Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1262.128328313740.0
Kwal_14.11362862827336e-97
YPR061C (JID1)3012925661e-71
CAGL0D01584g3002555512e-69
KLLA0B08459g2952575201e-64
ADL327W3052464383e-52
Scas_667.242852803632e-41
Sklu_1935.146132710.55
AER427W47026700.73
Kwal_23.483041133700.77
KLLA0D04818g35443691.0
Scas_488.336736691.0
CAGL0H03707g34936681.3
Kwal_23.306145845681.3
YNL007C (SIS1)35236681.3
YMR161W (HLJ1)22422661.6
CAGL0H04499g23222661.7
CAGL0J09966g40734671.8
KLLA0F03333g40934671.8
Sklu_2442.134836662.2
YNL077W (APJ1)52832662.4
CAGL0J10296g47926652.7
Scas_669.222422643.0
Scas_644.10512186653.1
Scas_694.2041033653.3
YMR214W (SCJ1)37724643.4
KLLA0C07260g36825643.4
ADL257C41034643.6
AAL008W34943634.6
Scas_709.341444634.9
YIR004W (DJP1)43244635.0
ADR124C61146635.3
Kwal_0.20735324626.0
Kwal_26.902437528617.7
Scas_564.1*45744618.5
Scas_721.9848442618.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1262.1
         (283 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1262.1 YPR061C, Contig c1262 1479-2330                           533   0.0  
Kwal_14.1136                                                          286   6e-97
YPR061C (JID1) [5490] chr16 complement(675972..676877) Member of...   222   1e-71
CAGL0D01584g 167879..168781 similar to tr|Q12350 Saccharomyces c...   216   2e-69
KLLA0B08459g 751178..752065 weakly similar to sgd|S0006265 Sacch...   204   1e-64
ADL327W [1414] [Homologous to ScYPR061C - SH] complement(123853....   173   3e-52
Scas_667.24                                                           144   2e-41
Sklu_1935.1 YNL077W, Contig c1935 224-1609                             32   0.55 
AER427W [2927] [Homologous to ScYNL077W - SH] complement(1456998...    32   0.73 
Kwal_23.4830                                                           32   0.77 
KLLA0D04818g complement(411615..412679) similar to sp|P25294 Sac...    31   1.0  
Scas_488.3                                                             31   1.0  
CAGL0H03707g complement(341230..342279) highly similar to sp|P25...    31   1.3  
Kwal_23.3061                                                           31   1.3  
YNL007C (SIS1) [4578] chr14 complement(618506..619564) Protein r...    31   1.3  
YMR161W (HLJ1) [4116] chr13 (577717..578391) Endoplasmic reticul...    30   1.6  
CAGL0H04499g complement(427509..428207) similar to sp|P48353 Sac...    30   1.7  
CAGL0J09966g complement(976568..977791) highly similar to sp|P25...    30   1.8  
KLLA0F03333g complement(313991..315220) similar to sp|P25491 Sac...    30   1.8  
Sklu_2442.1 YNL007C, Contig c2442 2508-3554 reverse complement         30   2.2  
YNL077W (APJ1) [4513] chr14 (481390..482976) Protein induced by ...    30   2.4  
CAGL0J10296g complement(1004500..1005939) similar to sp|P53940 S...    30   2.7  
Scas_669.2                                                             29   3.0  
Scas_644.10                                                            30   3.1  
Scas_694.20                                                            30   3.3  
YMR214W (SCJ1) [4170] chr13 (695349..696482) Homolog of E. coli ...    29   3.4  
KLLA0C07260g complement(632987..634093) similar to sp|P25303 Sac...    29   3.4  
ADL257C [1484] [Homologous to ScYNL064C (YDJ1) - SH] (249514..25...    29   3.6  
AAL008W [179] [Homologous to ScYNL007C (SIS1) - SH] complement(3...    29   4.6  
Scas_709.3                                                             29   4.9  
YIR004W (DJP1) [2669] chr9 (363218..364516) Protein required for...    29   5.0  
ADR124C [1865] [Homologous to ScYJL073W (JEM1) - SH] (926131..92...    29   5.3  
Kwal_0.207                                                             28   6.0  
Kwal_26.9024                                                           28   7.7  
Scas_564.1*                                                            28   8.5  
Scas_721.98                                                            28   8.7  

>Sklu_1262.1 YPR061C, Contig c1262 1479-2330
          Length = 283

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/283 (91%), Positives = 260/283 (91%)

Query: 1   MLSLSRTNPLKGLLLRRYATFPKPEDKNHRDDMWPSTKTPTPYEVFGVPPGSINPNDXXX 60
           MLSLSRTNPLKGLLLRRYATFPKPEDKNHRDDMWPSTKTPTPYEVFGVPPGSINPND   
Sbjct: 1   MLSLSRTNPLKGLLLRRYATFPKPEDKNHRDDMWPSTKTPTPYEVFGVPPGSINPNDLKK 60

Query: 61  XXXXXXXXXXPDISNNITILATKPHHHTDITGDSPTLTTADKLYRFKVLNEAYDLLTDSR 120
                     PDISNNITILATKPHHHTDITGDSPTLTTADKLYRFKVLNEAYDLLTDSR
Sbjct: 61  KYHALAKLYHPDISNNITILATKPHHHTDITGDSPTLTTADKLYRFKVLNEAYDLLTDSR 120

Query: 121 RKGIYDRYKTGWSHGPVAFXXXXXXXXXXNAGATSNDYHSNSDYWNAGTWEDVNNLGKTD 180
           RKGIYDRYKTGWSHGPVAF          NAGATSNDYHSNSDYWNAGTWEDVNNLGKTD
Sbjct: 121 RKGIYDRYKTGWSHGPVAFSSHVSSYASSNAGATSNDYHSNSDYWNAGTWEDVNNLGKTD 180

Query: 181 QKKISAWMILAWMCGLFVCVEFTALLTRIEETINQKNFTHDETEKDLTQAYINYGLDTDK 240
           QKKISAWMILAWMCGLFVCVEFTALLTRIEETINQKNFTHDETEKDLTQAYINYGLDTDK
Sbjct: 181 QKKISAWMILAWMCGLFVCVEFTALLTRIEETINQKNFTHDETEKDLTQAYINYGLDTDK 240

Query: 241 WSRLRRFLWFRTFGLYKSKADLDREAKKNEELVQFLKSKAENE 283
           WSRLRRFLWFRTFGLYKSKADLDREAKKNEELVQFLKSKAENE
Sbjct: 241 WSRLRRFLWFRTFGLYKSKADLDREAKKNEELVQFLKSKAENE 283

>Kwal_14.1136
          Length = 286

 Score =  286 bits (733), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 142/282 (50%), Positives = 190/282 (67%), Gaps = 8/282 (2%)

Query: 1   MLSL-SRTNPLKGLLLRRYATFPKPEDKNHRDDMWPSTKTPTPYEVFGVPPGSINPNDXX 59
           M+SL +RT    G + +R A+     +    D  WP    PTPYE+FG+PPG ++     
Sbjct: 1   MVSLITRTFYSNGSVFKRMASHSTNAEPVF-DSAWPKGSCPTPYEIFGMPPGQVDSRSLK 59

Query: 60  XXXXXXXXXXXPDISNNITILATKPHHHTDITGDSPTLTTADKLYRFKVLNEAYDLLTDS 119
                      PDISN + IL     HHT    +S  L+  DK+ RF++++EAY+LL+D 
Sbjct: 60  KKYHAMAKLYHPDISNGVRILKQNTSHHTLQMDESAVLSAQDKMNRFRIMSEAYELLSDY 119

Query: 120 RRKGIYDRYKTGWSHGPVAFXXXXXXXXXXNAGATSNDYHSNS--DYWNAGTWEDVNNLG 177
           R+K  YDR+++GW +GPV            +A ATS+ YH N   +YWNAGTWEDVNNL 
Sbjct: 120 RKKSTYDRFRSGWDYGPVG----NSSDSYASAAATSHGYHQNHHYEYWNAGTWEDVNNLK 175

Query: 178 KTDQKKISAWMILAWMCGLFVCVEFTALLTRIEETINQKNFTHDETEKDLTQAYINYGLD 237
           ++ + K+S W ++ W+CGLFVC++ TALLTRIEE++ + ++THDETE+DL  AY+NYGLD
Sbjct: 176 RSPENKVSVWAVVGWVCGLFVCIQCTALLTRIEESLTKVHYTHDETERDLGLAYMNYGLD 235

Query: 238 TDKWSRLRRFLWFRTFGLYKSKADLDREAKKNEELVQFLKSK 279
           TDKWSRLRRFLWFRT+GLY+SKADLDREA+ NE +VQ LKSK
Sbjct: 236 TDKWSRLRRFLWFRTYGLYRSKADLDREAQNNERIVQELKSK 277

>YPR061C (JID1) [5490] chr16 complement(675972..676877) Member of a
           DnaJ-like family of putative protein chaperones [906 bp,
           301 aa]
          Length = 301

 Score =  222 bits (566), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 126/292 (43%), Positives = 180/292 (61%), Gaps = 23/292 (7%)

Query: 2   LSLSRTNPLKGLLLRRYATFPKPEDKNH------RDDMWPSTKTPTPYEVFGVP-PGSIN 54
           LS     P +   + +YAT     DKN       RD+ WP    PTPY++FG+P  GS N
Sbjct: 16  LSCVEKCPPQITFIAKYAT---ANDKNGNRKLTIRDEQWPELADPTPYDIFGIPKAGSGN 72

Query: 55  PNDXXXXXXXX----XXXXXPDISNNITILATKPHHHTDITGDSPTL-TTADKLYRFKVL 109
           P                   PD S+NI I +++   ++D    SP L T+++KL+RFKV+
Sbjct: 73  PKLDKKSLKKKYHRYVKLYHPDHSDNIQIFSSEKVTNSD--SKSPLLLTSSEKLHRFKVI 130

Query: 110 NEAYDLLTDSRRKGIYDRYKTGWSHGPVAFXXXXXXXXXXNAGATSNDYHSNS--DYWNA 167
           ++AYD+L D ++K +YD  + GW+    ++             A S  YHSN+  +YWNA
Sbjct: 131 SQAYDILCDPKKKIVYDTTRQGWT---TSYSPRSNVNTENYQYAGSYGYHSNAQYEYWNA 187

Query: 168 GTWEDVNNL-GKTDQKKISAWMILAWMCGLFVCVEFTALLTRIEETINQKNFTHDETEKD 226
           GTWED N++  +  Q+ I+ W ++  +CGL +C+E TALL +I+E++++  FTHDE+   
Sbjct: 188 GTWEDANSMKNERIQENINPWTVIGIICGLAICIEGTALLAKIQESLSKAEFTHDESGLH 247

Query: 227 LTQAYINYGLDTDKWSRLRRFLWFRTFGLYKSKADLDREAKKNEELVQFLKS 278
           L Q+Y NYGLDTDK+SRLRRFLWFRT+GLYKSK DLDREAK NEE+++ LK+
Sbjct: 248 LIQSYTNYGLDTDKFSRLRRFLWFRTWGLYKSKEDLDREAKINEEMIRKLKA 299

>CAGL0D01584g 167879..168781 similar to tr|Q12350 Saccharomyces
           cerevisiae YPR061c, hypothetical start
          Length = 300

 Score =  216 bits (551), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 108/255 (42%), Positives = 154/255 (60%), Gaps = 4/255 (1%)

Query: 31  DDMWPSTKTPTPYEVFGVPPGS-INPNDXXXXXXXXXXXXXPDISNNITILAT---KPHH 86
           D +WP    PTPYE+FG   G+ ++                PD+S++I I  +   K HH
Sbjct: 46  DSLWPDKHNPTPYEIFGFGVGTHVDLKKLKMEYHKYVKMYHPDLSSHIQIRKSSLVKSHH 105

Query: 87  HTDITGDSPTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDRYKTGWSHGPVAFXXXXXXX 146
             +I   +  LT A+K+ RFK++ +AY++L D R+K +YD  ++GW     A        
Sbjct: 106 AMEIANTAQYLTQAEKIQRFKLVTQAYEILKDPRKKNLYDCTRSGWDMAGSAGPTGAQSA 165

Query: 147 XXXNAGATSNDYHSNSDYWNAGTWEDVNNLGKTDQKKISAWMILAWMCGLFVCVEFTALL 206
              ++ A +N    +  YWNAG WEDV+N      +K+  W +L W  GL +C+E ++LL
Sbjct: 166 YYASSAAYNNFSDQSYAYWNAGNWEDVHNYQNNSGQKLDPWTLLMWFGGLLLCLEGSSLL 225

Query: 207 TRIEETINQKNFTHDETEKDLTQAYINYGLDTDKWSRLRRFLWFRTFGLYKSKADLDREA 266
            RIE+T+  K+ T D  E +L Q YINYGLDTDKWSRLRRFLWFRTF +Y+SK DLDREA
Sbjct: 226 ARIEDTLTDKSITEDNIEVELGQCYINYGLDTDKWSRLRRFLWFRTFNMYRSKVDLDREA 285

Query: 267 KKNEELVQFLKSKAE 281
           +KNE+L++ L+ K +
Sbjct: 286 EKNEDLIKTLQEKVK 300

>KLLA0B08459g 751178..752065 weakly similar to sgd|S0006265
           Saccharomyces cerevisiae YPR061c, hypothetical start
          Length = 295

 Score =  204 bits (520), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 111/257 (43%), Positives = 153/257 (59%), Gaps = 16/257 (6%)

Query: 29  HRDDMWPSTKTP-TPYEVFGVPPGSINPNDXXXXXXXXXXXXXPDISNNITILATKPHHH 87
           H D  WP    P +PY +F +   +                  PD S+N TIL  K ++ 
Sbjct: 50  HFDSNWPKDNQPKSPYSLFELTESNFTKALLKKRFHELARLYHPDHSSNRTIL--KRNNS 107

Query: 88  TDITGDSP---TLTTADKLYRFKVLNEAYDLLTDSRRKGIYDRYKTGWSHGPVAFXXXXX 144
           T++T  +     L+T+DK  RFK++ EAY+LL D  RK  YD    GW +GP        
Sbjct: 108 TELTSSNIHDNVLSTSDKSDRFKIIKEAYELLKDPGRKHQYDMLGLGWVYGPKPIP---- 163

Query: 145 XXXXXNAGATSNDYHSNSDYWNAGTWEDVNNLGKTDQKKISAWMILAWMCGLFVCVEFTA 204
                   +    Y  +  ++NAGTWED +N+ + D++++    +L W  G+F  VE T+
Sbjct: 164 ------TASGMPRYERHEKFYNAGTWEDYSNIRRNDKEEVGPLSMLIWFFGIFAIVELTS 217

Query: 205 LLTRIEETINQKNFTHDETEKDLTQAYINYGLDTDKWSRLRRFLWFRTFGLYKSKADLDR 264
           LL+R+EE+IN+++F HDETEK LT AYINYGLD DKWSRLRRFLWFRT+ LY++K DLDR
Sbjct: 218 LLSRLEESINKRDFAHDETEKHLTLAYINYGLDEDKWSRLRRFLWFRTYSLYRTKEDLDR 277

Query: 265 EAKKNEELVQFLKSKAE 281
           EAKKNE +++ LK K E
Sbjct: 278 EAKKNENMIKDLKKKEE 294

>ADL327W [1414] [Homologous to ScYPR061C - SH]
           complement(123853..124770) [918 bp, 305 aa]
          Length = 305

 Score =  173 bits (438), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 127/246 (51%), Gaps = 27/246 (10%)

Query: 34  WPSTKTPTPYEVFGVPPGSINPNDXXXXXXXXXXXXXPDISNNITILATKPHHHTDITGD 93
           WP  K PTPYEV G+    ++                PD +                   
Sbjct: 84  WPQGKQPTPYEVLGLVKTGVDARQLKKRYHELAKLYHPDTAG----------------AA 127

Query: 94  SPTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDRYKTGWSHGPVAFXXXXXXXXXXNAGA 153
              L   ++L RFK++NEAY LL+D+ R+ +YD Y TGW+HGP                 
Sbjct: 128 QQGLGEHERLRRFKLVNEAYALLSDASRRRMYDMYATGWAHGPAPMAPAM---------- 177

Query: 154 TSNDYHSNSDYWNAGTWEDVNNLGKTDQK-KISAWMILAWMCGLFVCVEFTALLTRIEET 212
               YH    Y+NAGTWED+ +L    Q+ + SAW ++ W   +    +  A L R+EE 
Sbjct: 178 AHGAYHERYAYYNAGTWEDMQDLNSDRQQVQFSAWGMVVWALCMLAGFQVMAFLIRLEER 237

Query: 213 INQKNFTHDETEKDLTQAYINYGLDTDKWSRLRRFLWFRTFGLYKSKADLDREAKKNEEL 272
            ++   TH+E E  L  A++NYGLD D+ SR+RRFLWFR++GLY++KA+LD  A+ NE L
Sbjct: 238 TSKSAHTHEEAEHALLLAHLNYGLDQDRVSRVRRFLWFRSWGLYRTKAELDEAARTNEAL 297

Query: 273 VQFLKS 278
           V+ L+ 
Sbjct: 298 VRQLEG 303

>Scas_667.24
          Length = 285

 Score =  144 bits (363), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 96/280 (34%), Positives = 144/280 (51%), Gaps = 40/280 (14%)

Query: 16  RRYATFPK-PEDKNHRDDMWPSTK-TPTPYEVFGVP-PGSINPNDXXXXXXXXXXXXXPD 72
           R YA   K P  +   D+ WP+ K  P+PY++F +  P  IN                PD
Sbjct: 28  RLYAMIAKGPSSRVIFDNKWPNNKLNPSPYDIFAIAEPEKINKKAMKKLYHHYVKLYHPD 87

Query: 73  ISNNITILATKPHHHTDITGDSPTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDRYKTGW 132
              N+ IL       +     +  L+ A+K+ RFK++++ Y +L DS +K  +D +K   
Sbjct: 88  RCGNLNILKNPSLEKSS----NQMLSQAEKIRRFKLVSQYYAILMDSNKKRQWD-FKNAA 142

Query: 133 SHGPVAFXXXXXXXXXXNAGATSNDYHSNSDY--WNAGTWEDVNNL-------GKTDQKK 183
           S                  G   N+ + N++Y  WNAGTWEDVN+        G T +KK
Sbjct: 143 S------------------GTHMNNVNMNANYKYWNAGTWEDVNSYYKETNEGGHTLEKK 184

Query: 184 ISAWMILAWMCGLFVCVEFTALLTRIEETINQKN----FTHDETEKDLTQAYINYGLDTD 239
           +  W++  W+ GL+VCV+  ALL R +E+I  K+      HDE   +L +AY N+GL+ D
Sbjct: 185 LDLWVLFCWVSGLYVCVQGYALLNRAQESILNKDRHVVTDHDEIRTELFKAYNNFGLEND 244

Query: 240 KWSRLRRFLWFRTFGLYKSKADLDREAKKNEELVQFLKSK 279
           KWSRLRRFLWFR++ +  S  + D+E   NE+++  L  K
Sbjct: 245 KWSRLRRFLWFRSWAM-ASPNEYDKEHYANEKMINDLLKK 283

>Sklu_1935.1 YNL077W, Contig c1935 224-1609
          Length = 461

 Score = 32.0 bits (71), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 23/32 (71%)

Query: 99  TADKLYRFKVLNEAYDLLTDSRRKGIYDRYKT 130
           + D   +F+ + +AY++L D+++K +YDRY T
Sbjct: 43  SEDSKRKFQEICKAYEILGDAKKKLLYDRYGT 74

>AER427W [2927] [Homologous to ScYNL077W - SH]
           complement(1456998..1458410) [1413 bp, 470 aa]
          Length = 470

 Score = 31.6 bits (70), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%)

Query: 105 RFKVLNEAYDLLTDSRRKGIYDRYKT 130
           RF+ + +AY +L D R + IYDRY T
Sbjct: 47  RFQQIADAYRVLGDERLRKIYDRYGT 72

>Kwal_23.4830
          Length = 411

 Score = 31.6 bits (70), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 3/33 (9%)

Query: 95  PTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDR 127
           P+   ADK   FK L  AY++L+DS+++ IYD+
Sbjct: 39  PSEEAADK---FKELTVAYEILSDSQKRDIYDQ 68

>KLLA0D04818g complement(411615..412679) similar to sp|P25294
           Saccharomyces cerevisiae YNL007c SIS1 heat shock
           protein, start by similarity
          Length = 354

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 27/43 (62%), Gaps = 4/43 (9%)

Query: 93  DSPTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDRYKTGWSHG 135
           D PT  T     +FK ++EA+++L+D++++ +YD Y    + G
Sbjct: 36  DKPTGDTE----KFKEISEAFEILSDAQKREVYDTYGLEAARG 74

>Scas_488.3
          Length = 367

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 24/36 (66%), Gaps = 4/36 (11%)

Query: 93  DSPTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDRY 128
           D PT  T     +FK ++EA+++L D +++ IYD+Y
Sbjct: 36  DKPTGDTE----KFKEISEAFEILNDPQKREIYDQY 67

>CAGL0H03707g complement(341230..342279) highly similar to sp|P25294
           Saccharomyces cerevisiae YNL007c SIS1 heat shock
           protein, start by similarity
          Length = 349

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 25/36 (69%), Gaps = 4/36 (11%)

Query: 93  DSPTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDRY 128
           D PT  T     +FK ++EA+++L+D +++ +YD+Y
Sbjct: 36  DKPTGDTE----KFKEISEAFEILSDPQKREVYDQY 67

>Kwal_23.3061
          Length = 458

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 5/45 (11%)

Query: 86  HHTDITGDSPTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDRYKT 130
           HH D  G S       KL +F+ + +AY++L D +++ +YDR+ T
Sbjct: 35  HHPDKNGHS----EQSKL-KFQQICKAYEILGDDKKREMYDRFGT 74

>YNL007C (SIS1) [4578] chr14 complement(618506..619564) Protein
           required for initiation of translation, member of DnaJ
           family of protein chaperones [1059 bp, 352 aa]
          Length = 352

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 24/36 (66%), Gaps = 4/36 (11%)

Query: 93  DSPTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDRY 128
           D PT  T     +FK ++EA+++L D +++ IYD+Y
Sbjct: 36  DKPTGDTE----KFKEISEAFEILNDPQKREIYDQY 67

>YMR161W (HLJ1) [4116] chr13 (577717..578391) Endoplasmic reticulum
           membrane protein, member of the DnaJ family of putative
           protein chaperones [675 bp, 224 aa]
          Length = 224

 Score = 30.0 bits (66), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 18/22 (81%)

Query: 106 FKVLNEAYDLLTDSRRKGIYDR 127
           FKV+N A+++L++  ++ IYDR
Sbjct: 62  FKVINRAFEVLSNEEKRSIYDR 83

>CAGL0H04499g complement(427509..428207) similar to sp|P48353
           Saccharomyces cerevisiae YMR161w HLJ1, start by
           similarity
          Length = 232

 Score = 30.0 bits (66), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 20/22 (90%)

Query: 106 FKVLNEAYDLLTDSRRKGIYDR 127
           FK++N A+++L+DS+++ IYD+
Sbjct: 62  FKLINRAFEVLSDSQKRQIYDQ 83

>CAGL0J09966g complement(976568..977791) highly similar to sp|P25491
           Saccharomyces cerevisiae YNL064c YDJ1, start by
           similarity
          Length = 407

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 25/34 (73%), Gaps = 3/34 (8%)

Query: 95  PTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDRY 128
           P+   A+K   FK ++ AY++L+DS+++ +YD++
Sbjct: 39  PSEEAAEK---FKEVSSAYEILSDSQKREVYDQF 69

>KLLA0F03333g complement(313991..315220) similar to sp|P25491
           Saccharomyces cerevisiae YNL064c YDJ1 mitochondrial and
           ER import protein, start by similarity
          Length = 409

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 24/34 (70%), Gaps = 3/34 (8%)

Query: 95  PTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDRY 128
           P+   A+K   FK +  AY++L+DS+++ +YD++
Sbjct: 39  PSEEAAEK---FKEITSAYEILSDSQKREVYDQF 69

>Sklu_2442.1 YNL007C, Contig c2442 2508-3554 reverse complement
          Length = 348

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 4/36 (11%)

Query: 93  DSPTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDRY 128
           D PT  T     +FK ++EA+++L D +++ IYD Y
Sbjct: 36  DKPTGDTE----KFKEISEAFEILNDPQKREIYDSY 67

>YNL077W (APJ1) [4513] chr14 (481390..482976) Protein induced by
           cell stress, member of the DnaJ family of predicted
           protein chaperones [1587 bp, 528 aa]
          Length = 528

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 22/32 (68%)

Query: 99  TADKLYRFKVLNEAYDLLTDSRRKGIYDRYKT 130
           T +   +F+ + +AY++L D+R + +YD+Y T
Sbjct: 41  TEESKRKFQEICQAYEILKDNRLRALYDQYGT 72

>CAGL0J10296g complement(1004500..1005939) similar to sp|P53940
           Saccharomyces cerevisiae YNL077w, start by similarity
          Length = 479

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 21/26 (80%)

Query: 105 RFKVLNEAYDLLTDSRRKGIYDRYKT 130
           +F+ +++AY++L+D + + +YDRY T
Sbjct: 47  QFQEISKAYEVLSDPKSREMYDRYGT 72

>Scas_669.2
          Length = 224

 Score = 29.3 bits (64), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 9/22 (40%), Positives = 18/22 (81%)

Query: 106 FKVLNEAYDLLTDSRRKGIYDR 127
           FK++N A+++L+D  ++ +YDR
Sbjct: 63  FKIINRAFEVLSDVEKRQLYDR 84

>Scas_644.10
          Length = 512

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 72/186 (38%), Gaps = 36/186 (19%)

Query: 72  DISNNITILATKPHHHTDITGDSPTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDRYKTG 131
           DI+N+ +I+    +   DI  D+ T T    L +FK+     D+L   R  G+++RYK  
Sbjct: 346 DINNHFSIIKKHLNKTQDIAQDNATKTCNSLLPKFKLFT---DILLSLR--GLFERYKIM 400

Query: 132 WSHG-PVAFXXXXXXXXXXNAGATSNDYHSNSDYWNAGTWEDVNNLGKTDQKKISAWMIL 190
            ++  P              A     D        N   ++ +      D+K IS  +  
Sbjct: 401 ATNNIPQLQRHVVLNREKLEAMKGKPDA-------NGVEYDRIKMSITRDKKSISEQLNR 453

Query: 191 AWMCGLFVCVEFTALLTRIEETINQKNFTHDETEKDLTQAYINY--------GLDTDKWS 242
           AW+    +  EFT                  ET+  LT+A+ ++        G++ ++W 
Sbjct: 454 AWLVRKCILEEFTIF---------------QETQFMLTRAFQDWSKLNASFVGINLNEWE 498

Query: 243 RLRRFL 248
           +L   L
Sbjct: 499 KLEEQL 504

>Scas_694.20
          Length = 410

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 23/33 (69%), Gaps = 3/33 (9%)

Query: 95  PTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDR 127
           PT   A+K   FK ++ AY++L+DS ++ IYD+
Sbjct: 39  PTEEGAEK---FKEVSAAYEILSDSEKREIYDQ 68

>YMR214W (SCJ1) [4170] chr13 (695349..696482) Homolog of E. coli
           DnaJ, functions in the endoplasmic reticulum by
           interaction with Kar2p [1134 bp, 377 aa]
          Length = 377

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 18/24 (75%)

Query: 105 RFKVLNEAYDLLTDSRRKGIYDRY 128
           +F  + EAYD+L+D  +K IYD++
Sbjct: 64  KFIEVGEAYDVLSDPEKKKIYDQF 87

>KLLA0C07260g complement(632987..634093) similar to sp|P25303
           Saccharomyces cerevisiae YMR214w SCJ1 homolog of E. coli
           DnaJ, functions in the endoplasmic reticulum by
           interaction with KAR2P, start by similarity
          Length = 368

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%)

Query: 104 YRFKVLNEAYDLLTDSRRKGIYDRY 128
           + F  + EAYD+L+D  ++ IYDR+
Sbjct: 60  HHFIEVGEAYDVLSDPEKRQIYDRH 84

>ADL257C [1484] [Homologous to ScYNL064C (YDJ1) - SH]
           (249514..250746) [1233 bp, 410 aa]
          Length = 410

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 24/34 (70%), Gaps = 3/34 (8%)

Query: 94  SPTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDR 127
           +P+   ADK   FK +  AY++L+DS+++ +YD+
Sbjct: 38  NPSEEAADK---FKQITGAYEILSDSQKREMYDQ 68

>AAL008W [179] [Homologous to ScYNL007C (SIS1) - SH]
           complement(327127..328176) [1050 bp, 349 aa]
          Length = 349

 Score = 28.9 bits (63), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 4/43 (9%)

Query: 93  DSPTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDRYKTGWSHG 135
           D PT  T     +FK ++EA+++L+D  ++ +YD Y    + G
Sbjct: 36  DKPTGDTE----KFKEISEAFEILSDPNKREVYDTYGLEAARG 74

>Scas_709.3
          Length = 414

 Score = 28.9 bits (63), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 5/44 (11%)

Query: 85  HHHTDITGDSPTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDRY 128
             H D   + PT T      RF+ ++EAY +L+D   +  YD+Y
Sbjct: 32  QEHPDKNPNDPTATE-----RFQAISEAYQVLSDDTLRLKYDKY 70

>YIR004W (DJP1) [2669] chr9 (363218..364516) Protein required for
           peroxisomal biogenesis, has similarity to E. coli DnaJ
           and other DnaJ-like proteins [1299 bp, 432 aa]
          Length = 432

 Score = 28.9 bits (63), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 5/44 (11%)

Query: 85  HHHTDITGDSPTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDRY 128
             H D   + PT T      RF+ ++EAY +L D   +  YD+Y
Sbjct: 32  QEHPDKNPNDPTATE-----RFQAISEAYQVLGDDDLRAKYDKY 70

>ADR124C [1865] [Homologous to ScYJL073W (JEM1) - SH]
           (926131..927966) [1836 bp, 611 aa]
          Length = 611

 Score = 28.9 bits (63), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 24/46 (52%)

Query: 86  HHTDITGDSPTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDRYKTG 131
           +H D  G+      A    +   +NEAY++L+D  ++  YD  ++G
Sbjct: 536 YHPDKQGNMSDAERAKVEEKMSSINEAYEVLSDESKRKEYDMLRSG 581

>Kwal_0.207
          Length = 353

 Score = 28.5 bits (62), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 19/24 (79%)

Query: 105 RFKVLNEAYDLLTDSRRKGIYDRY 128
           +FK ++EA+++L D +++ +YD Y
Sbjct: 44  KFKEISEAFEILNDPQKREVYDTY 67

>Kwal_26.9024
          Length = 375

 Score = 28.1 bits (61), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 21/28 (75%)

Query: 101 DKLYRFKVLNEAYDLLTDSRRKGIYDRY 128
           D  ++F  + EAY++L+D +++ IYD++
Sbjct: 62  DAHHKFIEVGEAYEVLSDDQKRQIYDQH 89

>Scas_564.1*
          Length = 457

 Score = 28.1 bits (61), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 23/44 (52%)

Query: 85  HHHTDITGDSPTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDRY 128
            HH D   +S +        +FK ++ AY++L+D  ++  YD Y
Sbjct: 369 QHHPDKVVNSNSDDREASEIKFKEISAAYEILSDEDKRAHYDLY 412

>Scas_721.98
          Length = 484

 Score = 28.1 bits (61), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 242 SRLRRFLWFRTFGLYKSKADLDREAKKNEELVQFLKSKAENE 283
           S++R  +W +  G  +    L+REAKKN  + Q    K +NE
Sbjct: 284 SKIRGIMWLKRIGYMEI---LEREAKKNGAVNQLKDEKNDNE 322

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,515,438
Number of extensions: 401524
Number of successful extensions: 1122
Number of sequences better than 10.0: 46
Number of HSP's gapped: 1109
Number of HSP's successfully gapped: 46
Length of query: 283
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 183
Effective length of database: 13,134,309
Effective search space: 2403578547
Effective search space used: 2403578547
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)