Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_1023.235235216370.0
KLLA0C10318g3333528311e-110
AAL062W3273576845e-88
Kwal_47.181843373616455e-82
CAGL0D03916g3443586292e-79
Scas_690.373323576186e-78
YHR034C3442005682e-70
Scas_694.21313135770.13
Scas_612.528435700.81
Scas_637.1557556645.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_1023.2
         (352 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_1023.2 YHR034C, Contig c1023 1165-2223                           635   0.0  
KLLA0C10318g complement(885031..886032) similar to sp|P38768 Sac...   324   e-110
AAL062W [125] [Homologous to ScYHR034C - SH] complement(238295.....   268   5e-88
Kwal_47.18184                                                         253   5e-82
CAGL0D03916g complement(391089..392123) similar to sp|P38768 Sac...   246   2e-79
Scas_690.37                                                           242   6e-78
YHR034C (YHR034C) [2321] chr8 complement(176957..177991) Protein...   223   2e-70
Scas_694.21                                                            34   0.13 
Scas_612.5                                                             32   0.81 
Scas_637.15                                                            29   5.9  

>Sklu_1023.2 YHR034C, Contig c1023 1165-2223
          Length = 352

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/352 (91%), Positives = 321/352 (91%)

Query: 1   MSGNFLLRPINSTESTASVLLLEPQPGFVIKSKLDSCSPPTELAIGTKIFINVCFDNQVP 60
           MSGNFLLRPINSTESTASVLLLEPQPGFVIKSKLDSCSPPTELAIGTKIFINVCFDNQVP
Sbjct: 1   MSGNFLLRPINSTESTASVLLLEPQPGFVIKSKLDSCSPPTELAIGTKIFINVCFDNQVP 60

Query: 61  KPNTEFNPSIVYPLIMNNQWEIPIITSNVREDKDKKGAICYVWDCCINTECMSWVNKDYQ 120
           KPNTEFNPSIVYPLIMNNQWEIPIITSNVREDKDKKGAICYVWDCCINTECMSWVNKDYQ
Sbjct: 61  KPNTEFNPSIVYPLIMNNQWEIPIITSNVREDKDKKGAICYVWDCCINTECMSWVNKDYQ 120

Query: 121 LREILVEWCLESCELRQSVEISRDRIAFPKLKRKGDKIPTLEILNSDLNQDFRKEIDSIV 180
           LREILVEWCLESCELRQSVEISRDRIAFPKLKRKGDKIPTLEILNSDLNQDFRKEIDSIV
Sbjct: 121 LREILVEWCLESCELRQSVEISRDRIAFPKLKRKGDKIPTLEILNSDLNQDFRKEIDSIV 180

Query: 181 EKDRTDPTSILEMQRDLVFGETLGGRKNNGDEDXXXXXXXXXXXXXXXXXXXXQKKPLIE 240
           EKDRTDPTSILEMQRDLVFGETLGGRKNNGDED                    QKKPLIE
Sbjct: 181 EKDRTDPTSILEMQRDLVFGETLGGRKNNGDEDTGTLPPLFPTTATTTTNNTTQKKPLIE 240

Query: 241 EIQDLSIREKQAETRKPRAIVEPKTLEYQATMVXXXXXXXXXXXIEIISELDSSLDYSIK 300
           EIQDLSIREKQAETRKPRAIVEPKTLEYQATMV           IEIISELDSSLDYSIK
Sbjct: 241 EIQDLSIREKQAETRKPRAIVEPKTLEYQATMVKTKDDKKFKLKIEIISELDSSLDYSIK 300

Query: 301 YDVKNSVLAIKNINLHLYNEKKLEIPLPKIFEEQPDIKCFFIKSERKLIIFL 352
           YDVKNSVLAIKNINLHLYNEKKLEIPLPKIFEEQPDIKCFFIKSERKLIIFL
Sbjct: 301 YDVKNSVLAIKNINLHLYNEKKLEIPLPKIFEEQPDIKCFFIKSERKLIIFL 352

>KLLA0C10318g complement(885031..886032) similar to sp|P38768
           Saccharomyces cerevisiae YHR034c singleton, start by
           similarity
          Length = 333

 Score =  324 bits (831), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 173/352 (49%), Positives = 241/352 (68%), Gaps = 23/352 (6%)

Query: 4   NFLLRPINSTESTAS--VLLLEPQPGFVIKSKLDSCSPPTELAIGTKIFINVCFDNQVPK 61
           +FLLRP+N + S  S  V+ + P+P FV+KSK+ +    T L+   KIFIN+C ++Q+P 
Sbjct: 2   SFLLRPLNDSSSNNSNNVIRISPEPCFVVKSKVINPGT-TSLSSNAKIFINICHNDQIPL 60

Query: 62  PNTEFNPSIVYPLIMNNQWEIPIITSNVREDKDKKGAICYVWDCCINTECMSWVNKDYQL 121
           P  +FNP+IVYPLI+NNQWEIPI+TS++RED DKKG +CYV DCCINT+C+SW+  D QL
Sbjct: 61  PEIDFNPAIVYPLIINNQWEIPIVTSSIREDVDKKGNVCYVSDCCINTKCVSWIQHDLQL 120

Query: 122 REILVEWCLESCELRQSVEISRDRIAFPKLKRKGDKIPTLEILNSDLNQDFRKEIDSIVE 181
           REI+VEWCLESCELR  +EISRD I+FPKLK+KGD IP LEIL  DL +++ + I+ +V 
Sbjct: 121 REIVVEWCLESCELRAELEISRDNISFPKLKKKGDTIPELEILREDLTENYEETINDLVN 180

Query: 182 KDRTDPTSILEMQRDLVFGETLGGRKNNGDEDXXXXXXXXXXXXXXXXXXXXQKKPLIEE 241
           +++ +P SI+E +RD +  +      + G+                      ++KPLIEE
Sbjct: 181 REQKEPVSIIEKRRDFLAED----EPSTGE-----------LPPLIPIDQSSRRKPLIEE 225

Query: 242 IQDLSIREKQAETRKPRA-IVEPKTLEYQATMVXXXXXXXXXXXIEIISELDSSLDYSIK 300
           I+DLS+     ET+KP+   ++ K++ Y+ +M            IE+ SEL+SSLDY+IK
Sbjct: 226 IEDLSLH----ETKKPKVEEIQKKSISYELSMGKPKDTSEFLLKIEVTSELNSSLDYNIK 281

Query: 301 YDVKNSVLAIKNINLHLYNEKKLEIPLPKIFEEQPDIKCFFIKSERKLIIFL 352
           YD K++ L IKN NL +Y EKKL++PLP IF   P ++CFF+K ER+LIIFL
Sbjct: 282 YDAKSNKLIIKNTNLGIYPEKKLKVPLPDIFNNPPKLECFFVKPERRLIIFL 333

>AAL062W [125] [Homologous to ScYHR034C - SH]
           complement(238295..239278) [984 bp, 327 aa]
          Length = 327

 Score =  268 bits (684), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 150/357 (42%), Positives = 197/357 (55%), Gaps = 39/357 (10%)

Query: 4   NFLLRPINSTESTASVLLLEPQPGFVIKSKLDSCSPPTELAIGTKIFINVCFDNQVPKPN 63
           +FLLRPI+S E   SV+   P PGFVIKSKL+     T L +GTK F+NVC   QVP P+
Sbjct: 2   DFLLRPIDSKE--CSVITFVPTPGFVIKSKLEHGKDAT-LVVGTKTFVNVCHHTQVPLPD 58

Query: 64  TEFNPSIVYPLIMNNQWEIPIITSNVREDKDKKGAICYVWDCCINTECMSWVNKDYQLRE 123
             F+ SIVYPLIM N+WEIPI+TS VR D DKKG  CYVWDCCIN+ECM W+ KDYQLRE
Sbjct: 59  VPFDASIVYPLIMENKWEIPIVTSAVRRDADKKGQECYVWDCCINSECMQWIEKDYQLRE 118

Query: 124 ILVEWCLESCELRQSVEISRDRIAFPKLKRKGDKIPTLEILNSDLNQDFRKEIDSIVEKD 183
           ILVEWCLESCELRQSV ISR+ + FP++K KG  +P +E+L  DL  D++ EI       
Sbjct: 119 ILVEWCLESCELRQSVGISREAVVFPRMKSKG-ALPAVEVLQQDLTHDYKHEIAENSSLG 177

Query: 184 RTDPTSILEMQRDLVFGETLGGRKNNGDEDXXXXXXXXXXXXXXXXXXXXQKKPLIEEIQ 243
             DP  IL M+  L         + +GD+                       +PLIEE+ 
Sbjct: 178 MDDPRQILHMRGAL-------DEEASGDDGTLPSLFPERPAT----------RPLIEEVN 220

Query: 244 DLSIREKQAETRKPRAIVEPKT--------LEYQATMVXXXXXXXXXXXIEIISELDSSL 295
                      R   ++  PKT        LE+  TM            +++ S L+S  
Sbjct: 221 ---------TGRHSASVEAPKTLPACGLPRLEFAVTMGRPRNDANYKIKVQVASALNSGH 271

Query: 296 DYSIKYDVKNSVLAIKNINLHLYNEKKLEIPLPKIFEEQPDIKCFFIKSERKLIIFL 352
            YS+ YD K + L + + +   Y  K++ IPLP +      ++  F+K    L++FL
Sbjct: 272 AYSVHYDGKENSLLVTSTS-QAYEPKEICIPLPGVVAGTRSMRALFLKRSNALVVFL 327

>Kwal_47.18184
          Length = 337

 Score =  253 bits (645), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 148/361 (40%), Positives = 204/361 (56%), Gaps = 39/361 (10%)

Query: 5   FLLRPINSTESTA-SVLLLEPQPGFVIKSKLDSCSPPTELAIGTKIFINVCFDNQVPKPN 63
           FLLR I++  + A SV+ +EPQPGFV+KSKL S S     ++G K+F+NVC ++QVP+P 
Sbjct: 3   FLLRAIDNGNNDADSVVRVEPQPGFVVKSKLVS-SYDGRYSLGAKVFVNVCHEDQVPQPE 61

Query: 64  TEFNPSIVYPLIMNNQWEIPIITSNVREDKDKKGAICYVWDCCINTECMSWVNKDYQLRE 123
             FNPS+VYPLIM NQWEIPII S +R+D+DKKG +CYV DCCIN+ CM W   + QLRE
Sbjct: 62  IPFNPSVVYPLIMTNQWEIPIIASALRQDRDKKGDLCYVCDCCINSACMQWARTELQLRE 121

Query: 124 ILVEWCLESCELRQSVEISRDRIAFPKLKRKGDKIPTLEILNSDLNQDFRKEIDSIVEKD 183
           ILVEWCLESCELRQ +EISR+ +AFPKL+ KG  I  LE+L +DL+ DFR E+  + +++
Sbjct: 122 ILVEWCLESCELRQRIEISREHLAFPKLRMKGASILPLEVLTTDLHADFRHEMRDLAKRE 181

Query: 184 RTDPTSILEMQRDLVFGETLGGRKNNGDEDXXXXXXXXXXXXXXXXXXXXQKKPLIEEIQ 243
             +P SILE++R+L+          + D D                      + LI+EI 
Sbjct: 182 -AEPASILELKRELI----------DADLD---STSIDSSALPPLFPSKTPTRLLIQEID 227

Query: 244 DLSIRE----KQAETRKPR-------AIVEPKTLEYQATMVXXXXXXXXXXXIEIISELD 292
             S       K   T  P        ++ +P     QA +            I+I+S L 
Sbjct: 228 STSTSSQAPAKTVSTTPPTTDPAFDISMGKPSAQNSQAKL-----------RIDIVSLLP 276

Query: 293 SSLDYSIKYDVKNSVLAIKNINLHLYNEKKLEIPLPK-IFEEQPDIKCFFIKSERKLIIF 351
           +  DY I Y+   + L I + N   +  K++ I LP  +    P I   F    RK+ I+
Sbjct: 277 AESDYLISYNSNENTLTISHTNTTHFLPKEITIALPHVVVSSTPQITTAFDDQSRKMTIY 336

Query: 352 L 352
           L
Sbjct: 337 L 337

>CAGL0D03916g complement(391089..392123) similar to sp|P38768
           Saccharomyces cerevisiae YHR034c, hypothetical start
          Length = 344

 Score =  246 bits (629), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 142/358 (39%), Positives = 210/358 (58%), Gaps = 24/358 (6%)

Query: 4   NFLLRPINSTESTASVLLLEPQPGFVIKSKL----DSCSPPTELAIGTKIFINVCFDNQV 59
           +FLLRPI S +    V +L P+P FVIKSK+    +      +L  G+KIF+N+C D Q 
Sbjct: 2   DFLLRPIASGDDN-QVTVLHPEPLFVIKSKIVNIDNRPKKLLKLEAGSKIFVNLCHDPQA 60

Query: 60  PKPNTEFNPSIVYPLIMNNQWEIPIITSNVREDKDKKGAICYVWDCCINTECMSWVNKDY 119
           PKP   F+P+IVYPLI+NN+WEIPI+ S++R D DKKG +CYV DCC+ ++C+ W  +DY
Sbjct: 61  PKPEIPFDPNIVYPLIINNKWEIPIVASSIRTDTDKKGQVCYVIDCCVASDCVKWFVEDY 120

Query: 120 QLREILVEWCLESCELRQSVEISRDRIAFPKLKRKGDKIPTLEILNSDLNQDFRKEIDSI 179
           QL+EI+VEWCLE+ ELR+ +EISRD+I+FPK+++KGD IP LEI +++L+     +I   
Sbjct: 121 QLKEIVVEWCLEAAELREVIEISRDKISFPKMRKKGDSIPDLEIFSNELDG---SDIKEA 177

Query: 180 VEKDR-TDPTSILEMQRDLVFGETLGGRKNNGDEDXXXXXXXXXXXXXXXXXXXXQKKPL 238
            + D+  DP+S+L+++RDL+  E      N+ D                      + + L
Sbjct: 178 TQNDKGNDPSSLLQIRRDLLSQEEDLSLSNDSD------ITAHGLPPLFPKANETKGRSL 231

Query: 239 IEEIQDLSIREKQAETRKPRAIVEPKTLEYQATMVXXXXXXXXXXXIEIISELDSSLDYS 298
           I+EI DL+++EK     K       K +EY   M               I  +    D +
Sbjct: 232 IQEIDDLTLKEKPKNAAKKVQ----KNIEYNVVMKKIENHKYKLRLDIQIDSITGKSDLN 287

Query: 299 IKYDVKNSVLAIKNINLHLYNEKKLEIPLPKIFEEQPDI----KCFFIKSERKLIIFL 352
           I YD  N+ + ++N+N  LY++K  +IPLP IFE + DI    + F++     L IFL
Sbjct: 288 IFYDPTNNDIVLRNLNTDLYDQKDFKIPLPNIFEGK-DIMNSSEIFYVNKTGTLTIFL 344

>Scas_690.37
          Length = 332

 Score =  242 bits (618), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 144/357 (40%), Positives = 210/357 (58%), Gaps = 39/357 (10%)

Query: 4   NFLLRPINSTESTASVLLLEPQPGFVIKSKLDSCSPPTELAIGTKIFINVCFDNQVPKPN 63
           +FL+RPI++ +    ++ + P P FVIKSKL     PT     +K+FINVC D  VP P+
Sbjct: 7   DFLIRPISTAQD--PIITIHPTPKFVIKSKLT----PT----NSKLFINVCQDANVPSPS 56

Query: 64  TEFNPSIVYPLIMNNQWEIPIITSNVREDKDKKGAICYVWDCCINTECMSWVNKDYQLRE 123
             F P++VYPLIM ++WEIPI+TS +R+D DKKG+ C+V DC IN +CM W+ KD QLRE
Sbjct: 57  IPFQPNVVYPLIMRDEWEIPILTSPMRQDTDKKGSPCHVCDCIINDQCMQWIAKDLQLRE 116

Query: 124 ILVEWCLESCELRQSVEISRDRIAFPKLKRKGD-KIPTLEILNSDLNQDFRKEIDSIVEK 182
           IL+EWCLE+ ELR++V + RD +  PKL  KG   +P LEI   +L +DF+++I SI+E+
Sbjct: 117 ILIEWCLEAVELREAVTVDRDAVKLPKLTCKGSLPLPVLEIPKRELERDFKRDIASIIEE 176

Query: 183 DRTD-PTSILEMQRDLVFGETLGGRKNNGDEDXXXXXXXXXXXXXXXXXXXXQKKPLIEE 241
           +  D P  +L+++R             N D D                     + PLIEE
Sbjct: 177 NTVDEPVKVLQLKR-----------TQNDDPDDTLPPLFPQSGNV--------QGPLIEE 217

Query: 242 IQ----DLSIREKQAETRKPRAIVEPKTLEYQATMVXXXXXXXXXXXIEIISELDSSLDY 297
           I     DL I +++  + +   ++  K L ++  M            I+I SE+DSSLD 
Sbjct: 218 IDVDMDDLKITKQEPTSSRTSPLL--KDLHFETVMRKTNNTQRYKLRIDITSEIDSSLDL 275

Query: 298 SIKYDVKNSVLAIKNINLHLYNEKKLEIPLPKIF--EEQPDIKCFFIKSERKLIIFL 352
            + YD  N+ L ++N+N   + EKK++IPLP IF  E     +CFFIK +++LIIF+
Sbjct: 276 HLAYDRTNNELILQNLNTVEFIEKKIKIPLPNIFTYENIKQSECFFIKKQKRLIIFI 332

>YHR034C (YHR034C) [2321] chr8 complement(176957..177991) Protein of
           unknown function, has low similarity to uncharacterized
           C. albicans Orf6.8994p [1035 bp, 344 aa]
          Length = 344

 Score =  223 bits (568), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 138/200 (69%), Gaps = 11/200 (5%)

Query: 3   GNFLLRPINSTE-----------STASVLLLEPQPGFVIKSKLDSCSPPTELAIGTKIFI 51
            +FLLRPI               +  SV  +EP   FVIK+KL S + P +L  G K+FI
Sbjct: 2   ADFLLRPIKQRHRNEDKYVSVDAADGSVSKIEPIADFVIKTKLLSANGPEKLQDGRKVFI 61

Query: 52  NVCFDNQVPKPNTEFNPSIVYPLIMNNQWEIPIITSNVREDKDKKGAICYVWDCCINTEC 111
           NVC    VPKP  +FN  IV+PLI+ N+WEIPIITS  R D DKKG  CYVWDCCIN++C
Sbjct: 62  NVCHSPLVPKPEVDFNARIVFPLIIQNEWEIPIITSCYRMDHDKKGQECYVWDCCINSDC 121

Query: 112 MSWVNKDYQLREILVEWCLESCELRQSVEISRDRIAFPKLKRKGDKIPTLEILNSDLNQD 171
             W+  D QLREILVEWCLESCE+R SV + RDRIAFPK+K+KG ++P LE+LN +L+QD
Sbjct: 122 SRWICDDIQLREILVEWCLESCEIRDSVVLCRDRIAFPKMKKKGAELPALEVLNDELHQD 181

Query: 172 FRKEIDSIVEKDRTDPTSIL 191
           ++ ++  I+E++  DP SIL
Sbjct: 182 YKAKMHKIIEEEAGDPMSIL 201

>Scas_694.21
          Length = 313

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 59/135 (43%), Gaps = 23/135 (17%)

Query: 40  PTELAIGTKIF--INVCFDNQVPKPNTEFNPSIVYPLIMNNQWEIPIITSNVREDKDKKG 97
           P +  +GT+ F  +N+C             P ++ P     +W + +I   +R     K 
Sbjct: 61  PLQYILGTQPFGLLNICC-----------KPKVLIPRWETEEWAMDLIRGIIRAAMQTKK 109

Query: 98  AICYVWDCCINTECMSWVNKDYQLREILVEWCLESCELR-QSVEISRDRIAFPKLKRKGD 156
            I  +WD C  + C++ +     LR+ L +   +  +L   +V++S   I   +   K  
Sbjct: 110 PILTIWDLCTGSGCIALL-----LRKELSQ---QGIDLEVTAVDVSPAAIQLTRENSKKL 161

Query: 157 KIPTLEILNSDLNQD 171
           KIP + IL SD+  D
Sbjct: 162 KIP-IRILKSDILSD 175

>Scas_612.5
          Length = 284

 Score = 31.6 bits (70), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 22/35 (62%), Gaps = 2/35 (5%)

Query: 169 NQDFRKEIDSIVE-KDRTDPTSILEMQRDLVFGET 202
           N+D    + + VE  DRTDPTSI   Q DLV GET
Sbjct: 214 NEDLNTVVSTTVETSDRTDPTSITTTQLDLV-GET 247

>Scas_637.15
          Length = 575

 Score = 29.3 bits (64), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%)

Query: 148 FPKLKRKGDKIPTLEILNSDLNQDFRKEIDSIVEKDRTDPTSILEMQRDLVFGETL 203
           F  LKR+G K+  LE +  DLN+ F + I    E+ + D   I++  R ++   +L
Sbjct: 193 FDTLKREGTKLTDLETIERDLNRTFPENIHFHREQFQKDEPIIIQSLRRVLIAFSL 248

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.137    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,181,111
Number of extensions: 476945
Number of successful extensions: 1347
Number of sequences better than 10.0: 15
Number of HSP's gapped: 1352
Number of HSP's successfully gapped: 18
Length of query: 352
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 249
Effective length of database: 13,030,455
Effective search space: 3244583295
Effective search space used: 3244583295
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)