S T+ +  T+    V + KF+  E           + E+ 
Sbjct: 65  TQYHALLITSVYGPR-PIRGSFTSRASLTIQFKEVTLEKFTTGE-----------IKEVC 112

Query: 129 TSLVRTFEKNVMLQLYPRTLIDIQIHVLQQD---------GGIMGALINGITLALIDAGI 179
             L   F   V L+ YP++ IDI ++++Q             ++   INGITLAL +AGI
Sbjct: 113 NFLTNIFNAVVNLERYPKSGIDIFLNLIQHSSTDNQETDIASVIPTCINGITLALTNAGI 172

Query: 180 AMYDYISG 187
            + D +S 
Sbjct: 173 EILDMVSA 180

>KLLA0F18304g complement(1689187..1689897) similar to sp|P48240
           Saccharomyces cerevisiae YGR158c MTR3 involved in mRNA
           transport singleton, start by similarity
          Length = 236

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 66/140 (47%), Gaps = 26/140 (18%)

Query: 63  ADGSSYLEQGNNK-----IITLVNGPQEPALRSQTNPSHATMNVTVNITKFSKMERSKSS 117
           A+GSSYLE  +       +++ V GP+   LR     S A++++        + +     
Sbjct: 55  ANGSSYLEYMDGTSDQVLVMSSVFGPR--PLRGSFQ-SKASVSI--------QFKEVTLE 103

Query: 118 HKNERRVLEMQTSLVRTFEKNVMLQLYPRTLIDIQIHVLQQDGG----------IMGALI 167
           H N   + E+ T L   F   + ++ YP++ IDI I ++Q              I+   I
Sbjct: 104 HLNTGEIKEICTFLTNVFNAVINVEKYPKSGIDIFIDLIQHSNSNPTEEANIVNILPTCI 163

Query: 168 NGITLALIDAGIAMYDYISG 187
           N IT+AL+DAGI + D +S 
Sbjct: 164 NSITMALVDAGIEIIDLVSA 183

>Kwal_23.3969
          Length = 224

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 58/139 (41%), Gaps = 18/139 (12%)

Query: 61  NAADGSSYLEQGNNKIITLVNGPQEPALRSQTNPSHATMNVTVNITKFSKMERSKSSHKN 120
           +  DGS  ++ G   ++  V GP EP  R Q  PS   + + V   K     R K     
Sbjct: 10  DQVDGSCKIQCGETSVLCSVTGPIEPKAR-QELPSQLALEIVVRPCKGVPNTREKLLEDQ 68

Query: 121 ERRVLEMQTSLVRTFEKNVMLQLYPRTLIDIQIHVLQQ---DGGI----MGALINGITLA 173
            R VL   T ++  +       LYPR L  I   +L+    D       + + IN   LA
Sbjct: 69  IRGVL---TPILARY-------LYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLA 118

Query: 174 LIDAGIAMYDYISGVSIGL 192
           LID+GI +    + V + +
Sbjct: 119 LIDSGIGLQSSFASVCLSV 137

>AFR109W [3301] [Homologous to ScYGR158C (MTR3) - SH]
           complement(632965..633678) [714 bp, 237 aa]
          Length = 237

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 67/139 (48%), Gaps = 25/139 (17%)

Query: 63  ADGSSYLE----QGNNKIITLVNGPQEPALRSQTNPSHATMNVTVNITKFSKMERSKSSH 118
           A+GSSYLE      N  ++T   GP+ P   S T  S A ++V     K   +ER  S  
Sbjct: 54  ANGSSYLEVKAETHNTLLVTTAYGPR-PIRGSFT--SRAAISVHF---KEVTLERWDSGE 107

Query: 119 KNERRVLEMQTSLVRTFEKNVMLQLYPRTLIDIQIHVLQQD----------GGIMGALIN 168
                V EM   L   F   + ++ YP++ IDI ++++Q              ++   I+
Sbjct: 108 -----VTEMCNFLNTVFSAAINVERYPKSGIDIFLNLIQHSNVRDDKTLNLAEVLPDCIS 162

Query: 169 GITLALIDAGIAMYDYISG 187
           GITLAL+DAGI + D ++ 
Sbjct: 163 GITLALMDAGIELKDVVAA 181

>Scas_621.17
          Length = 239

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 65/129 (50%), Gaps = 15/129 (11%)

Query: 63  ADGSSYLEQGNNKIITLVNGPQEPALRSQTNPSHATMNVTVNITKFSKMERSKSSHKNER 122
            +GS+ +E     ++T V GP+  ++R  +  S  T+ +        +++     +    
Sbjct: 56  CNGSTLIESSKFSLLTSVYGPK--SIRG-SFTSQGTITI--------QLKNGVVENYQTT 104

Query: 123 RVLEMQTSLVRTFEKNVMLQLYPRTLIDIQIHVLQQDGG----IMGALINGITLALIDAG 178
            + E+ + LV  F   V L+ YP++ IDI ++++    G    ++  LI GI LAL+D G
Sbjct: 105 ELKEVSSWLVGIFNSVVNLENYPKSGIDIFVNLIIDKQGDISKLIPFLIMGICLALVDGG 164

Query: 179 IAMYDYISG 187
           I + D ++G
Sbjct: 165 IEIIDIVTG 173

>AAR035C [221] [Homologous to ScYGR095C (RRP46) - SH]
           (406091..406849) [759 bp, 252 aa]
          Length = 252

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 40/97 (41%), Gaps = 11/97 (11%)

Query: 64  DGSSYLEQGNNKIITLVNGPQEPALRSQTNPSHATMNVTVNITKFSKMERSKSSHKNERR 123
           DGSS         I  V+GP EP  R +  P H  ++V V         R K     E +
Sbjct: 48  DGSSKFSTAAASAICGVSGPIEPKARQEI-PQHLALDVIVRPAAGPPTTREK---LLEDK 103

Query: 124 VLEMQTSLVRTFEKNVMLQLYPRTLIDIQIHVLQQDG 160
           V    T +V TF       L+PR L  I + VL+  G
Sbjct: 104 VRATITPVVETF-------LHPRQLCQITLQVLKSVG 133

>CAGL0E03223g complement(297800..298546) similar to sp|P48240
           Saccharomyces cerevisiae YGR158c MTR3 involved in mRNA
           transport, start by similarity
          Length = 248

 Score = 32.7 bits (73), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 62/147 (42%), Gaps = 37/147 (25%)

Query: 63  ADGSSYLEQGNNKI-------ITLVNGPQEPALRSQTNPSHATMNVTVNITKFSKMERSK 115
            +GS+ +E  + KI       IT V GP+  ++R     S A++++ +      K E   
Sbjct: 51  CNGSALVEIKDTKITHHQTSLITSVYGPK--SVRGSFT-SQASLSIQLKNGLLEKYE--- 104

Query: 116 SSHKNERRVLEMQTSLVRTFEKNVMLQLYPRTLIDIQIHVLQQDG--------------- 160
                 R + E+   L   F   + L+ YP++ IDI I++  +                 
Sbjct: 105 -----SRELKEVANFLTSIFNSVINLKRYPKSGIDIFIYITYEKSLENFKEQEPAAPVRK 159

Query: 161 ----GIMGALINGITLALIDAGIAMYD 183
                I+   I+ IT+ALIDA I + D
Sbjct: 160 SNIYKILPHCISSITMALIDADIEIID 186

>YGR158C (MTR3) [2112] chr7 complement(805272..806024) Protein
           involved in mRNA transport, component of the exosome
           complex responsible for 3'-5' degradation of mRNA and
           for 3'-end processing of multiple small RNA species [753
           bp, 250 aa]
          Length = 250

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 35/84 (41%), Gaps = 20/84 (23%)

Query: 120 NERRVLEMQTSLVRTFEKNVMLQLYPRTLIDIQIHVL--------------------QQD 159
           N   + E+ + L+  F   V L  YP++ IDI +++                      Q 
Sbjct: 106 NTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNNPQDDDSQSKMMSSQI 165

Query: 160 GGIMGALINGITLALIDAGIAMYD 183
             ++   I  ITLAL DAGI + D
Sbjct: 166 SSLIPHCITSITLALADAGIELVD 189

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 28.5 bits (62), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 25/53 (47%)

Query: 64  DGSSYLEQGNNKIITLVNGPQEPALRSQTNPSHATMNVTVNITKFSKMERSKS 116
           DG S +  GNN  I L + P E  LR  T   +  +N T+     S+M  + S
Sbjct: 584 DGLSLVAAGNNNSICLYDIPNEVLLRRFTVSKNMMLNGTMEFLNSSRMTEAGS 636

>Scas_720.83d
          Length = 915

 Score = 28.1 bits (61), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%)

Query: 64  DGSSYLEQGNNKIITLVNGPQEPALRSQTNPSHATMNVTVNITKFSKMERSKS 116
           DG + +  GNN  I L + P E  L+  T   + T+N T+     S+M  + S
Sbjct: 586 DGMALVAGGNNNSICLYDVPNEVLLKRFTVSRNMTLNGTLEFLNSSRMTEAGS 638

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,433,918
Number of extensions: 347131
Number of successful extensions: 1113
Number of sequences better than 10.0: 33
Number of HSP's gapped: 1100
Number of HSP's successfully gapped: 33
Length of query: 273
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 173
Effective length of database: 13,134,309
Effective search space: 2272235457
Effective search space used: 2272235457
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)