Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_721.401834183496490.0
Sklu_2124.11830182670190.0
YBR208C (DUR1,2)1835183669640.0
Kwal_27.119511869183467740.0
KLLA0E08107g1829182767620.0
CAGL0M05533g1834183563490.0
ADR051C1819183257360.0
CAGL0K06787g11754387541e-81
KLLA0C05764g11734787391e-79
Kwal_14.180311744517362e-79
Scas_686.1711764387104e-76
YGL062W (PYC1)11784737104e-76
YBR218C (PYC2)11804517087e-76
CAGL0F06941g11804687089e-76
AAR162C11714606891e-73
Scas_563.1212164216751e-71
Sklu_1458.111324426596e-70
KLLA0F06072g22315105925e-61
Scas_720.7422315105863e-60
YMR207C (HFA1)21234765792e-59
YNR016C (ACC1)22335105675e-58
AAR071W22315335667e-58
CAGL0L10780g22335105641e-57
Kwal_23.615722305125622e-57
CAGL0M13585g4674642633e-23
Kwal_23.42494652712606e-23
YMR293C4644442492e-21
KLLA0A09845g4692752367e-20
Scas_684.254822052341e-19
ABR140C4632052261e-18
Kwal_56.222955832401781e-12
Sklu_2417.115912461718e-12
Sklu_2417.105912461718e-12
KLLA0E15444g22283011702e-11
CAGL0L05676g22113001674e-11
YJL130C (URA2)22143001603e-10
ACR263C22403011585e-10
Scas_582.4*21933001568e-10
Scas_721.665731291531e-09
Sklu_1884.25462691521e-09
YDR242W (AMD2)5492571493e-09
Sklu_2331.122203001397e-08
Kwal_33.1406122213001381e-07
Sklu_2136.36171561332e-07
Sklu_2413.411221811308e-07
Sklu_2072.34504331289e-07
Kwal_34.157245561681289e-07
KLLA0B08800g5702811289e-07
KLLA0F03190g11171851201e-05
Kwal_55.1978311212101154e-05
Kwal_27.104385691301145e-05
CAGL0C04917g11131771102e-04
YJR109C (CPA2)11181951083e-04
Scas_691.1911171981064e-04
KLLA0D12628g5781511020.001
ABR157W1113216910.027
Kwal_27.1148547175820.28
Scas_628.2448780761.4
CAGL0H07887g791120733.6
CAGL0L07634g113078734.1
YKL162C40292714.8
AGR068W348107705.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_721.40
         (1834 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_721.40                                                          3721   0.0  
Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement         2708   0.0  
YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...  2687   0.0  
Kwal_27.11951                                                        2613   0.0  
KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharo...  2609   0.0  
CAGL0M05533g complement(588667..594171) similar to sp|P32528 Sac...  2450   0.0  
ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH] (796213..8...  2214   0.0  
CAGL0K06787g complement(659290..662817) highly similar to sp|P32...   295   1e-81
KLLA0C05764g complement(512470..515991) highly similar to sp|P32...   289   1e-79
Kwal_14.1803                                                          288   2e-79
Scas_686.17                                                           278   4e-76
YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase...   278   4e-76
YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate ca...   277   7e-76
CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharo...   277   9e-76
AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (P...   270   1e-73
Scas_563.12                                                           264   1e-71
Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement         258   6e-70
KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharo...   232   5e-61
Scas_720.74                                                           230   3e-60
YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein w...   227   2e-59
YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-Co...   223   5e-58
AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (H...   222   7e-58
CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q...   221   1e-57
Kwal_23.6157                                                          221   2e-57
CAGL0M13585g complement(1335488..1336891) similar to sp|Q03557 S...   105   3e-23
Kwal_23.4249                                                          104   6e-23
YMR293C (YMR293C) [4247] chr13 complement(855398..856792) Protei...   100   2e-21
KLLA0A09845g complement(862467..863876) similar to sp|Q03557 Sac...    96   7e-20
Scas_684.25                                                            95   1e-19
ABR140C [732] [Homologous to ScYMR293C - SH] (662185..663576) [1...    92   1e-18
Kwal_56.22295                                                          73   1e-12
Sklu_2417.11 , Contig c2417 20071-21846                                70   8e-12
Sklu_2417.10 , Contig c2417 20071-21846                                70   8e-12
KLLA0E15444g 1370741..1377427 highly similar to sp|P07259 Saccha...    70   2e-11
CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharo...    69   4e-11
YJL130C (URA2) [2788] chr10 complement(165641..172285) Multifunc...    66   3e-10
ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..83...    65   5e-10
Scas_582.4*                                                            65   8e-10
Scas_721.66                                                            64   1e-09
Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement         63   1e-09
YDR242W (AMD2) [1076] chr4 (946799..948448) Protein with similar...    62   3e-09
Sklu_2331.1 YJL130C, Contig c2331 2029-8691                            58   7e-08
Kwal_33.14061                                                          58   1e-07
Sklu_2136.3 , Contig c2136 3336-5189 reverse complement                56   2e-07
Sklu_2413.4 YJR109C, Contig c2413 10886-14254                          55   8e-07
Sklu_2072.3 , Contig c2072 3010-4362 reverse complement                54   9e-07
Kwal_34.15724                                                          54   9e-07
KLLA0B08800g complement(772732..774444) similar to ca|CA4426|CaA...    54   9e-07
KLLA0F03190g complement(296883..300236) highly similar to sp|P03...    51   1e-05
Kwal_55.19783                                                          49   4e-05
Kwal_27.10438                                                          49   5e-05
CAGL0C04917g 457506..460847 highly similar to sp|P03965 Saccharo...    47   2e-04
YJR109C (CPA2) [3001] chr10 complement(629500..632856) Carbamoyl...    46   3e-04
Scas_691.19                                                            45   4e-04
KLLA0D12628g 1071637..1073373 weakly similar to sp|P22580 Saccha...    44   0.001
ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH] complement(6...    40   0.027
Kwal_27.11485                                                          36   0.28 
Scas_628.24                                                            34   1.4  
CAGL0H07887g 769859..772234 highly similar to sp|P07244 Saccharo...    33   3.6  
CAGL0L07634g complement(838412..841804) some similarities with s...    33   4.1  
YKL162C (YKL162C) [3108] chr11 complement(147635..148843) Protei...    32   4.8  
AGR068W [4378] [Homologous to ScYLR100W (ERG27) - SH] complement...    32   5.8  

>Scas_721.40
          Length = 1834

 Score = 3721 bits (9649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1804/1834 (98%), Positives = 1804/1834 (98%)

Query: 1    MTNNIAKKTLGWSIKDWIEFHQSVTADESFKQLQYLVECQQIAPTDPAWLSLCSADTLKK 60
            MTNNIAKKTLGWSIKDWIEFHQSVTADESFKQLQYLVECQQIAPTDPAWLSLCSADTLKK
Sbjct: 1    MTNNIAKKTLGWSIKDWIEFHQSVTADESFKQLQYLVECQQIAPTDPAWLSLCSADTLKK 60

Query: 61   QWQILQHRSGKESLPLYGVPVAIKDNIDARGFPTTAACPSFLYEPEKDSKVVKLLRNAGA 120
            QWQILQHRSGKESLPLYGVPVAIKDNIDARGFPTTAACPSFLYEPEKDSKVVKLLRNAGA
Sbjct: 61   QWQILQHRSGKESLPLYGVPVAIKDNIDARGFPTTAACPSFLYEPEKDSKVVKLLRNAGA 120

Query: 121  IIIGKTNLDQFATGLVGTRSPYGKTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTA 180
            IIIGKTNLDQFATGLVGTRSPYGKTPCVFSDKH              RGIVPIALGTDTA
Sbjct: 121  IIIGKTNLDQFATGLVGTRSPYGKTPCVFSDKHVSGGSSAGSASVVARGIVPIALGTDTA 180

Query: 181  GSGRVPAALNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESDLE 240
            GSGRVPAALNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESDLE
Sbjct: 181  GSGRVPAALNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESDLE 240

Query: 241  NDEYSRTYPRSPLRKFSDSVTIGIPKDLLWYGEEENPVLYDNAIKQLEKSGANITKIDFE 300
            NDEYSRTYPRSPLRKFSDSVTIGIPKDLLWYGEEENPVLYDNAIKQLEKSGANITKIDFE
Sbjct: 241  NDEYSRTYPRSPLRKFSDSVTIGIPKDLLWYGEEENPVLYDNAIKQLEKSGANITKIDFE 300

Query: 301  PLLELARCLYEGPWVAERYSAVKDFLQKNPSSKGFDHVVKSIIDSAKKFSAVDAFQFEYK 360
            PLLELARCLYEGPWVAERYSAVKDFLQKNPSSKGFDHVVKSIIDSAKKFSAVDAFQFEYK
Sbjct: 301  PLLELARCLYEGPWVAERYSAVKDFLQKNPSSKGFDHVVKSIIDSAKKFSAVDAFQFEYK 360

Query: 361  RQGLLQKIDKLLENIDALCVPTCPLNPTFEDVSNEPILVNSRQGTWTNFVNLADMAALAI 420
            RQGLLQKIDKLLENIDALCVPTCPLNPTFEDVSNEPILVNSRQGTWTNFVNLADMAALAI
Sbjct: 361  RQGLLQKIDKLLENIDALCVPTCPLNPTFEDVSNEPILVNSRQGTWTNFVNLADMAALAI 420

Query: 421  PSGFRSDGLPTGITLIGKKFTDFALLDLAQMYFQIAYPNNSRTFGIFTEGVEINDDKVSG 480
            PSGFRSDGLPTGITLIGKKFTDFALLDLAQMYFQIAYPNNSRTFGIFTEGVEINDDKVSG
Sbjct: 421  PSGFRSDGLPTGITLIGKKFTDFALLDLAQMYFQIAYPNNSRTFGIFTEGVEINDDKVSG 480

Query: 481  PVISSSDSIKLAVVGAHLKGLPLHWQLEKVNATFISSTKTSKNYELYALPRTGPILKPGL 540
            PVISSSDSIKLAVVGAHLKGLPLHWQLEKVNATFISSTKTSKNYELYALPRTGPILKPGL
Sbjct: 481  PVISSSDSIKLAVVGAHLKGLPLHWQLEKVNATFISSTKTSKNYELYALPRTGPILKPGL 540

Query: 541  RRVNEEGFAIQVETYSIPVENFGTFISMVPEPLGIGSVELENGEWVKSFICEESGYTAKG 600
            RRVNEEGFAIQVETYSIPVENFGTFISMVPEPLGIGSVELENGEWVKSFICEESGYTAKG
Sbjct: 541  RRVNEEGFAIQVETYSIPVENFGTFISMVPEPLGIGSVELENGEWVKSFICEESGYTAKG 600

Query: 601  SVNITKYGGFKTYLKFLETNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIFSTP 660
            SVNITKYGGFKTYLKFLETNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIFSTP
Sbjct: 601  SVNITKYGGFKTYLKFLETNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIFSTP 660

Query: 661  DRYSQHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERC 720
            DRYSQHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERC
Sbjct: 661  DRYSQHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERC 720

Query: 721  DAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGSSLITTAHEAKEIAAKLEYPIM 780
            DAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGSSLITTAHEAKEIAAKLEYPIM
Sbjct: 721  DAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGSSLITTAHEAKEIAAKLEYPIM 780

Query: 781  VKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGD 840
            VKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGD
Sbjct: 781  VKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGD 840

Query: 841  GLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEF 900
            GLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEF
Sbjct: 841  GLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEF 900

Query: 901  IYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPDFNQLKIDVNGVAM 960
            IYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPDFNQLKIDVNGVAM
Sbjct: 901  IYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPDFNQLKIDVNGVAM 960

Query: 961  EARLYAENPVHDFKPSPGQLVEVEFPKWARIDTWVSKGTIVTPEYDPTLAKIIVHGKDRH 1020
            EARLYAENPVHDFKPSPGQLVEVEFPKWARIDTWVSKGTIVTPEYDPTLAKIIVHGKDRH
Sbjct: 961  EARLYAENPVHDFKPSPGQLVEVEFPKWARIDTWVSKGTIVTPEYDPTLAKIIVHGKDRH 1020

Query: 1021 DALEKLNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILNSYDYKPSAMEIILPG 1080
            DALEKLNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILNSYDYKPSAMEIILPG
Sbjct: 1021 DALEKLNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILNSYDYKPSAMEIILPG 1080

Query: 1081 SHTSIQDYPGRKGCWRIGVPPSGPMDAFSFRLANKIVGNNHKAPAFEITLNGPTILFHID 1140
            SHTSIQDYPGRKGCWRIGVPPSGPMDAFSFRLANKIVGNNHKAPAFEITLNGPTILFHID
Sbjct: 1081 SHTSIQDYPGRKGCWRIGVPPSGPMDAFSFRLANKIVGNNHKAPAFEITLNGPTILFHID 1140

Query: 1141 AIIGITGGACVCQLNNTQIEQFKPIHVTSGDKLSIGKLLTGCRAYLAIRGGVDVPEYLGS 1200
            AIIGITGGACVCQLNNTQIEQFKPIHVTSGDKLSIGKLLTGCRAYLAIRGGVDVPEYLGS
Sbjct: 1141 AIIGITGGACVCQLNNTQIEQFKPIHVTSGDKLSIGKLLTGCRAYLAIRGGVDVPEYLGS 1200

Query: 1201 KSTFTLGNFGGYSGRCLKMGDTLFIDQNKLNKYVLPGHNYSDQPLSYSLLPDMPTDKQWK 1260
            KSTFTLGNFGGYSGRCLKMGDTLFIDQNKLNKYVLPGHNYSDQPLSYSLLPDMPTDKQWK
Sbjct: 1201 KSTFTLGNFGGYSGRCLKMGDTLFIDQNKLNKYVLPGHNYSDQPLSYSLLPDMPTDKQWK 1260

Query: 1261 IGVLCGPHGSPDFFKPEYVDSFFSEKWKVHYNSNRFGVRLSGPKPVWARKDGGEGGLHPS 1320
            IGVLCGPHGSPDFFKPEYVDSFFSEKWKVHYNSNRFGVRLSGPKPVWARKDGGEGGLHPS
Sbjct: 1261 IGVLCGPHGSPDFFKPEYVDSFFSEKWKVHYNSNRFGVRLSGPKPVWARKDGGEGGLHPS 1320

Query: 1321 NAHDYVYSLGAINFTGDEPVIVTCDGPSLGGFVCHAVVAESELWKVGQVKPGDYIQFVPI 1380
            NAHDYVYSLGAINFTGDEPVIVTCDGPSLGGFVCHAVVAESELWKVGQVKPGDYIQFVPI
Sbjct: 1321 NAHDYVYSLGAINFTGDEPVIVTCDGPSLGGFVCHAVVAESELWKVGQVKPGDYIQFVPI 1380

Query: 1381 SFESARELMKSQDVAINTLEPKSLKTLDDIITLPTPEDPVLRLLPERPGISPRITYRQAG 1440
            SFESARELMKSQDVAINTLEPKSLKTLDDIITLPTPEDPVLRLLPERPGISPRITYRQAG
Sbjct: 1381 SFESARELMKSQDVAINTLEPKSLKTLDDIITLPTPEDPVLRLLPERPGISPRITYRQAG 1440

Query: 1441 DRYILVEYGENIMDLNICYRIHSLIGLVDDYNTAGIVEMSQGVRSVLIEFDPYVISQTQX 1500
            DRYILVEYGENIMDLNICYRIHSLIGLVDDYNTAGIVEMSQGVRSVLIEFDPYVISQTQ 
Sbjct: 1441 DRYILVEYGENIMDLNICYRIHSLIGLVDDYNTAGIVEMSQGVRSVLIEFDPYVISQTQL 1500

Query: 1501 XXXXXXXXXXXXXXXNWTVNSKVIRLPMAFEDSKTMACVARYQETIRSSAPWLPNNADFV 1560
                           NWTVNSKVIRLPMAFEDSKTMACVARYQETIRSSAPWLPNNADFV
Sbjct: 1501 LTLLLAYEEELPYTENWTVNSKVIRLPMAFEDSKTMACVARYQETIRSSAPWLPNNADFV 1560

Query: 1561 ANINGITHKDVYDLVYSARFMVLGLGDVFLGSPCAVPLDPRHRLLGSKYNPSRTFTERGA 1620
            ANINGITHKDVYDLVYSARFMVLGLGDVFLGSPCAVPLDPRHRLLGSKYNPSRTFTERGA
Sbjct: 1561 ANINGITHKDVYDLVYSARFMVLGLGDVFLGSPCAVPLDPRHRLLGSKYNPSRTFTERGA 1620

Query: 1621 VGLGGMFMCIYAASSPGGYQLMGRTIPIWDKLLLLSSSEQPWLLNPFDQIEFYPVSEKEL 1680
            VGLGGMFMCIYAASSPGGYQLMGRTIPIWDKLLLLSSSEQPWLLNPFDQIEFYPVSEKEL
Sbjct: 1621 VGLGGMFMCIYAASSPGGYQLMGRTIPIWDKLLLLSSSEQPWLLNPFDQIEFYPVSEKEL 1680

Query: 1681 DRLTDDFDYGKYIVDSRKEKFNHMDYLKWVDENSKSITEFQLLQEGENAEKFAKLIELSN 1740
            DRLTDDFDYGKYIVDSRKEKFNHMDYLKWVDENSKSITEFQLLQEGENAEKFAKLIELSN
Sbjct: 1681 DRLTDDFDYGKYIVDSRKEKFNHMDYLKWVDENSKSITEFQLLQEGENAEKFAKLIELSN 1740

Query: 1741 AELDENDEIEKDQVNDYPENSVMIYSEYSGRFWKPLVTEGEFVKSGQGLIIIEAMKTEML 1800
            AELDENDEIEKDQVNDYPENSVMIYSEYSGRFWKPLVTEGEFVKSGQGLIIIEAMKTEML
Sbjct: 1741 AELDENDEIEKDQVNDYPENSVMIYSEYSGRFWKPLVTEGEFVKSGQGLIIIEAMKTEML 1800

Query: 1801 VPTLHDGKVLKIVHKNGSMVDSGDLVVVIEPIFA 1834
            VPTLHDGKVLKIVHKNGSMVDSGDLVVVIEPIFA
Sbjct: 1801 VPTLHDGKVLKIVHKNGSMVDSGDLVVVIEPIFA 1834

>Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement
          Length = 1830

 Score = 2708 bits (7019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1287/1826 (70%), Positives = 1500/1826 (82%), Gaps = 4/1826 (0%)

Query: 9    TLGWSIKDWIEFHQSVTADESFKQLQYLVECQQIAPTDPAWLSLCSADTLKKQWQILQHR 68
            TLGWS +DWI+FH   T + S+  L  L++ Q+ AP DPAW+SL +   L  QW++LQ +
Sbjct: 5    TLGWSAQDWIDFHGKSTPEHSYNTLLSLLKSQKSAPEDPAWISLINEANLAHQWKVLQSK 64

Query: 69   SGKESLPLYGVPVAIKDNIDARGFPTTAACPSFLYEPEKDSKVVKLLRNAGAIIIGKTNL 128
            + K+ LPLYGVP+A+KDNID++G PTTAACP+F Y P  DS VV LL++AGAI+IGKTNL
Sbjct: 65   ANKQQLPLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSADSTVVALLKDAGAIVIGKTNL 124

Query: 129  DQFATGLVGTRSPYGKTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAA 188
            DQFATGLVGTRSPYGKTPCVFSDKH              RGIVPIALGTDTAGSGRVPAA
Sbjct: 125  DQFATGLVGTRSPYGKTPCVFSDKHVSGGSSAGSASAVGRGIVPIALGTDTAGSGRVPAA 184

Query: 189  LNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESDLENDEYSRTY 248
            LNNLIGLKPTKG FSC GVVPACKSLDCVSVF++NLSDAE CFK++ + DLENDEYSR  
Sbjct: 185  LNNLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPDLENDEYSRPL 244

Query: 249  PRSPLRKFSDSVTIGIPKDLLWYGEEENPVLYDNAIKQLEKSGANITKIDFEPLLELARC 308
            P +PL+K+  +VTI IPK++ WYGE ENP LY  AI+ L+ +GA+I  IDFEPLL LARC
Sbjct: 245  PSNPLQKYPKNVTIAIPKEVPWYGETENPKLYAKAIENLKVAGASIVTIDFEPLLALARC 304

Query: 309  LYEGPWVAERYSAVKDFLQKNPSSKGFDHVVKSIIDSAKKFSAVDAFQFEYKRQGLLQKI 368
            LYEG WVAERY A KDF   NP     D  V SII +A K+ A D+F++EY+RQG+LQK+
Sbjct: 305  LYEGAWVAERYEATKDFFATNPPESSLDPTVTSIIKTATKYDAADSFRYEYQRQGILQKV 364

Query: 369  DKLLENIDALCVPTCPLNPTFEDVSNEPILVNSRQGTWTNFVNLADMAALAIPSGFRSDG 428
            D+ L++ID LCVPTCPLNPTFE+V+ EP+LVNSRQGTWTNFVNLADMAALA+P+GFR DG
Sbjct: 365  DQTLKDIDVLCVPTCPLNPTFEEVAAEPVLVNSRQGTWTNFVNLADMAALAVPAGFRPDG 424

Query: 429  LPTGITLIGKKFTDFALLDLAQMYFQIAYPNNSRTFGIFTE-GVEINDDKVSGPVISSSD 487
            LP G+TLIGKKFTDFALL+LA  YF++A+P  SRTFG F +  V   DD++ GP IS  D
Sbjct: 425  LPQGVTLIGKKFTDFALLELANRYFKVAFPQGSRTFGKFIDRQVTTKDDELRGPDISPED 484

Query: 488  SIKLAVVGAHLKGLPLHWQLEKVNATFISSTKTSKNYELYALPRTGPILKPGLRRVNEE- 546
            S+KLAVVGAHLKGLPL+WQLEKVNAT++ S KTSKNY+LYALP+TGPILKPGLRRV EE 
Sbjct: 485  SVKLAVVGAHLKGLPLYWQLEKVNATYLGSPKTSKNYKLYALPKTGPILKPGLRRVGEET 544

Query: 547  GFAIQVETYSIPVENFGTFISMVPEPLGIGSVELENGEWVKSFICEESGYTAKGSVNITK 606
            G  IQ+E YS+P ENFG FISMVPEPLGIGSVELE+GEWVKSFICEE GYT KG+V+ITK
Sbjct: 545  GSQIQLEVYSVPKENFGEFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQKGTVDITK 604

Query: 607  YGGFKTYLKFL-ETNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIFSTPDRYSQ 665
            YGGFK Y+ FL +   K KKPF TVL+ANRGEIAVRIIKTLKK+ I+SVA++S PD+YSQ
Sbjct: 605  YGGFKKYIDFLKQEEAKVKKPFETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQ 664

Query: 666  HVIDADLTVDLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDAEGI 725
            HVIDADL V L G +AA+TYL+I+KII AAK T AQAIIPGYGFLSENA+F+++C  EGI
Sbjct: 665  HVIDADLGVALNGRTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGI 724

Query: 726  TFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGSSLITTAHEAKEIAAKLEYPIMVKSTA 785
             FVGPSG+ +R LGLKHSAREIA+KA VPLVPGS L+T+A EAKEIA KLEYP+MVKSTA
Sbjct: 725  VFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGSGLVTSAKEAKEIANKLEYPVMVKSTA 784

Query: 786  GGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGNA 845
            GGGGIGLQKV+SE++IER+FETV+HQG AYFGDSGVF+ERF+ENARHVE+Q+MGDG G A
Sbjct: 785  GGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKA 844

Query: 846  LAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEI 905
            +AIGERDCSLQRRNQKIIEETPAPNL ETTR K+R+AA+ LGSLLKYKCAGTVEFIYDE 
Sbjct: 845  IAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDER 904

Query: 906  RDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPDFNQLKIDVNGVAMEARLY 965
            RDEFYFLEVN RLQVEHPITEMVTG+DLVEWML IAAD APDF    I V G ++EARLY
Sbjct: 905  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAADDAPDFESANIVVTGASIEARLY 964

Query: 966  AENPVHDFKPSPGQLVEVEFPKWARIDTWVSKGTIVTPEYDPTLAKIIVHGKDRHDALEK 1025
            AENP  DF+PSPG L +V FP+WAR+DTWVSKGT V+ EYDPTLAKIIVHGKDR+DA+ K
Sbjct: 965  AENPAKDFRPSPGLLTDVHFPEWARVDTWVSKGTTVSAEYDPTLAKIIVHGKDRNDAIMK 1024

Query: 1026 LNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILNSYDYKPSAMEIILPGSHTSI 1085
            +NKAL ET V GCITNIDYLRSI+SSEMF+ AKV+T IL+SYDYKP A E+  PG++T++
Sbjct: 1025 MNKALNETVVYGCITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTSPGAYTTV 1084

Query: 1086 QDYPGRKGCWRIGVPPSGPMDAFSFRLANKIVGNNHKAPAFEITLNGPTILFHIDAIIGI 1145
            QDYPGR G WRIGVPPSGPMDA+SFRLAN+IVGN++KAPA E+TLNGP ILFH + II I
Sbjct: 1085 QDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNHYKAPAIELTLNGPKILFHTETIIAI 1144

Query: 1146 TGGACVCQLNNTQIEQFKPIHVTSGDKLSIGKLLTGCRAYLAIRGGVDVPEYLGSKSTFT 1205
            +GG   C LN+  IEQ KPI V  GD L+IGKL  GCRAYLAIRGG+DVPEYLGS+STF 
Sbjct: 1145 SGGIAACSLNDKPIEQNKPIQVNRGDHLAIGKLSVGCRAYLAIRGGIDVPEYLGSRSTFA 1204

Query: 1206 LGNFGGYSGRCLKMGDTLFIDQNKLNKYVLPGHNYSDQPLSYSLLPDMPTDKQWKIGVLC 1265
            LGN GGY+GR LK+GD LF++Q +L    LPG  Y  Q    +LLP +  DK+W IGV C
Sbjct: 1205 LGNMGGYNGRVLKLGDVLFLNQPELASSSLPGPAYEPQAPPANLLPKISDDKEWTIGVTC 1264

Query: 1266 GPHGSPDFFKPEYVDSFFSEKWKVHYNSNRFGVRLSGPKPVWARKDGGEGGLHPSNAHDY 1325
            GPHGSPDFFKPE V+ FFSEKWKVHYNSNRFGVRL GPKP WARKDGGEGGLHPSNAHDY
Sbjct: 1265 GPHGSPDFFKPESVEEFFSEKWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNAHDY 1324

Query: 1326 VYSLGAINFTGDEPVIVTCDGPSLGGFVCHAVVAESELWKVGQVKPGDYIQFVPISFESA 1385
            VYSLGAINFTGDEPVI+T DGPSLGGFVC AVV E+ELWKVGQVKPGD IQFVPIS++ A
Sbjct: 1325 VYSLGAINFTGDEPVIITSDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPISYQVA 1384

Query: 1386 RELMKSQDVAINTLEPKSLKTLDDIITLPTPEDPVLRLLPERPGISPRITYRQAGDRYIL 1445
            R+L +SQD AI TLE   L+TL   + LPT EDPVL  LP++  +SP++TYRQAGDRYIL
Sbjct: 1385 RQLKESQDAAIETLEDGKLQTLTSDLILPTYEDPVLVQLPKKSNLSPKVTYRQAGDRYIL 1444

Query: 1446 VEYGENIMDLNICYRIHSLIGLVDDYNTAGIVEMSQGVRSVLIEFDPYVISQTQXXXXXX 1505
            VEYGEN MDLNI YRI+ LI LV  + T GIVEMSQGVRSVLIE+D Y ISQ        
Sbjct: 1445 VEYGENQMDLNIAYRINQLINLVGKHKTVGIVEMSQGVRSVLIEYDGYKISQGALLDTLV 1504

Query: 1506 XXXXXXXXXXNWTVNSKVIRLPMAFEDSKTMACVARYQETIRSSAPWLPNNADFVANING 1565
                      NW++ SK+ +LP+AFEDSKT+ CV RYQETIRS APWLPNN DFVA +N 
Sbjct: 1505 AYESEIQFDKNWSIKSKIFKLPLAFEDSKTLECVTRYQETIRSKAPWLPNNVDFVAEVND 1564

Query: 1566 ITHKDVYDLVYSARFMVLGLGDVFLGSPCAVPLDPRHRLLGSKYNPSRTFTERGAVGLGG 1625
            ITHKDV +++YSARF+VLGLGDVFLG+PCAVPLDPRHR LGSKYNPSRT+T+ G VG+GG
Sbjct: 1565 ITHKDVENMLYSARFLVLGLGDVFLGAPCAVPLDPRHRFLGSKYNPSRTYTKNGVVGIGG 1624

Query: 1626 MFMCIYAASSPGGYQLMGRTIPIWDKLLLLS-SSEQPWLLNPFDQIEFYPVSEKELDRLT 1684
            M+MCIYA  SPGGYQL+GRTIPIWDKL L S S E PWLL PFDQ+EFYPVSE+ELDR T
Sbjct: 1625 MYMCIYAMDSPGGYQLVGRTIPIWDKLKLGSHSQEHPWLLTPFDQVEFYPVSEEELDRFT 1684

Query: 1685 DDFDYGKYIVDSRKEKFNHMDYLKWVDENSKSITEFQLLQEGENAEKFAKLIELSNAELD 1744
            +D + GK+ V   +  F+H +YLKW++EN +SITEFQ  Q G  A++FA+LI+++N EL+
Sbjct: 1685 EDCENGKFPVQVEESVFDHKNYLKWINENIESITEFQKSQGGAKADEFARLIQVANQELE 1744

Query: 1745 ENDEIEKDQVNDYPENSVMIYSEYSGRFWKPLVTEGEFVKSGQGLIIIEAMKTEMLVPTL 1804
             +   +     +YPE++ M+YSEYSGRFWKP+V+ G+ V  G GL+I+EAMKTEM+VP  
Sbjct: 1745 SSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVEAMKTEMVVPAK 1804

Query: 1805 HDGKVLKIVHKNGSMVDSGDLVVVIE 1830
              GKVLKIVHKNG MVD+G +V VI+
Sbjct: 1805 KSGKVLKIVHKNGDMVDAGGIVAVIQ 1830

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score = 2687 bits (6964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1264/1836 (68%), Positives = 1515/1836 (82%), Gaps = 11/1836 (0%)

Query: 2    TNNIAKKTLGWSIKDWIEFHQSVTADESFKQLQYLVECQQIAPTDPAWLSLCSADTLKKQ 61
            ++  A+ +LGWSI+DWI+FH+S ++  S + L+ L++ Q +AP D AW+SL S + L  Q
Sbjct: 5    SDTTAEISLGWSIQDWIDFHKSSSSQASLRLLESLLDSQNVAPVDNAWISLISKENLLHQ 64

Query: 62   WQILQHRSGKESLPLYGVPVAIKDNIDARGFPTTAACPSFLYEPEKDSKVVKLLRNAGAI 121
            +QIL+ R  KE+LPLYGVP+A+KDNID RG PTTAACPSF YEP KDSKVV+LLRNAGAI
Sbjct: 65   FQILKSRENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSKDSKVVELLRNAGAI 124

Query: 122  IIGKTNLDQFATGLVGTRSPYGKTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAG 181
            I+GKTNLDQFATGLVGTRSPYGKTPC FS +H              RGIVPIALGTDTAG
Sbjct: 125  IVGKTNLDQFATGLVGTRSPYGKTPCAFSKEHVSGGSSAGSASVVARGIVPIALGTDTAG 184

Query: 182  SGRVPAALNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESDLEN 241
            SGRVPAALNNLIGLKPTKG FSCQGVVPACKSLDCVS+F+LNLSDAE CF+I+C+ D +N
Sbjct: 185  SGRVPAALNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQPDPDN 244

Query: 242  DEYSRTYPRSPLRKFSDSVTIGIPKDLLWYGEEENPVLYDNAIKQLEKSGANITKIDFEP 301
            DEYSR Y  +PL+KFS +VTI IPK++ WYGE +NPVL+ NA++ L ++GAN+ +IDFEP
Sbjct: 245  DEYSRPYVSNPLKKFSSNVTIAIPKNIPWYGETKNPVLFSNAVENLSRTGANVIEIDFEP 304

Query: 302  LLELARCLYEGPWVAERYSAVKDFLQKNPSSKGFDHVVKSIIDSAKKFSAVDAFQFEYKR 361
            LLELARCLYEG WVAERY A++ FL   P  +  D  V SII+ AKK+SAVD F FEYKR
Sbjct: 305  LLELARCLYEGTWVAERYQAIQSFLDSKPPKESLDPTVISIIEGAKKYSAVDCFSFEYKR 364

Query: 362  QGLLQKIDKLLENIDALCVPTCPLNPTFEDVSNEPILVNSRQGTWTNFVNLADMAALAIP 421
            QG+LQK+ +LLE++D LCVPTCPLNPT + V++EP+LVNSRQGTWTNFVNLAD+AALA+P
Sbjct: 365  QGILQKVRRLLESVDVLCVPTCPLNPTMQQVADEPVLVNSRQGTWTNFVNLADLAALAVP 424

Query: 422  SGFRSDGLPTGITLIGKKFTDFALLDLAQMYFQIAYPNNSRTFGIFTEG-VEINDDKVSG 480
            +GFR DGLP GITLIGKKFTD+ALL+LA  YFQ  +PN SRT+G FT   V+  +D++ G
Sbjct: 425  AGFRDDGLPNGITLIGKKFTDYALLELANRYFQNIFPNGSRTYGTFTSSSVKPANDQLVG 484

Query: 481  PVISSSDSIKLAVVGAHLKGLPLHWQLEKVNATFISSTKTSKNYELYALPRTGPILKPGL 540
            P    S SIKLAVVGAHLKGLPLHWQLEKVNAT++ +TKTSK Y+L+ALP+ GP+LKPGL
Sbjct: 485  PDYDPSTSIKLAVVGAHLKGLPLHWQLEKVNATYLCTTKTSKAYQLFALPKNGPVLKPGL 544

Query: 541  RRVNEE-GFAIQVETYSIPVENFGTFISMVPEPLGIGSVELENGEWVKSFICEESGYTAK 599
            RRV +  G  I++E YS+P E FG FISMVPEPLGIGSVELE+GEW+KSFICEESGY AK
Sbjct: 545  RRVQDSNGSQIELEVYSVPKELFGAFISMVPEPLGIGSVELESGEWIKSFICEESGYKAK 604

Query: 600  GSVNITKYGGFKTYLKFLETNTKTKKP-FTTVLVANRGEIAVRIIKTLKKMEIQSVAIFS 658
            G+V+ITKYGGF+ Y + L+     KK  F TVL+ANRGEIAVRIIKTLKK+ I+SVA++S
Sbjct: 605  GTVDITKYGGFRAYFEMLKKKESQKKKLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYS 664

Query: 659  TPDRYSQHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSE 718
             PD+YSQHV DAD++V L G +AA TYL++ KIIDAAK+T AQAIIPGYGFLSENADFS+
Sbjct: 665  DPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSD 724

Query: 719  RCDAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGSSLITTAHEAKEIAAKLEYP 778
             C + GITFVGPSGD++RGLGLKHSAR+IA+KA VPLVPGS LIT+  EAK++AA+LEYP
Sbjct: 725  ACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSLLITSVEEAKKVAAELEYP 784

Query: 779  IMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIM 838
            +MVKSTAGGGGIGLQKV+SE+DIE IFETVKHQG  +FGD+GVF+ERFIENARHVEVQ+M
Sbjct: 785  VMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLM 844

Query: 839  GDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTV 898
            GDG G A+A+GERDCSLQRRNQK+IEETPAPNLPE TR  LR+AA+ LGSLL YKCAGTV
Sbjct: 845  GDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTV 904

Query: 899  EFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPDFNQLKIDVNGV 958
            EFIYDE +DEFYFLEVNTRLQVEHPITEMVTG+DLVEWM+ IAA+ APDF+  K++VNGV
Sbjct: 905  EFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDSTKVEVNGV 964

Query: 959  AMEARLYAENPVHDFKPSPGQLVEVEFPKWARIDTWVSKGTIVTPEYDPTLAKIIVHGKD 1018
            +MEARLYAENP+ +F+PSPG LV+V+FP WAR+DTWV KGT ++PEYDPTLAKIIVHGKD
Sbjct: 965  SMEARLYAENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTLAKIIVHGKD 1024

Query: 1019 RHDALEKLNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILNSYDYKPSAMEIIL 1078
            R DA+ KLN+AL ETKV GCITNIDYL+SI +S+ F  AKVSTNILNSY Y+P+A+EI L
Sbjct: 1025 RDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILNSYQYEPTAIEITL 1084

Query: 1079 PGSHTSIQDYPGRKGCWRIGVPPSGPMDAFSFRLANKIVGNNHKAPAFEITLNGPTILFH 1138
            PG+HTSIQDYPGR G WRIGVPPSGPMDA+SFRLAN+IVGN+++ PA E+TL GP+I+FH
Sbjct: 1085 PGAHTSIQDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPSIVFH 1144

Query: 1139 IDAIIGITGGACVCQLNNTQIEQFKPIHVTSGDKLSIGKLLTGCRAYLAIRGGVDVPEYL 1198
             + +I ITGG  +C L+  +I Q KP+ V  G  LSIGKL +GCRAYL IRGG+DVP+YL
Sbjct: 1145 CETVIAITGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRGGIDVPKYL 1204

Query: 1199 GSKSTFTLGNFGGYSGRCLKMGDTLFIDQNKLNKYV--LPGHNYSDQPLSYSLLPDMPTD 1256
            GS STFTLGN GGY+GR LK+GD LF+  N+ NK V  LP      Q +  SL+P +   
Sbjct: 1205 GSYSTFTLGNVGGYNGRVLKLGDVLFLPSNEENKSVECLP------QNIPQSLIPQISET 1258

Query: 1257 KQWKIGVLCGPHGSPDFFKPEYVDSFFSEKWKVHYNSNRFGVRLSGPKPVWARKDGGEGG 1316
            K+W+IGV CGPHGSPDFFKPE ++ FFSEKWKVHYNSNRFGVRL GPKP WAR +GGEGG
Sbjct: 1259 KEWRIGVTCGPHGSPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSNGGEGG 1318

Query: 1317 LHPSNAHDYVYSLGAINFTGDEPVIVTCDGPSLGGFVCHAVVAESELWKVGQVKPGDYIQ 1376
            +HPSN HDYVYSLGAINFTGDEPVI+TCDGPSLGGFVC AVV E+ELWKVGQVKPGD IQ
Sbjct: 1319 MHPSNTHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQ 1378

Query: 1377 FVPISFESARELMKSQDVAINTLEPKSLKTLDDIITLPTPEDPVLRLLPERPGISPRITY 1436
            FVP+S+ES+R L +SQDVAI +L+   L+ LD +  LP+ E P+L  + +   +SP++ Y
Sbjct: 1379 FVPLSYESSRSLKESQDVAIKSLDGTKLRRLDSVSILPSFETPILAQMEKVNELSPKVVY 1438

Query: 1437 RQAGDRYILVEYGENIMDLNICYRIHSLIGLVDDYNTAGIVEMSQGVRSVLIEFDPYVIS 1496
            RQAGDRY+LVEYG+N M+ NI YRI  LI LV    T GIVEMSQGVRSVLIEFD Y ++
Sbjct: 1439 RQAGDRYVLVEYGDNEMNFNISYRIECLISLVKKNKTIGIVEMSQGVRSVLIEFDGYKVT 1498

Query: 1497 QTQXXXXXXXXXXXXXXXXNWTVNSKVIRLPMAFEDSKTMACVARYQETIRSSAPWLPNN 1556
            Q +                NW + S +IRLPMAFEDSKT+ACV RYQETIRSSAPWLPNN
Sbjct: 1499 QKELLKVLVAYETEIQFDENWKITSNIIRLPMAFEDSKTLACVQRYQETIRSSAPWLPNN 1558

Query: 1557 ADFVANINGITHKDVYDLVYSARFMVLGLGDVFLGSPCAVPLDPRHRLLGSKYNPSRTFT 1616
             DF+AN+NGI+  +VYD++YSARFMVLGLGDVFLGSPCAVPLDPRHR LGSKYNPSRT+T
Sbjct: 1559 VDFIANVNGISRNEVYDMLYSARFMVLGLGDVFLGSPCAVPLDPRHRFLGSKYNPSRTYT 1618

Query: 1617 ERGAVGLGGMFMCIYAASSPGGYQLMGRTIPIWDKLLLLSSSEQPWLLNPFDQIEFYPVS 1676
            ERGAVG+GGM+MCIYAA+SPGGYQL+GRTIPIWDKL L +SSE PWL+NPFDQ+EFYPVS
Sbjct: 1619 ERGAVGIGGMYMCIYAANSPGGYQLVGRTIPIWDKLCLAASSEVPWLMNPFDQVEFYPVS 1678

Query: 1677 EKELDRLTDDFDYGKYIVDSRKEKFNHMDYLKWVDENSKSITEFQLLQEGENAEKFAKLI 1736
            E++LD++T+D D G Y V+  K  F+H +YL+W++ N  SIT FQ  Q GE AE+FAKLI
Sbjct: 1679 EEDLDKMTEDCDNGVYKVNIEKSVFDHQEYLRWINANKDSITAFQEGQLGERAEEFAKLI 1738

Query: 1737 ELSNAELDENDEIEKDQVNDYPENSVMIYSEYSGRFWKPLVTEGEFVKSGQGLIIIEAMK 1796
            + +N+EL E+  ++ D+  D+PE + ++YSEYSGRFWK + + G+ +++GQGL+IIEAMK
Sbjct: 1739 QNANSELKESVTVKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAMK 1798

Query: 1797 TEMLVPTLHDGKVLKIVHKNGSMVDSGDLVVVIEPI 1832
             EM++     GK++KI H NG MVDSGD+V VIE +
Sbjct: 1799 AEMIISAPKSGKIIKICHGNGDMVDSGDIVAVIETL 1834

>Kwal_27.11951
          Length = 1869

 Score = 2613 bits (6774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1242/1834 (67%), Positives = 1474/1834 (80%), Gaps = 4/1834 (0%)

Query: 1    MTNNIAK-KTLGWSIKDWIEFHQSVTADESFKQLQYLVECQQIAPTDPAWLSLCSADTLK 59
            + NN++   TLGWS++DW+ FH   T + S   L  L+  Q+ AP DPAW+SL S + L+
Sbjct: 36   IPNNMSSVNTLGWSVQDWLGFHAEATPEASLAALSALIGAQKSAPEDPAWISLVSQEHLE 95

Query: 60   KQWQILQHRSGKESLPLYGVPVAIKDNIDARGFPTTAACPSFLYEPEKDSKVVKLLRNAG 119
             QW+ILQ +  K+ LPLYGVP+A+KDNIDA G  TTAACP F Y P  DS VV LLR+AG
Sbjct: 96   HQWRILQSKGDKKELPLYGVPIAVKDNIDATGCETTAACPEFAYTPSNDSTVVALLRDAG 155

Query: 120  AIIIGKTNLDQFATGLVGTRSPYGKTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDT 179
            AI+IGKTNLDQFATGLVGTRSPYGKTPCVFS++H              RGIVP+ALGTDT
Sbjct: 156  AIVIGKTNLDQFATGLVGTRSPYGKTPCVFSNEHVSGGSSAGSASVVGRGIVPLALGTDT 215

Query: 180  AGSGRVPAALNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESDL 239
            AGSGRVPAALNNLIGLKP+KG FSC GVVPACKSLDCVS+F+LNL DAE CFK++ + D 
Sbjct: 216  AGSGRVPAALNNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDT 275

Query: 240  ENDEYSRTYPRSPLRKFSDSVTIGIPKDLLWYGEEENPVLYDNAIKQLEKSGANITKIDF 299
            E DEYSR  P +PL+K++   TI +P  L WY E EN V Y  AI+ L+K+GA + ++DF
Sbjct: 276  EKDEYSRAMPANPLQKYAKDATIAVPTKLPWYDETENFVHYAAAIENLKKTGAKVVEVDF 335

Query: 300  EPLLELARCLYEGPWVAERYSAVKDFLQKNPSSKGFDHVVKSIIDSAKKFSAVDAFQFEY 359
            EPLLELARCLYEG WVAERY A +DF  KNPS    D  V  II     + A DAF++EY
Sbjct: 336  EPLLELARCLYEGAWVAERYEATRDFFAKNPSESSLDPTVTKIIKGGANYDAADAFRYEY 395

Query: 360  KRQGLLQKIDKLLENIDALCVPTCPLNPTFEDVSNEPILVNSRQGTWTNFVNLADMAALA 419
            KRQG+LQK+ KLLE ID LCVPTCP NPTF  +   P+ +NSRQGTWTNFVNLAD+AALA
Sbjct: 396  KRQGILQKVSKLLETIDVLCVPTCPHNPTFAQLEAMPVEMNSRQGTWTNFVNLADLAALA 455

Query: 420  IPSGFRSDGLPTGITLIGKKFTDFALLDLAQMYFQIAYPNNSRTFGIFTEGVEINDDKVS 479
            +P GFRSDGLPTGITLIGK FTD+ALL+LA  YFQIA+PNNSRT+G F E      D + 
Sbjct: 456  VPCGFRSDGLPTGITLIGKTFTDYALLELANRYFQIAFPNNSRTYGKFLETPITTQDNLQ 515

Query: 480  GPVISSSDSIKLAVVGAHLKGLPLHWQLEKVNATFISSTKTSKNYELYALPRTGPILKPG 539
            GP  S+ DSIKLAVVGAHLKGLPLHWQLEKVNA +I S KTS NY LYALP+TGP+LKPG
Sbjct: 516  GPPFSTEDSIKLAVVGAHLKGLPLHWQLEKVNAQYIGSPKTSPNYRLYALPKTGPVLKPG 575

Query: 540  LRRVNEEGFA-IQVETYSIPVENFGTFISMVPEPLGIGSVELENGEWVKSFICEESGYTA 598
            LRRV+ EG A IQ+E YS+P + FGTFISMVPEPLGIGSVELE+GEWVKSFICEE GYT 
Sbjct: 576  LRRVDSEGGAQIQLEVYSVPKDQFGTFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQ 635

Query: 599  KGSVNITKYGGFKTYL-KFLETNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIF 657
             G+ +IT+ G FKTY+ +     ++ KKPF TVLVANRGEIAVRIIKTLKK++I+SVA++
Sbjct: 636  DGTKDITELGSFKTYVDQLAREESEKKKPFETVLVANRGEIAVRIIKTLKKLKIKSVAVY 695

Query: 658  STPDRYSQHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFS 717
            S PD+YSQHV DAD+ V LKG +AA+TYL+I+KII AAK+TG +AIIPGYGFLSENADFS
Sbjct: 696  SDPDKYSQHVTDADVAVALKGRTAAETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFS 755

Query: 718  ERCDAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGSSLITTAHEAKEIAAKLEY 777
            +RC +EGI FVGP+GD +R LGLKHSAREIA+KA VPLVPGS L+ T  EA+EIA  LEY
Sbjct: 756  DRCASEGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEY 815

Query: 778  PIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQI 837
            P+MVKSTAGGGGIGLQKV+SE+DIER+FETV+HQG AYFGDSGVF+ERF+ENARHVE+Q+
Sbjct: 816  PVMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQM 875

Query: 838  MGDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGT 897
            MGDG G A+AIGERDCSLQRRNQK+IEETPAPNL E TR ++REA++ LGSLLKY+CAGT
Sbjct: 876  MGDGKGKAIAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGT 935

Query: 898  VEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPDFNQLKIDVNG 957
            VEFIYDE RDEFYFLEVN RLQVEHPITEMVTG+DLVEWML+IAA   PDF+  KI V G
Sbjct: 936  VEFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTG 995

Query: 958  VAMEARLYAENPVHDFKPSPGQLVEVEFPKWARIDTWVSKGTIVTPEYDPTLAKIIVHGK 1017
             ++EARLYAENPV DF+PSPGQL +V FP+WAR+DTWVSKGT ++ EYDPTLAKIIVHGK
Sbjct: 996  ASIEARLYAENPVKDFRPSPGQLTDVSFPEWARVDTWVSKGTTISAEYDPTLAKIIVHGK 1055

Query: 1018 DRHDALEKLNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILNSYDYKPSAMEII 1077
            DR +A++KLN+AL ET + GCITNIDYLRSI+SSEMF+ AKV+T +L+SYDY+PSA EI 
Sbjct: 1056 DRDEAIQKLNQALNETSIYGCITNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEIT 1115

Query: 1078 LPGSHTSIQDYPGRKGCWRIGVPPSGPMDAFSFRLANKIVGNNHKAPAFEITLNGPTILF 1137
             PG++T++QDYPGR   WRIGVPPSGPMD++SFRLAN+IVGN++KAPA EITLNGP +LF
Sbjct: 1116 SPGAYTTVQDYPGRVRHWRIGVPPSGPMDSYSFRLANRIVGNHYKAPAIEITLNGPKLLF 1175

Query: 1138 HIDAIIGITGGACVCQLNNTQIEQFKPIHVTSGDKLSIGKLLTGCRAYLAIRGGVDVPEY 1197
            H DA+I ITG    C +N + + Q KP+ V  GD+L++GKL  GCRAYLAIRGG+DVPEY
Sbjct: 1176 HTDAVIAITGAKAPCTINGSDVSQNKPLSVKKGDQLTVGKLSDGCRAYLAIRGGIDVPEY 1235

Query: 1198 LGSKSTFTLGNFGGYSGRCLKMGDTLFIDQNKLNKYVLPGHNYSDQPLSYSLLPDMPTDK 1257
            LGS+STF LGN GGY+GR LK+GD LF++Q +L    +P   Y       SLLP +   K
Sbjct: 1236 LGSRSTFALGNMGGYNGRVLKLGDVLFLNQPELPSSGIPAPVYDPSEPPASLLPAISGSK 1295

Query: 1258 QWKIGVLCGPHGSPDFFKPEYVDSFFSEKWKVHYNSNRFGVRLSGPKPVWARKDGGEGGL 1317
            +WKIGV CGPHGSPDFFKPE V+ FFSE+WKVHYNSNRFGVRL GPKP WARKDGGEGGL
Sbjct: 1296 EWKIGVTCGPHGSPDFFKPESVEEFFSEQWKVHYNSNRFGVRLIGPKPKWARKDGGEGGL 1355

Query: 1318 HPSNAHDYVYSLGAINFTGDEPVIVTCDGPSLGGFVCHAVVAESELWKVGQVKPGDYIQF 1377
            HPSNAHDYVYSLGAINFTGDEPVI+T DGPSLGGFVC AVV E ELWKVGQVKPGD IQF
Sbjct: 1356 HPSNAHDYVYSLGAINFTGDEPVIITADGPSLGGFVCQAVVPEGELWKVGQVKPGDLIQF 1415

Query: 1378 VPISFESARELMKSQDVAINTLEPKSLKTLDDIITLPTPEDPVLRLLPERPGISPRITYR 1437
            VP+S+E+AR L +SQD AI T E  SL+TL   + LP  E+PVL  LP     SP++TYR
Sbjct: 1416 VPVSYETARVLKESQDQAIETFENGSLRTLTSELVLPAAENPVLAQLPRYSEFSPKVTYR 1475

Query: 1438 QAGDRYILVEYGENIMDLNICYRIHSLIGLVDDYNTAGIVEMSQGVRSVLIEFDPYVISQ 1497
            QAGDRY+LVEYGEN MDLNI YR++ LI LV+   T GIVEMSQGVRSVL+EFD Y ISQ
Sbjct: 1476 QAGDRYVLVEYGENEMDLNISYRVNRLINLVEKNKTIGIVEMSQGVRSVLVEFDGYKISQ 1535

Query: 1498 TQXXXXXXXXXXXXXXXXNWTVNSKVIRLPMAFEDSKTMACVARYQETIRSSAPWLPNNA 1557
                              NW++ SKV +LP+AFEDS+T+ CV RYQETIRS APWLPNN 
Sbjct: 1536 KALLETLIAYEGEIKFDRNWSIKSKVFKLPLAFEDSETLECVKRYQETIRSKAPWLPNNV 1595

Query: 1558 DFVANINGITHKDVYDLVYSARFMVLGLGDVFLGSPCAVPLDPRHRLLGSKYNPSRTFTE 1617
            DF+A++NGI+H DV D++Y ARF+VLGLGDVFLG+PCAVPL+P HR LGSKYNPSRT+T+
Sbjct: 1596 DFIADVNGISHSDVEDMLYQARFLVLGLGDVFLGAPCAVPLNPTHRFLGSKYNPSRTYTK 1655

Query: 1618 RGAVGLGGMFMCIYAASSPGGYQLMGRTIPIWDKLLL-LSSSEQPWLLNPFDQIEFYPVS 1676
             G VG+GGM+MCIYA  SPGGYQL+GRTIPIWDKL L   SS+ PWLL PFDQ+E+Y V+
Sbjct: 1656 NGTVGIGGMYMCIYAMDSPGGYQLVGRTIPIWDKLQLGAHSSQHPWLLTPFDQVEYYQVT 1715

Query: 1677 EKELDRLTDDFDYGKYIVDSRKEKFNHMDYLKWVDENSKSITEFQLLQEGENAEKFAKLI 1736
            E EL++ T++ + G++ V   +  F+H +YLKW+D NS+ I EFQ  Q GE AE+FAKLI
Sbjct: 1716 EDELNKFTEECENGQFPVQVEESTFDHGEYLKWIDANSEIIKEFQNKQNGEKAEEFAKLI 1775

Query: 1737 ELSNAELDENDEIEKDQVNDYPENSVMIYSEYSGRFWKPLVTEGEFVKSGQGLIIIEAMK 1796
            + SNAEL++  + +     ++PE++ M+YSEYSGRFWKPLV+ G+ VK+G GLI++EAMK
Sbjct: 1776 QESNAELEKAPDSQGAVEEEFPEDAEMVYSEYSGRFWKPLVSVGDVVKAGDGLIVVEAMK 1835

Query: 1797 TEMLVPTLHDGKVLKIVHKNGSMVDSGDLVVVIE 1830
            TEM+V     GKVLK+VHKNG MV++GD+VVVI+
Sbjct: 1836 TEMMVSAPKGGKVLKVVHKNGDMVEAGDVVVVIQ 1869

>KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharomyces
            cerevisiae YBR208c DUR1_2 urea amidolyase, start by
            similarity
          Length = 1829

 Score = 2609 bits (6762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1221/1827 (66%), Positives = 1485/1827 (81%), Gaps = 4/1827 (0%)

Query: 7    KKTLGWSIKDWIEFHQSVTADESFKQLQYLVECQQIAPTDPAWLSLCSADTLKKQWQILQ 66
            + TLGWS++DW+ FH   T  +S + L+ L++ Q+ AP DPAW+SL   + L  QW ILQ
Sbjct: 2    ESTLGWSVQDWLSFHSKSTPTKSLELLENLLKSQKPAPEDPAWISLIPVEDLHHQWNILQ 61

Query: 67   HRSGKESLPLYGVPVAIKDNIDARGFPTTAACPSFLYEPEKDSKVVKLLRNAGAIIIGKT 126
             +S KE LPLYGVP+A+KDNID +G PTTAACPS+LY+P +DS VV+LLR+AGA++IGKT
Sbjct: 62   SKSNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYLYQPTRDSYVVELLRDAGAVVIGKT 121

Query: 127  NLDQFATGLVGTRSPYGKTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVP 186
            NLDQFATGLVGTRSPYGKTPCVF+DK+              RGIVP++LGTDTAGSGRVP
Sbjct: 122  NLDQFATGLVGTRSPYGKTPCVFNDKYVSGGSSAGSASVVGRGIVPLSLGTDTAGSGRVP 181

Query: 187  AALNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESDLENDEYSR 246
            AALNNLIGLKPTKG FSC+GVVPACKSLDCVSVF+LNLSDAE  FK++ + DL  DEYSR
Sbjct: 182  AALNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVMNKPDLLEDEYSR 241

Query: 247  TYPRSPLRKFSDSVTIGIPKDLLWYGEEENPVLYDNAIKQLEKSGANITKIDFEPLLELA 306
             +P++P+ ++   +TI IPK++ W+GE ENP LY  A+  L+ +GA I  +DFEPLLELA
Sbjct: 242  EFPKNPISQYPKDLTIAIPKEVPWFGETENPKLYTKAVASLKNTGAKIVVVDFEPLLELA 301

Query: 307  RCLYEGPWVAERYSAVKDFLQKNPSSKGFDHVVKSIIDSAKKFSAVDAFQFEYKRQGLLQ 366
            RCLYEG WVAERY A +DFL  NP     D  V +II  A KF A DAF+FEYKRQG+LQ
Sbjct: 302  RCLYEGAWVAERYCATRDFLATNPPESSLDETVVNIIKGAVKFDAADAFKFEYKRQGILQ 361

Query: 367  KIDKLLENIDALCVPTCPLNPTFEDVSNEPILVNSRQGTWTNFVNLADMAALAIPSGFRS 426
            K++ LL++ID LCVPTCPLNP  E+V+ EP+LVNSRQGTWTNFVNLAD+AALA+PSGFRS
Sbjct: 362  KVNLLLKDIDVLCVPTCPLNPKLEEVAQEPVLVNSRQGTWTNFVNLADLAALAVPSGFRS 421

Query: 427  DGLPTGITLIGKKFTDFALLDLAQMYFQIAYPNNSRTFGIFTEGVEINDDKVSGPVISSS 486
            DGLP GITLIGKKF+D+ALLDLA+ +F +A+PNNSRT+G F +     +D++ GP   + 
Sbjct: 422  DGLPNGITLIGKKFSDYALLDLAKRFFSVAFPNNSRTYGKFVDRRITVEDELDGPSKDTL 481

Query: 487  DSIKLAVVGAHLKGLPLHWQLEKVNATFISSTKTSKNYELYALPRTGPILKPGLRRVNE- 545
            + +KLAVVGAHLKGLPLHWQL+K NAT++SS KTS NY+LYALP+ GP+LKPGLRRVN+ 
Sbjct: 482  NGVKLAVVGAHLKGLPLHWQLQKCNATYLSSPKTSNNYKLYALPKVGPVLKPGLRRVNDG 541

Query: 546  EGFAIQVETYSIPVENFGTFISMVPEPLGIGSVELENGEWVKSFICEESGYTAKGSVNIT 605
             G  IQ+E YS+P + FG FI+MVPEPLGIGSVELE+GEWVKSFICEE GYT +G+V+IT
Sbjct: 542  TGSQIQLEVYSVPYDRFGDFIAMVPEPLGIGSVELESGEWVKSFICEEFGYTQQGTVDIT 601

Query: 606  KYGGFKTYLKFLE-TNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIFSTPDRYS 664
            K+GGFK Y++ ++ T  + KKPF TVL+ANRGEIAVRI+KTLK+M I+SVA++S PD+YS
Sbjct: 602  KFGGFKPYIEHIQVTEAQKKKPFETVLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYS 661

Query: 665  QHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDAEG 724
            QHV DAD +V L G +AA+TYL+I+KII+AAKKTGAQAIIPGYGFLSENADFS+RC  E 
Sbjct: 662  QHVTDADFSVALHGRTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQEN 721

Query: 725  ITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGSSLITTAHEAKEIAAKLEYPIMVKST 784
            I FVGPSGD +R LGLKHSAREIA++A VPLVPGS LI  A EAKE+A KLEYP+MVKST
Sbjct: 722  IVFVGPSGDAIRKLGLKHSAREIAERAKVPLVPGSGLIKDAKEAKEVAKKLEYPVMVKST 781

Query: 785  AGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGN 844
            AGGGGIGLQKV+SEDDIER+FETV+HQG +YFGD+GVFMERF+ NARHVE+Q+MGDG G 
Sbjct: 782  AGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGK 841

Query: 845  ALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDE 904
            A+AIGERDCSLQRRNQK+IEETPAPNLPE TR K+R A++RLGSLLKYKCAGTVEFIYDE
Sbjct: 842  AIAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDE 901

Query: 905  IRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPDFNQLKIDVNGVAMEARL 964
             RDEFYFLEVN RLQVEHPITEMVTG+DLVEWML IAA+ +PDF+  KI+V+G ++EARL
Sbjct: 902  QRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDSPDFDNTKIEVSGASIEARL 961

Query: 965  YAENPVHDFKPSPGQLVEVEFPKWARIDTWVSKGTIVTPEYDPTLAKIIVHGKDRHDALE 1024
            YAENPV DF+PSPGQL  V FP WAR+DTWV KGT V+ EYDPTLAKIIVHGKDR+DA+ 
Sbjct: 962  YAENPVKDFRPSPGQLTSVSFPSWARVDTWVKKGTNVSAEYDPTLAKIIVHGKDRNDAIM 1021

Query: 1025 KLNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILNSYDYKPSAMEIILPGSHTS 1084
            KLN+AL ET V GCITNIDYLRSI+SS+MF++AKV+T +L+S+DYKP A E++ PG++TS
Sbjct: 1022 KLNQALNETAVYGCITNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLAPGANTS 1081

Query: 1085 IQDYPGRKGCWRIGVPPSGPMDAFSFRLANKIVGNNHKAPAFEITLNGPTILFHIDAIIG 1144
            +QDYPGR G WRIGVPPSGPMD++SFRLAN++VGNN K+PA EITLNGP +LFH + +I 
Sbjct: 1082 VQDYPGRTGYWRIGVPPSGPMDSYSFRLANRVVGNNSKSPALEITLNGPKLLFHTETVIA 1141

Query: 1145 ITGGACVCQLNNTQIEQFKPIHVTSGDKLSIGKLLTGCRAYLAIRGGVDVPEYLGSKSTF 1204
            ++GG   C LN+ QI Q +PI V  GD LS+GK+  GCRAYL+IRGG+DVPEYLGS+STF
Sbjct: 1142 VSGGTVSCTLNDAQIAQNEPIEVKRGDILSVGKVTVGCRAYLSIRGGIDVPEYLGSRSTF 1201

Query: 1205 TLGNFGGYSGRCLKMGDTLFIDQNKLNKYVLPGHNYSDQPLSYSLLPDMPTDKQWKIGVL 1264
             +GN GGY+GR LK+GD LF++Q +L+   LP  ++  Q    SLLP + T+K WKIGV 
Sbjct: 1202 AMGNMGGYNGRILKLGDVLFLNQPELSVSSLPAPDFEPQAAPKSLLPTLSTNKDWKIGVT 1261

Query: 1265 CGPHGSPDFFKPEYVDSFFSEKWKVHYNSNRFGVRLSGPKPVWARKDGGEGGLHPSNAHD 1324
            CGPHGS D FK EY++ FF++KWKVHYNSNRFGVRL GPKP WAR DGGE GLHPSNAHD
Sbjct: 1262 CGPHGSIDLFKEEYIEQFFNDKWKVHYNSNRFGVRLIGPKPKWARSDGGEAGLHPSNAHD 1321

Query: 1325 YVYSLGAINFTGDEPVIVTCDGPSLGGFVCHAVVAESELWKVGQVKPGDYIQFVPISFES 1384
            YVYSLGAINFTGDEPVI+TCDGPSLGGFVC AVVAE+ELWKVGQ+ PGD IQFVP+S+  
Sbjct: 1322 YVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVAEAELWKVGQLTPGDTIQFVPLSYGV 1381

Query: 1385 ARELMKSQDVAINTLEPKSLKTLDDIITLPTPEDPVLRLLPERPGISPRITYRQAGDRYI 1444
            AR+L +SQD +I+  E  SL  L D   LP  E+P+L +LP++  +SP++TYRQAGDRYI
Sbjct: 1382 ARQLKESQDKSIDNFEEGSLLELSDDKILPKYENPILAVLPKKSDLSPKVTYRQAGDRYI 1441

Query: 1445 LVEYGENIMDLNICYRIHSLIGLVDDYNTAGIVEMSQGVRSVLIEFDPYVISQTQXXXXX 1504
            LVEYGE   DLNICYRI+ LI  V+ + T GIVEMSQGVRSVLIEFD   I+Q       
Sbjct: 1442 LVEYGELEFDLNICYRINRLIHQVERHQTVGIVEMSQGVRSVLIEFDGSKINQKALLKCL 1501

Query: 1505 XXXXXXXXXXXNWTVNSKVIRLPMAFEDSKTMACVARYQETIRSSAPWLPNNADFVANIN 1564
                       NW V SK+ +LPMAFEDSKT+ CV RY+ETIRS APWLPNN DF+A++N
Sbjct: 1502 IAYESEIQFDKNWNVKSKIFKLPMAFEDSKTLDCVTRYRETIRSEAPWLPNNVDFIADVN 1561

Query: 1565 GITHKDVYDLVYSARFMVLGLGDVFLGSPCAVPLDPRHRLLGSKYNPSRTFTERGAVGLG 1624
             I   DV +++YSA+FMVLGLGDVFLGSPCAVPLDPRHR LG+KYNPSRT+T RG VG+G
Sbjct: 1562 DIDRNDVKNMLYSAKFMVLGLGDVFLGSPCAVPLDPRHRYLGTKYNPSRTYTARGVVGIG 1621

Query: 1625 GMFMCIY-AASSPGGYQLMGRTIPIWDKLLLLSSS-EQPWLLNPFDQIEFYPVSEKELDR 1682
            GM+MCIY A  SPGGYQL+GRTI  WDKL++     + PWLL PFDQ+EFYPV+E+EL+ 
Sbjct: 1622 GMYMCIYNAEGSPGGYQLVGRTITAWDKLVIGDHPIDHPWLLTPFDQVEFYPVTEEELEV 1681

Query: 1683 LTDDFDYGKYIVDSRKEKFNHMDYLKWVDENSKSITEFQLLQEGENAEKFAKLIELSNAE 1742
            + +D D GK+ +D  +  F+H +YL W++EN  SI  FQ  Q GE A++FA+LI+++NAE
Sbjct: 1682 IIEDNDNGKFKIDVEESIFDHKEYLAWINENIDSIVAFQEAQGGEKADEFARLIQVANAE 1741

Query: 1743 LDENDEIEKDQVNDYPENSVMIYSEYSGRFWKPLVTEGEFVKSGQGLIIIEAMKTEMLVP 1802
            L ++ + +   V +YP+++ ++YSEY+GRFWKP+   G+ V++G G+IIIEAMKTEM+V 
Sbjct: 1742 LKKSGDDKPQDVEEYPDDAELLYSEYTGRFWKPVAAVGDHVEAGDGVIIIEAMKTEMVVG 1801

Query: 1803 TLHDGKVLKIVHKNGSMVDSGDLVVVI 1829
                GKV KI+HKNG MV++GDLV VI
Sbjct: 1802 ATKSGKVYKILHKNGDMVEAGDLVAVI 1828

>CAGL0M05533g complement(588667..594171) similar to sp|P32528
            Saccharomyces cerevisiae YBR208c DUR1 urea amidolyase,
            hypothetical start
          Length = 1834

 Score = 2450 bits (6349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1163/1835 (63%), Positives = 1443/1835 (78%), Gaps = 8/1835 (0%)

Query: 1    MTNNIAKKTLGWSIKDWIEFHQSVTADESFKQLQYLVECQQIAPTDPAWLSLCSADTLKK 60
            MT      ++GWSI+DWI+FH   T  +S++ L  LV+ Q+IAP DPAW+S+ +   L++
Sbjct: 1    MTATNICPSIGWSIQDWIDFHFKSTPKDSYESLLELVKNQRIAPEDPAWISVATESLLEQ 60

Query: 61   QWQILQHRSGKESLPLYGVPVAIKDNIDARGFPTTAACPSFLYEPEKDSKVVKLLRNAGA 120
            QWQ+LQ R  KE LPLYGVP+A+KDNIDA+GFPTTAACPSF Y P +DS VV+LL+ AGA
Sbjct: 61   QWQLLQSRHEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFSYMPTRDSTVVELLKQAGA 120

Query: 121  IIIGKTNLDQFATGLVGTRSPYGKTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTA 180
            IIIGKTNLDQFATGLVGTRSPYG+TPCVFSDKH              RGIVPIALGTDTA
Sbjct: 121  IIIGKTNLDQFATGLVGTRSPYGRTPCVFSDKHVSGGSSAGSASVVARGIVPIALGTDTA 180

Query: 181  GSGRVPAALNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESDLE 240
            GSGRVPAALNN+IGLKPT+G FSC GVVPACKSLDCVSVFS+NLSDAE C KI+ + D+E
Sbjct: 181  GSGRVPAALNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIE 240

Query: 241  NDEYSRTYPRSPLRKFSDSVTIGIPKDLLWYGEEENPVLYDNAIKQLEKSGANITKIDFE 300
            NDEYSR++P +PL+ F+ ++T+ IPK+++WYGE+ENP+LYD AI   ++ GA I  IDFE
Sbjct: 241  NDEYSRSFPANPLQSFNKNLTVAIPKNVMWYGEKENPLLYDRAIDNFKQLGAQIKIIDFE 300

Query: 301  PLLELARCLYEGPWVAERYSAVKDFLQKNPSSKGFDHVVKSIIDSAKKFSAVDAFQFEYK 360
            PLLELARCLYEG WVAERY+A + FL+ +P     D VV  II SA KF A DAF++EYK
Sbjct: 301  PLLELARCLYEGTWVAERYAATRKFLETSPQQSTLDPVVYGIIKSATKFDAADAFEYEYK 360

Query: 361  RQGLLQKIDKLLENIDALCVPTCPLNPTFEDVSNEPILVNSRQGTWTNFVNLADMAALAI 420
            RQG+L+K++ LL++ID LCVPTCPLNP+FE+V  EPILVNSRQGTWTNFVNLAD++ALAI
Sbjct: 361  RQGILRKVEVLLQDIDVLCVPTCPLNPSFEEVDKEPILVNSRQGTWTNFVNLADLSALAI 420

Query: 421  PSGFRSDGLPTGITLIGKKFTDFALLDLAQMYFQIAYPNNSRTFGIFTEG-VEINDDKVS 479
            P GFRSDGLP G+TLI KKF D+ALL LA+ +    YP+ +R +G+F +  V + DD + 
Sbjct: 421  PVGFRSDGLPNGVTLIAKKFEDYALLQLAKRFLAQLYPSGTRPYGMFLDRYVGLKDDSLE 480

Query: 480  GPVISSSDSIKLAVVGAHLKGLPLHWQLEKVNATFISSTKTSKNYELYALPRTGPILKPG 539
            GP++SS DSI LAVVGAHL+GLPLHWQLEKVNATFI STKT+K YELYALP+ GP+LKPG
Sbjct: 481  GPIVSSDDSIVLAVVGAHLRGLPLHWQLEKVNATFICSTKTAKKYELYALPKNGPVLKPG 540

Query: 540  LRRVNE-EGFAIQVETYSIPVENFGTFISMVPEPLGIGSVELENGEWVKSFICEESGYTA 598
            LRR+    G  I++E YS+P E FG FIS VPEPLGIGSVELENG+WVKSFICEESGY +
Sbjct: 541  LRRITSGTGSQIELELYSVPKEKFGEFISFVPEPLGIGSVELENGKWVKSFICEESGYNS 600

Query: 599  KGSVNITKYGGFKTYLK-FLETNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIF 657
             GS++I+ YGGF+ Y++  + +N   K  F TVLVANRGEIAVRIIKTLK M+I+S+AI+
Sbjct: 601  TGSIDISHYGGFRAYIESIIPSNESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIY 660

Query: 658  STPDRYSQHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFS 717
            S  D+YSQHV+D D+   L G +  +TYL++EKII  AKK    AIIPGYGFLSENA F+
Sbjct: 661  SATDKYSQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFA 720

Query: 718  ERCDAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGSSLITTAHEAKEIAAKLEY 777
            +RC+ EGI F+GP G+ +R LGLKHSARE+AK A VPLVPGS L+  A EA  IA  + Y
Sbjct: 721  DRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSPLVKNADEAFTIAKNIGY 780

Query: 778  PIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQI 837
            P+MVKSTAGGGGIGLQKV++E D+ + FETVKHQG++YFGDSGVFME+FI+NARHVEVQI
Sbjct: 781  PVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQI 840

Query: 838  MGDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGT 897
            MGDG G  LA+GERDCSLQRRNQK+IEETPAPNLP  TRQK+  AA+RLG+ L Y+ AGT
Sbjct: 841  MGDGKGKTLALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGT 900

Query: 898  VEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPDFNQLKIDVNG 957
            VEFIYDE RD+FYFLEVNTRLQVEHPITEMVTG+DLVEWM+ I+A + P  ++  I  NG
Sbjct: 901  VEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQNG 960

Query: 958  VAMEARLYAENPVHDFKPSPGQLVEVEFPKWARIDTWVSKGTIVTPEYDPTLAKIIVHGK 1017
             ++E R+YAENP+ DF+PSPG+LV+V+FP   R+DTWV KGT ++PE+DPTLAKIIVHGK
Sbjct: 961  ASIEVRVYAENPLKDFRPSPGELVDVQFPNDCRVDTWVKKGTKISPEFDPTLAKIIVHGK 1020

Query: 1018 DRHDALEKLNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILNSYDYKPSAMEII 1077
            DR++A+ K+ KAL ETK+ GC+TN+DYL+S+ SSEMFR+A++STN LN+Y+Y PSA+EII
Sbjct: 1021 DRNEAILKMKKALNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTYEYSPSAVEII 1080

Query: 1078 LPGSHTSIQDYPGRKGCWRIGVPPSGPMDAFSFRLANKIVGNNHKAPAFEITLNGPTILF 1137
             PG+ T+IQDYPGR   WRIGVPP GPMD +SFRLAN+IVGN+ + P  EITL GPTI F
Sbjct: 1081 EPGALTTIQDYPGRVNYWRIGVPPCGPMDNYSFRLANRIVGNDERTPGIEITLTGPTIKF 1140

Query: 1138 HIDAIIGITGGACVCQLNNTQIEQFKPIHVTSGDKLSIGKLLTGCRAYLAIRGGVDVPEY 1197
            + D+++ I GG   C+L+  +I  F+PI V +G  LSIGK++ G RAYLAIRGG+DVP+Y
Sbjct: 1141 YSDSLVSIAGGEVCCKLDEKKIPMFEPISVKTGSVLSIGKIVKGSRAYLAIRGGIDVPKY 1200

Query: 1198 LGSKSTFTLGNFGGYSGRCLKMGDTLFIDQNKLNKYVLPGHNYSDQPLSYSLLPDMPTDK 1257
            +GS STFT+GN GG++GR LK GD L + Q   +++ +P   +S +     + PD+P D 
Sbjct: 1201 MGSFSTFTMGNLGGFNGRALKRGDVLSLPQQFDSEHGIPSPCFSPEKAPIYVRPDIPNDG 1260

Query: 1258 QWKIGVLCGPHGSPDFFKPEYVDSFFSEKWKVHYNSNRFGVRLSGPKPVWARKDGGEGGL 1317
             W IGVL GPHG+PD F+ E +  FF  +WKVHYNSNRFGVRL GPKP W+R DGGEGGL
Sbjct: 1261 VWTIGVLAGPHGAPDIFESEGMMEFFKSEWKVHYNSNRFGVRLIGPKPKWSRTDGGEGGL 1320

Query: 1318 HPSNAHDYVYSLGAINFTGDEPVIVTCDGPSLGGFVCHAVVAESELWKVGQVKPGDYIQF 1377
            HPSN HDYVYSLGAINFTGDEPVI+TCDGPSLGGFVC AVV+E+E+WKVGQ+KPGD I F
Sbjct: 1321 HPSNTHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVSEAEMWKVGQLKPGDTINF 1380

Query: 1378 VPISFESARELMKSQDVAINTLEPKSLKTLDDIITLPTPEDPVLRLLPERPGISPRITYR 1437
             PI ++SAR L ++QDV IN +   +L+ L D   L +PEDP+L     +   SP++ YR
Sbjct: 1381 TPIDWQSARNLKENQDVIINDMSSCALQKLSDQPLLKSPEDPILFQKDGQELQSPKVVYR 1440

Query: 1438 QAGDRYILVEYGENIMDLNICYRIHSLIGLVDDYNTAGIVEMSQGVRSVLIEFDPYVISQ 1497
            QAGDRYIL+EYG++I +LN+CYRI SLI ++   NT GI EMSQGVRSVL+E+D Y ISQ
Sbjct: 1441 QAGDRYILIEYGDDIFELNLCYRIKSLIDIISQRNTKGIKEMSQGVRSVLVEYDGYEISQ 1500

Query: 1498 TQXXXXXXXXXXXXXXXXNWTVNSKVIRLPMAFEDSKTMACVARYQETIRSSAPWLPNNA 1557
             +                NW+V S++ RLPMAFED +T+ACV RYQETIRS APWLPNN 
Sbjct: 1501 KELLKTLIAYEEQLPQEKNWSVKSRIFRLPMAFEDKETLACVKRYQETIRSKAPWLPNNV 1560

Query: 1558 DFVANINGITHKDVYDLVYSARFMVLGLGDVFLGSPCAVPLDPRHRLLGSKYNPSRTFTE 1617
            DFVA +N +TH D+  L+Y+ R+MVLG+GDVFLGSPCA+PLDPR+RLLGSKYNPSRTFT+
Sbjct: 1561 DFVAEVNNLTHDDIRQLIYTTRYMVLGVGDVFLGSPCAIPLDPRNRLLGSKYNPSRTFTK 1620

Query: 1618 RGAVGLGGMFMCIYAASSPGGYQLMGRTIPIWDKLLLLSSSEQPWLLNPFDQIEFYPVSE 1677
            RG VG+GG +MCIYAA SPGGYQL+GRTIPIWD+L+L S  ++PWLL+PFDQIEFYPVSE
Sbjct: 1621 RGVVGIGGSYMCIYAADSPGGYQLVGRTIPIWDRLMLQSKKDEPWLLSPFDQIEFYPVSE 1680

Query: 1678 KELDRLTDDFDYGKYIVDSRKEKFNHMDYLKWVDENSKSITEFQLLQEGENAEKFAKLIE 1737
            +++D  TD++D G Y +D     F+H  YLKWV +N ++I E Q  Q G+N  KFA+ I+
Sbjct: 1681 EQIDEYTDEWDNGNYKIDVDDVVFDHGSYLKWVQDNIEAIEEHQRAQRGDNYSKFAQKIQ 1740

Query: 1738 LSNAELDE--NDEIEKDQVNDYPENSVMIYSEYSGRFWKPLVTEGEFVKSGQGLIIIEAM 1795
             +NA+L +   + IE++ + D  E    I+SEY+GRFWKP+V  G  ++  QG+ +IEAM
Sbjct: 1741 EANADLKQTTTEVIEQNILEDDCE---YIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAM 1797

Query: 1796 KTEMLVPTLHDGKVLKIVHKNGSMVDSGDLVVVIE 1830
            KTEM+V +   GK+ K + KNG MVD+GD V +I+
Sbjct: 1798 KTEMIVSSSVVGKLKKFLFKNGDMVDAGDPVAIIQ 1832

>ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH]
            (796213..801672) [5460 bp, 1819 aa]
          Length = 1819

 Score = 2214 bits (5736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1069/1832 (58%), Positives = 1358/1832 (74%), Gaps = 17/1832 (0%)

Query: 1    MTNNIAKKTLGWSIKDWIEFHQSVTADESFKQLQYLVECQQIAPTDPAWLSLCSADTLKK 60
            MT++    T+GW+ + W EFH+  +AD S  +L  L   ++ A    AW+S+ S + ++ 
Sbjct: 1    MTDH--SSTVGWTSQQWREFHRRASADASLARLLALAHAERDA--GAAWISVASDEHIEH 56

Query: 61   QWQILQHRSGKESLPLYGVPVAIKDNIDARGFPTTAACPSFLYEPEKDSKVVKLLRNAGA 120
            QW++LQ R  ++ LPLYGVPVA+KDNID RG  TTAACPSF Y   +D+  V+LLR+AGA
Sbjct: 57   QWRVLQSRGDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFAYTAAQDATAVRLLRDAGA 116

Query: 121  IIIGKTNLDQFATGLVGTRSPYGKTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTA 180
            +I+GKTN+DQFATGLVGTRSPYG     FS  H              RG VP+ LGTDTA
Sbjct: 117  VILGKTNMDQFATGLVGTRSPYGSVASAFSSAHAAGGSSSGSAVVVARGAVPLTLGTDTA 176

Query: 181  GSGRVPAALNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESDLE 240
            GSGRVPAALNNL+G+KPT+GT SC GVVPAC+SLDCVSVF+ +++DA  C +IL   D  
Sbjct: 177  GSGRVPAALNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPD-G 235

Query: 241  NDEYSRTYPRSPLRKFSDSVTIGIPKDLLWYGEEENPVLYDNAIKQLEKSGANITKIDFE 300
            +D YSR  P    R+ S    +G+P++  W+GE +N  L+  A +++  +GA + K+D +
Sbjct: 236  SDPYSRPSPADAPRRLSTCPVVGVPREPEWFGESQNAKLFATACQRMRATGARVVKVDPQ 295

Query: 301  PLLELARCLYEGPWVAERYSAVKDFLQKNPSSKGFDHVVKSIIDSAKKFSAVDAFQFEYK 360
            PLL+L R LYEGPWVAERY+A++ F    P     D  V  II SA  +SA D F    +
Sbjct: 296  PLLDLGRSLYEGPWVAERYAAMRAFYSGQPPRDTLDPTVTGIITSAGGYSAADVFDHGLR 355

Query: 361  RQGLLQKIDKLLENIDALCVPTCPLNPTFEDVSNEPILVNSRQGTWTNFVNLADMAALAI 420
            RQ L+  I+  L  +DAL VPTCPLNPT   ++ EP+LVN+RQG WTNFVNLAD+AA+AI
Sbjct: 356  RQKLVAAIEAELAGVDALLVPTCPLNPTLAAIAAEPLLVNARQGMWTNFVNLADLAAVAI 415

Query: 421  PSGFRSDGLPTGITLIGKKFTDFALLDLAQMYFQIAYPNNSRTFGIFTEGVEINDDKVSG 480
            P+GFR DGLP G+TL+G+KF+D ALL+L     ++      R  G    G  + +D+V  
Sbjct: 416  PAGFRRDGLPQGVTLVGRKFSDLALLELGSRLLRVE-DAEPRRCGALPAGQALCEDEVVS 474

Query: 481  PVISSSDSIKLAVVGAHLKGLPLHWQLEKVNATFISSTKTSKNYELYALPRTGPILKPGL 540
                   ++ LAVVGAHL+GL LHWQL++V A F+   +T+ +Y LYALP+TGP+LKP L
Sbjct: 475  GSEERDSTVLLAVVGAHLRGLALHWQLDEVQAEFVREARTAPSYRLYALPKTGPVLKPAL 534

Query: 541  RRVNE-EGFAIQVETYSIPVENFGTFISMVPEPLGIGSVELENGEWVKSFICEESGYTAK 599
            RRV   +G AI++E YS+P   FG F++MVP PL IGSVELE+GE++KSF+CEE GY   
Sbjct: 535  RRVCAGKGAAIELEAYSVPEATFGRFVAMVPAPLAIGSVELESGEYIKSFVCEEDGYIQD 594

Query: 600  GSVNITKYGGFKTYLKFLETNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIFST 659
            G+V+IT  GGF+ Y++ L       KPF TVLVANRGEIAVRII+TLK++ I+SVA++S 
Sbjct: 595  GTVDITHLGGFRRYVEHLRRQRDVDKPFDTVLVANRGEIAVRIIRTLKRLGIRSVAVYSD 654

Query: 660  PDRYSQHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSER 719
            PDR+SQHV DAD+ V L G SAA+TYL+I+KI+ AAKKT  QAIIPGYGFLSENA F+ER
Sbjct: 655  PDRHSQHVRDADVAVALGGSSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAER 714

Query: 720  CDAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGSSLITTAHEAKEIAAKLEYPI 779
            C AEGI FVGPSGD +R LGLKH ARE+A  A VPL  G+ L+ +A  A E   ++ YP+
Sbjct: 715  CGAEGIVFVGPSGDSIRKLGLKHWARELAASAGVPLTKGTGLLQSASAALEAGEEIGYPL 774

Query: 780  MVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMG 839
            MVKSTAGGGGIGLQ+V+S  ++   FE V+ QG  YF DSGVF+E FI  ARHVEVQIMG
Sbjct: 775  MVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMG 834

Query: 840  DGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVE 899
            DG G  +A+GERDCSLQRRNQKIIEETPAPNLP  TRQK+R+AAQRL S +KYKCAGTVE
Sbjct: 835  DGHGRTVALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVE 894

Query: 900  FIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPDFNQLKIDVNGVA 959
            F+YDE +DEFYFLEVNTRLQVEHPITEMVTG+DLVEWML IAA+  PDF+   +++ GV+
Sbjct: 895  FMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPDFDA-GVEIEGVS 953

Query: 960  MEARLYAENPVHDFKPSPGQLVEVEFPKWARIDTWVSKGTIVTPEYDPTLAKIIVHGKDR 1019
            MEAR+Y ENPV  F PSPG L EV FP WAR+DTW+ KGT V  EYDPTLAKIIVHGKDR
Sbjct: 954  MEARVYVENPVKGFTPSPGLLTEVVFPSWARVDTWILKGTRVAAEYDPTLAKIIVHGKDR 1013

Query: 1020 HDALEKLNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILNSYDYKPSAMEIILP 1079
             DA+ KL  AL ET+++GC+TN+DYL+SI+SSE FR A V T +LN ++Y P+A E+ +P
Sbjct: 1014 EDAVSKLLLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEVKIP 1073

Query: 1080 GSHTSIQDYPGRKGCWRIGVPPSGPMDAFSFRLANKIVGNNHKAPAFEITLNGPTILFHI 1139
            G++T+IQDYPGR G WRIGVPPSGPMD++SFRLAN++VGN+ KA A EITLNGP + FH 
Sbjct: 1074 GAYTTIQDYPGRVGYWRIGVPPSGPMDSYSFRLANRVVGNDSKAAALEITLNGPELKFHS 1133

Query: 1140 DAIIGITGGACVCQLNNTQIEQFKPIHVTSGDKLSIGKLLTGCRAYLAIRGGVDVPEYLG 1199
            DA+I +TGGA    LN   + Q+ P+ +  GD L IGKL +G RAYLA+RGG+DVPE+LG
Sbjct: 1134 DAVIAVTGGAVPVTLNGKPVLQYVPLTLEKGDVLKIGKLESGSRAYLAVRGGIDVPEFLG 1193

Query: 1200 SKSTFTLGNFGGYSGRCLKMGDTLFIDQNKLNKYVLPGHNYSDQPLSYSLLPDMPTDKQW 1259
            S+STF +G  GG++GR L  GD LFI++   +  V  G   +   +   L P +P +  W
Sbjct: 1194 SRSTFAMGGIGGHNGRVLAPGDVLFINK---DSSVAVGDTVT---IPSGLQPVIPRE-SW 1246

Query: 1260 KIGVLCGPHGSPDFFKPEYVDSFFSEKWKVHYNSNRFGVRLSGPKPVWARKDGGEGGLHP 1319
            KIG++CGPHGSPDFFK E ++ FFS  WKVHYNSNRFG+RL GPKP WAR DGGE GLHP
Sbjct: 1247 KIGLVCGPHGSPDFFKREALEEFFSSPWKVHYNSNRFGIRLIGPKPKWARSDGGEAGLHP 1306

Query: 1320 SNAHDYVYSLGAINFTGDEPVIVTCDGPSLGGFVCHAVVAESELWKVGQVKPGDYIQFVP 1379
            SN HDYVYS+GAINFTGDEPVI+  +GPSLGGFVC AVV E+ELWKVGQ+KPGD I+FVP
Sbjct: 1307 SNTHDYVYSVGAINFTGDEPVIIAAEGPSLGGFVCAAVVPEAELWKVGQLKPGDTIKFVP 1366

Query: 1380 ISFESARELMKSQDVAINTLEPKSLKTLDDIITLPTPEDPVLRLLPERPGISPRITYRQA 1439
            IS ++AR L +SQD A++ L+  S   LDD + LP+ +DPVL  L +R G+ P++T+RQ+
Sbjct: 1367 ISVDTARALKRSQDAAVDALDILSSIKLDDSMVLPSYQDPVLLRLAKRSGLCPKVTFRQS 1426

Query: 1440 GDRYILVEYGENIMDLNICYRIHSLIGLVDDYNTAGIVEMSQGVRSVLIEFDPYVISQTQ 1499
            GDRYIL+EYGEN MD+NI YRI  L  +V      GIVEMSQG+RS+L+E++ Y ISQ  
Sbjct: 1427 GDRYILIEYGENEMDINISYRIKQLQEMVTKNKVTGIVEMSQGIRSLLVEYNGYTISQED 1486

Query: 1500 XXXXXXXXXXXXXXXXNWTVNSKVIRLPMAFEDSKTMACVARYQETIRSSAPWLPNNADF 1559
                            +W V +K+ RLPMAFEDSKT+  V RYQETIRS APWLP+NADF
Sbjct: 1487 LLSVLSAYELEINFDVDWKVKAKLFRLPMAFEDSKTLEAVRRYQETIRSDAPWLPSNADF 1546

Query: 1560 VANINGITHKDVYDLVYSARFMVLGLGDVFLGSPCAVPLDPRHRLLGSKYNPSRTFTERG 1619
            VAN+NGIT  DV DL+YSA FMVLGLGDVFLG+PCAVPLDPR RLLG+KYNPSRT+T  G
Sbjct: 1547 VANVNGITRADVRDLLYSATFMVLGLGDVFLGAPCAVPLDPRQRLLGTKYNPSRTYTPNG 1606

Query: 1620 AVGLGGMFMCIYAASSPGGYQLMGRTIPIWDKLLLLSS-SEQPWLLNPFDQIEFYPVSEK 1678
             VG+GGM+MCIY   SPGGYQLMGRTIPIW++L L  +  + PWLL PFDQ+EFYPVSE+
Sbjct: 1607 VVGIGGMYMCIYCTDSPGGYQLMGRTIPIWNRLQLGEAWKDHPWLLTPFDQVEFYPVSEE 1666

Query: 1679 ELDRLTDDFDYGKYIVDSRKEKFNHMDYLKWVDENSKSITEFQLLQEGENAEKFAKLIEL 1738
             ++ LT++ + G + ++ ++  F++  Y +W+++N +SI  F+  Q GE A +FA+LI++
Sbjct: 1667 RINELTEEVENGTFELEVKETVFDNGAYNRWLEDNRESIQAFKEGQSGERAAEFARLIKV 1726

Query: 1739 SNAELDENDEIEKDQVNDYPENSVMIYSEYSGRFWKPLVTEGEFVKSGQGLIIIEAMKTE 1798
            +N++L+     E + V +YPE++ M+YSEY+GRFWK +V+ G+ VK G  L+IIEAMKTE
Sbjct: 1727 ANSDLETAVRKEAEPV-EYPEDAHMVYSEYAGRFWKQVVSVGDKVKEGDKLVIIEAMKTE 1785

Query: 1799 MLVPTLHDGKVLKIVHKNGSMVDSGDLVVVIE 1830
            M+V    DG+V+ I+H NG MVD+G+LVVV++
Sbjct: 1786 MVVSATADGEVINILHANGDMVDAGNLVVVLK 1817

>CAGL0K06787g complement(659290..662817) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 Pyruvate
            carboxylase 2, start by similarity
          Length = 1175

 Score =  295 bits (754), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 174/438 (39%), Positives = 261/438 (59%), Gaps = 17/438 (3%)

Query: 630  VLVANRGEIAVRIIKTLKKMEIQSVAIFSTPDRYSQHVIDAD--LTVDLKG-VSAADTYL 686
            +LVANRGEI +RI ++  ++ +++VAI+S  DR S H + AD    +  +G  +    YL
Sbjct: 23   ILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYL 82

Query: 687  NIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDAEGITFVGPSGDVMRGLGLKHSARE 746
             I++IID AKK G   I PGYGFLSENA+F+++    GIT++GP  +V+  +G K SAR 
Sbjct: 83   AIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSARN 142

Query: 747  IAKKANVPLVPGS-SLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIF 805
            +A KANVP VPG+   I T  EA++   K  YP+++K+  GGGG G++ V   DD+   F
Sbjct: 143  LAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYGGGGRGMRVVREGDDVADAF 202

Query: 806  ETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGNALAIGERDCSLQRRNQKIIEE 865
            +  K +    FG+   F+ERF++  +H+EVQ++ D  GN + + ERDCS+QRR+QK++E 
Sbjct: 203  QRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 262

Query: 866  TPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPIT 925
             PA  LP   R  +   A RL     Y+ AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 263  APAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 321

Query: 926  EMVTGIDLVEWMLVIAADMA-PDFNQL--KIDVNGVAMEARLYAENPVHDFKPSPGQLVE 982
            E +TGIDLV   + IAA  + P    L  +I   G A++ R+  E+P  +F+P  G+L  
Sbjct: 322  EEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRL-- 379

Query: 983  VEFPKWA-----RIDTWVS-KGTIVTPEYDPTLAKIIVHGKDRHDALEKLNKALVETKVS 1036
             E  + A     R+D   +  G +++P YD  L K    G        K+ +AL+E ++ 
Sbjct: 380  -EVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIR 438

Query: 1037 GCITNIDYLRSISSSEMF 1054
            G  TNI +L ++ +  +F
Sbjct: 439  GVKTNIPFLLTLLTHPVF 456

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 36/54 (66%)

Query: 1777 VTEGEFVKSGQGLIIIEAMKTEMLVPTLHDGKVLKIVHKNGSMVDSGDLVVVIE 1830
            V +G  VK GQ + ++ AMK EM++ +  +G V  ++ K+G  VD+ DL+VV+E
Sbjct: 1116 VHKGSQVKKGQPVAVLSAMKMEMVISSTGEGLVKDVLVKDGENVDASDLLVVLE 1169

>KLLA0C05764g complement(512470..515991) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 pyruvate
            carboxylase 2, start by similarity
          Length = 1173

 Score =  289 bits (739), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 178/478 (37%), Positives = 273/478 (57%), Gaps = 14/478 (2%)

Query: 610  FKTYLKFLETNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIFSTPDRYSQHVID 669
              + L  L  N+        +LVANRGEI +RI +T  ++ +++VAI+S  DR S H + 
Sbjct: 1    MSSQLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLK 60

Query: 670  AD--LTVDLKG-VSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDAEGIT 726
            AD    +  +G  +    YL I++II+ AK  G   I PGYGFLSEN++F+E+  A GIT
Sbjct: 61   ADEAYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGIT 120

Query: 727  FVGPSGDVMRGLGLKHSAREIAKKANVPLVPGS-SLITTAHEAKEIAAKLEYPIMVKSTA 785
            +VGP   V+  +G K SAR +A+KANVP+VPG+   I T  EA+    K  +P+++K+  
Sbjct: 121  WVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAF 180

Query: 786  GGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGNA 845
            GGGG G++ V   DDI   F+  K +    FG+   F+ERF++  +H+EVQ++ D  GN 
Sbjct: 181  GGGGRGMRVVREGDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNV 240

Query: 846  LAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEI 905
            + + ERDCS+QRR+QK++E  PA  LPE  R  +   A +L     Y+ AGT EF+ D  
Sbjct: 241  VHLFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDN- 299

Query: 906  RDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPD---FNQLKIDVNGVAMEA 962
            ++  YF+E+N R+QVEH ITE +TGID+V   + IAA    +     Q KI   G A++ 
Sbjct: 300  QNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGATLEQLGLMQDKITTRGFAIQC 359

Query: 963  RLYAENPVHDFKPSPGQL--VEVEFPKWARIDTWVS-KGTIVTPEYDPTLAKIIVHGKDR 1019
            R+  E+P  +F+P  G++           R+D   +  G++++P YD  L K    G   
Sbjct: 360  RITTEDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTY 419

Query: 1020 HDALEKLNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILNSYDYKPSAMEII 1077
                 K+ +AL+E ++ G  TNI +L ++ +  +F+  +  T  +   D  P   E++
Sbjct: 420  EIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFI---DDTPQLFEMV 474

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 42/67 (62%)

Query: 1764 IYSEYSGRFWKPLVTEGEFVKSGQGLIIIEAMKTEMLVPTLHDGKVLKIVHKNGSMVDSG 1823
            I S  +G   +  V +G  +  GQ + ++ AMK EM++ +  DG+V +++ K+G  VD+ 
Sbjct: 1101 IGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISSPADGQVKEVLVKDGENVDAS 1160

Query: 1824 DLVVVIE 1830
            DL+VV+E
Sbjct: 1161 DLLVVLE 1167

>Kwal_14.1803
          Length = 1174

 Score =  288 bits (736), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 172/451 (38%), Positives = 271/451 (60%), Gaps = 21/451 (4%)

Query: 630  VLVANRGEIAVRIIKTLKKMEIQSVAIFSTPDRYSQHVIDAD--LTVDLKG-VSAADTYL 686
            +LVANRGEI +RI ++  ++ +++VAI+S  DR S H + AD    +  +G  +    YL
Sbjct: 20   ILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADEAYMIGKQGKYTPVGAYL 79

Query: 687  NIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDAEGITFVGPSGDVMRGLGLKHSARE 746
             I++I++ AK+     I PGYGFLSEN++F+ + +  GIT++GPS +V+  +G K SAR 
Sbjct: 80   AIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSARN 139

Query: 747  IAKKANVPLVPGS-SLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIF 805
            +A KANVP+VPG+   I +  EA+   A+  YP+++K+  GGGG G++ V   DDI   F
Sbjct: 140  LAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIADAF 199

Query: 806  ETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGNALAIGERDCSLQRRNQKIIEE 865
            +    +    FG+   F+ERF+   +H+EVQ++ DG GN + + ERDCS+QRR+QK++E 
Sbjct: 200  QRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVVEV 259

Query: 866  TPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPIT 925
             PA  LP+  R  +   A +L S+  YK AGT EF+ D+ ++  YF+E+N R+QVEH IT
Sbjct: 260  APAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDD-QNRHYFIEINPRIQVEHTIT 318

Query: 926  EMVTGIDLVEWMLVIAADMAPDFNQL-----KIDVNGVAMEARLYAENPVHDFKPSPGQL 980
            E +TGID+V   + IAA  +    QL     +I   G A++ R+  E+P  +F+P  G+ 
Sbjct: 319  EEITGIDIVAAQIQIAAGAS--LQQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGR- 375

Query: 981  VEVEFPKWA-----RIDTWVS-KGTIVTPEYDPTLAKIIVHGKDRHDALEKLNKALVETK 1034
              +E  + A     R+D   +  G+I++P YD  L K    G        K+ +AL+E +
Sbjct: 376  --IEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFR 433

Query: 1035 VSGCITNIDYLRSISSSEMFRDAKVSTNILN 1065
            + G  TNI +L ++ ++ +F D    T  ++
Sbjct: 434  IRGVKTNIPFLLTLLTNPVFIDGTYWTTFID 464

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 52/98 (53%), Gaps = 7/98 (7%)

Query: 1740 NAELDENDEIEKDQVNDY-------PENSVMIYSEYSGRFWKPLVTEGEFVKSGQGLIII 1792
            N EL +   ++K Q  D          +S  I +  +G   +  V  G  VK GQ + ++
Sbjct: 1070 NGELRKVAVVDKSQKVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVL 1129

Query: 1793 EAMKTEMLVPTLHDGKVLKIVHKNGSMVDSGDLVVVIE 1830
             AMK EM++ +  DG+V +++ K+G  VD+ DL+V +E
Sbjct: 1130 SAMKMEMVISSPIDGQVKEVLVKDGENVDASDLLVYLE 1167

>Scas_686.17
          Length = 1176

 Score =  278 bits (710), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 167/438 (38%), Positives = 262/438 (59%), Gaps = 17/438 (3%)

Query: 630  VLVANRGEIAVRIIKTLKKMEIQSVAIFSTPDRYSQHVIDAD--LTVDLKG-VSAADTYL 686
            +LVANRGEI +RI ++  ++ +++VAI+S  DR S H + AD    +  +G  +    YL
Sbjct: 22   ILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADESYVIGEEGQFTPVGAYL 81

Query: 687  NIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDAEGITFVGPSGDVMRGLGLKHSARE 746
             I++II+ AKK     I PGYGFLSEN++F+++    GIT++GP  +V+  +G K SAR 
Sbjct: 82   AIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIGPPAEVIDSVGDKVSARY 141

Query: 747  IAKKANVPLVPGS-SLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIF 805
            +A +A+VP VPG+   I +  EA++  A+  YP+++K+  GGGG G++ V   +DI   F
Sbjct: 142  LAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFGGGGRGMRVVREGEDINDAF 201

Query: 806  ETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGNALAIGERDCSLQRRNQKIIEE 865
            +    +    FGD   F+ERF+++ +H+EVQ++GD  GN + + ERDCS+QRR+QK++E 
Sbjct: 202  QRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQKVVEV 261

Query: 866  TPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPIT 925
             PA N+P   R  +   A +L     Y+ AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 262  APAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 320

Query: 926  EMVTGIDLVEWMLVIAADMA---PDFNQLKIDVNGVAMEARLYAENPVHDFKPSPGQLVE 982
            E +TGIDLV   + IAA  +       Q +I   G A++ R+  E+P  +F+P  G+L  
Sbjct: 321  EEITGIDLVAAQIQIAAGASLAQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRL-- 378

Query: 983  VEFPKWA-----RIDTWVS-KGTIVTPEYDPTLAKIIVHGKDRHDALEKLNKALVETKVS 1036
             E  + A     R+D   +  G +++P YD  L K    G        K+ +AL+E ++ 
Sbjct: 379  -EVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIR 437

Query: 1037 GCITNIDYLRSISSSEMF 1054
            G  TNI +L ++ +  +F
Sbjct: 438  GVKTNIPFLLTLLTHPVF 455

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 39/58 (67%)

Query: 1777 VTEGEFVKSGQGLIIIEAMKTEMLVPTLHDGKVLKIVHKNGSMVDSGDLVVVIEPIFA 1834
            V +G  VK G+ + ++ AMK EM++ +  DG+V +++  NG+ VD+ DL+VV+E   A
Sbjct: 1115 VHKGSLVKKGEAVAVLSAMKMEMVISSPADGQVKEVLVSNGNAVDASDLLVVLEDAVA 1172

>YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase 1,
            catalyzes conversion of pyruvate to oxaloacetate in the
            gluconeogenesis pathway [3537 bp, 1178 aa]
          Length = 1178

 Score =  278 bits (710), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 174/473 (36%), Positives = 268/473 (56%), Gaps = 24/473 (5%)

Query: 606  KYGGFKTYLKFLETNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIFSTPDRYSQ 665
            K+ G +     L    K       +LVANRGEI +RI +T  ++ +Q+VAI+S  DR S 
Sbjct: 5    KFAGLRDNFNLLGEKNK-------ILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLST 57

Query: 666  HVIDAD---LTVDLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDA 722
            H   AD   +  ++   +    YL I++II  A+K     I PGYGFLSEN++F+++   
Sbjct: 58   HKQKADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVK 117

Query: 723  EGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGS-SLITTAHEAKEIAAKLEYPIMV 781
             GIT++GP  +V+  +G K SAR +A KANVP VPG+   I T  EA +   +  YP+++
Sbjct: 118  AGITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVII 177

Query: 782  KSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDG 841
            K+  GGGG G++ V   DD+   F+    +    FG+   F+ERF++  +H+EVQ++ D 
Sbjct: 178  KAAFGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADN 237

Query: 842  LGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFI 901
             GN + + ERDCS+QRR+QK++E  PA  LP   R  +   A +L     Y+ AGT EF+
Sbjct: 238  HGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFL 297

Query: 902  YDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMA-PDFN--QLKIDVNGV 958
             D  ++  YF+E+N R+QVEH ITE +TGID+V   + IAA  + P     Q KI   G 
Sbjct: 298  VDN-QNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRGF 356

Query: 959  AMEARLYAENPVHDFKPSPGQLVEVEFPKWA-----RIDTWVS-KGTIVTPEYDPTLAKI 1012
            A++ R+  E+P  +F+P  G+   +E  + A     R+D   +  GTI++P YD  L K 
Sbjct: 357  AIQCRITTEDPAKNFQPDTGR---IEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKC 413

Query: 1013 IVHGKDRHDALEKLNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILN 1065
               G        K+ +AL+E ++ G  TNI +L ++ ++ +F +    T  ++
Sbjct: 414  SCSGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFID 466

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 36/54 (66%)

Query: 1777 VTEGEFVKSGQGLIIIEAMKTEMLVPTLHDGKVLKIVHKNGSMVDSGDLVVVIE 1830
            V +G  +K GQ + ++ AMK EM++ +  DG+V ++   +G  VDS DL+V++E
Sbjct: 1116 VHKGSLIKKGQPVAVLSAMKMEMIISSPSDGQVKEVFVSDGENVDSSDLLVLLE 1169

>YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate
            carboxylase 2 [3543 bp, 1180 aa]
          Length = 1180

 Score =  277 bits (708), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 165/451 (36%), Positives = 262/451 (58%), Gaps = 21/451 (4%)

Query: 630  VLVANRGEIAVRIIKTLKKMEIQSVAIFSTPDRYSQHVIDAD--LTVDLKG-VSAADTYL 686
            +LVANRGEI +RI ++  ++ ++++AI+S  DR S H + AD    +  +G  +    YL
Sbjct: 23   ILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKADEAYVIGEEGQYTPVGAYL 82

Query: 687  NIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDAEGITFVGPSGDVMRGLGLKHSARE 746
             +++II+ AKK     I PGYGFLSEN++F+++    GIT++GP  +V+  +G K SAR 
Sbjct: 83   AMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARH 142

Query: 747  IAKKANVPLVPGS-SLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIF 805
            +A +ANVP VPG+   I T  EA +   +  YP+++K+  GGGG G++ V   DD+   F
Sbjct: 143  LAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFGGGGRGMRVVREGDDVADAF 202

Query: 806  ETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGNALAIGERDCSLQRRNQKIIEE 865
            +    +    FG+   F+ERF++  +H+EVQ++ D  GN + + ERDCS+QRR+QK++E 
Sbjct: 203  QRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 262

Query: 866  TPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPIT 925
             PA  LP   R  +   A +L  +  Y+ AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 263  APAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 321

Query: 926  EMVTGIDLVEWMLVIAADMAPDFNQL-----KIDVNGVAMEARLYAENPVHDFKPSPGQL 980
            E +TGID+V   + IAA       QL     KI   G +++ R+  E+P  +F+P  G+L
Sbjct: 322  EEITGIDIVSAQIQIAA--GATLTQLGLLQDKITTRGFSIQCRITTEDPSKNFQPDTGRL 379

Query: 981  VEVEFPKWA-----RIDTWVS-KGTIVTPEYDPTLAKIIVHGKDRHDALEKLNKALVETK 1034
               E  + A     R+D   +  G  ++P YD  L K    G        K+ +AL+E +
Sbjct: 380  ---EVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFR 436

Query: 1035 VSGCITNIDYLRSISSSEMFRDAKVSTNILN 1065
            + G  TNI +L ++ ++ +F +    T  ++
Sbjct: 437  IRGVKTNIPFLLTLLTNPVFIEGTYWTTFID 467

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 51/98 (52%), Gaps = 13/98 (13%)

Query: 1746 NDEIEKDQVNDYPEN-------------SVMIYSEYSGRFWKPLVTEGEFVKSGQGLIII 1792
            N E+ K +V D  +N             +  I +  +G   +  V +G  VK G+ + ++
Sbjct: 1073 NGELRKIRVADKSQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVL 1132

Query: 1793 EAMKTEMLVPTLHDGKVLKIVHKNGSMVDSGDLVVVIE 1830
             AMK EM+V +  DG+V  +  K+G  VD+ DL+VV+E
Sbjct: 1133 SAMKMEMVVSSPADGQVKDVFIKDGESVDASDLLVVLE 1170

>CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharomyces
            cerevisiae YGL062w PYC1 pyruvate carboxylase or sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2, hypothetical start
          Length = 1180

 Score =  277 bits (708), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 174/468 (37%), Positives = 266/468 (56%), Gaps = 13/468 (2%)

Query: 609  GFKTYLKFLETNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIFSTPDRYSQHVI 668
            G K  L  L  N         +LVANRGEI +RI +T  ++ +++VAI+S  DR S H +
Sbjct: 5    GQKKKLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRL 64

Query: 669  DAD--LTVDLKG-VSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDAEGI 725
             AD    +  +G  +    YL I++IID AKK G   I PGYGFLSEN++F+++    GI
Sbjct: 65   KADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGI 124

Query: 726  TFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGS-SLITTAHEAKEIAAKLEYPIMVKST 784
            T++GP  +V+  +G K SAR +A KA VP VPG+   I T  EA+   A+  YP+++K+ 
Sbjct: 125  TWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAA 184

Query: 785  AGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGN 844
             GGGG G++ V   +DI   F+    +    FG+   F+ERF++  +H+EVQ++ D  GN
Sbjct: 185  YGGGGRGMRVVREGEDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGN 244

Query: 845  ALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDE 904
             + + ERDCS+QRR+QK++E  PA  LP   R  +   A +L     Y+ AGT EF+ D 
Sbjct: 245  VIHLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDN 304

Query: 905  IRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPD---FNQLKIDVNGVAME 961
             ++  YF+E+N R+QVEH ITE +TGID+V   + IAA  +       Q +I   G A++
Sbjct: 305  -QNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLTELGLLQDRITTRGFAIQ 363

Query: 962  ARLYAENPVHDFKPSPGQLVEV---EFPKWARIDTWVS-KGTIVTPEYDPTLAKIIVHGK 1017
             R+  E+P  +F+P  G+ +EV         R+D   +  G +++P YD  L K    G 
Sbjct: 364  CRITTEDPAKNFQPDTGR-IEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGS 422

Query: 1018 DRHDALEKLNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILN 1065
                   K+ +AL+E ++ G  TNI +L ++ +  +F   +  T  ++
Sbjct: 423  TYEIVRRKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFID 470

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 35/54 (64%)

Query: 1777 VTEGEFVKSGQGLIIIEAMKTEMLVPTLHDGKVLKIVHKNGSMVDSGDLVVVIE 1830
            V +G  VK GQ + I+ AMK EM+V +  DG+V  +  K+   V++ DL+V++E
Sbjct: 1120 VHKGSLVKKGQPVAILSAMKMEMVVSSQADGQVKDVFVKDAENVEASDLLVLLE 1173

>AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (PYC2)
            - SH] (634067..637582) [3516 bp, 1171 aa]
          Length = 1171

 Score =  270 bits (689), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 165/460 (35%), Positives = 261/460 (56%), Gaps = 18/460 (3%)

Query: 605  TKYGGFKTYLKFLETNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIFSTPDRYS 664
            ++  GF+ +   L    K       VLVANRGEI +RI +T  ++ + +VA++S  DR S
Sbjct: 3    SQLAGFRRHSNLLGEKNK-------VLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLS 55

Query: 665  QHVIDAD--LTVDLKG-VSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCD 721
             H   AD    +  +G  +    YL I++I+  A+      I PGYGFLSENA+F+ + +
Sbjct: 56   MHRQKADEAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVE 115

Query: 722  AEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGSS-LITTAHEAKEIAAKLEYPIM 780
              GIT++GP   V+  +G K SAR +A  A+VP VPG+   I++  EA+E   K  YP++
Sbjct: 116  GAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVI 175

Query: 781  VKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGD 840
            +K+  GGGG G++ V   DDI   F+  + +    FG+   F+ERF++  +H+EVQ++ D
Sbjct: 176  IKAAFGGGGRGMRVVREGDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLAD 235

Query: 841  GLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEF 900
              GN + + ERDCS+QRR+QK++E  PA  L +  R  +   A +L     Y+ AGT EF
Sbjct: 236  NYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEF 295

Query: 901  IYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPD---FNQLKIDVNG 957
            + D+ ++  YF+E+N R+QVEH ITE +TG+D+V   + IAA  + +     Q +I   G
Sbjct: 296  LVDK-QNRHYFIEINPRIQVEHTITEEITGVDIVAAQIQIAAGASLEQLGLMQDRITTRG 354

Query: 958  VAMEARLYAENPVHDFKPSPGQL--VEVEFPKWARIDTWVS-KGTIVTPEYDPTLAKIIV 1014
             A++ R+  E+P  +F+P  G+L           R+D   +  G +++P YD  L K   
Sbjct: 355  FAIQCRITTEDPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSC 414

Query: 1015 HGKDRHDALEKLNKALVETKVSGCITNIDYLRSISSSEMF 1054
             G        K+ +AL+E ++ G  TNI +L ++ +  +F
Sbjct: 415  SGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVF 454

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 59/122 (48%), Gaps = 16/122 (13%)

Query: 1712 ENSKSITEFQL---LQEGENAEKFAKLIELSNAELDENDEIEKDQVNDYPENSVMIYSEY 1768
            E  K    F+L   L++   A+K  KL  +S  + D +D+ +             + +  
Sbjct: 1059 ETGKREVYFELNGELRKVSVADKSQKLETVSKLKADAHDQFQ-------------VGAPM 1105

Query: 1769 SGRFWKPLVTEGEFVKSGQGLIIIEAMKTEMLVPTLHDGKVLKIVHKNGSMVDSGDLVVV 1828
            +G   +  V +G  V  GQ + ++ AMK EM++ +  DG+V  +   +G  V++ DL+V 
Sbjct: 1106 AGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISSPSDGQVKDVFVSDGETVEASDLLVQ 1165

Query: 1829 IE 1830
            +E
Sbjct: 1166 LE 1167

>Scas_563.12
          Length = 1216

 Score =  264 bits (675), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 156/421 (37%), Positives = 244/421 (57%), Gaps = 11/421 (2%)

Query: 644  KTLKKMEIQSVAIFSTPDRYSQHVIDADLTVDL---KGVSAADTYLNIEKIIDAAKKTGA 700
            ++  ++ +Q+VAI+S  DR S H + AD +  +      +    YL I++II+ AK+ G 
Sbjct: 77   RSAHELSMQTVAIYSHEDRLSTHRLKADESYVIGEPHQFTPVGAYLAIDEIINIAKRHGV 136

Query: 701  QAIIPGYGFLSENADFSERCDAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGS- 759
              I PGYGFLSEN++F+++    GIT++GP   V+  +G K SAR +A KANVP VPG+ 
Sbjct: 137  DYIHPGYGFLSENSEFADKVAKAGITWIGPPASVIDSVGDKVSARNLATKANVPTVPGTP 196

Query: 760  SLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDS 819
              I T  +A++   +  YP+++K+  GGGG G++ V   DD+   F+    +    FGD 
Sbjct: 197  GPIRTVQDAQDFVNEYGYPVIIKAAFGGGGRGMRVVNEGDDLADAFQRASSEALTAFGDG 256

Query: 820  GVFMERFIENARHVEVQIMGDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKL 879
              F+ERF+   +H+EVQ++ D  GN + + ERDCS+QRR+QK++E  PA  LP   R  +
Sbjct: 257  TCFVERFLNKPKHIEVQLLADTHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAI 316

Query: 880  REAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLV 939
               A +L     Y+ AGT EF+ D+ ++  YF+E+N R+QVEH ITE +TGID+V   + 
Sbjct: 317  LTDAVKLAKECGYQNAGTAEFLVDD-QNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQ 375

Query: 940  IAADMAPD---FNQLKIDVNGVAMEARLYAENPVHDFKPSPGQL--VEVEFPKWARIDTW 994
            IAA  + +     Q KI   G A++ R+  E+P  +F+P  G+L   +       R+D  
Sbjct: 376  IAAGASLEQLGLLQDKITTRGFAIQCRITTEDPAKNFQPDTGRLEVYDSAGGNGVRLDGG 435

Query: 995  VS-KGTIVTPEYDPTLAKIIVHGKDRHDALEKLNKALVETKVSGCITNIDYLRSISSSEM 1053
             +  G I++P YD  L K    G        K+ +AL+E ++ G  TNI +L ++ +  +
Sbjct: 436  NAYAGAIISPHYDSMLVKCSCSGSTYEVVRRKMIRALIEFRIRGVKTNIPFLLTLLTHPV 495

Query: 1054 F 1054
            F
Sbjct: 496  F 496

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 34/54 (62%)

Query: 1777 VTEGEFVKSGQGLIIIEAMKTEMLVPTLHDGKVLKIVHKNGSMVDSGDLVVVIE 1830
            V +G  VK G+ + ++ AMK EM++ +  DG V +++      VD+ DL+V++E
Sbjct: 1157 VHKGSLVKKGEAVAVLSAMKMEMVISSPADGLVKEVLVNESENVDASDLLVLLE 1210

>Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement
          Length = 1132

 Score =  258 bits (659), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 162/442 (36%), Positives = 253/442 (57%), Gaps = 24/442 (5%)

Query: 651  IQSVAIFSTPDRYSQHVIDAD---LTVDLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGY 707
            +++VAI+S  DR S H + AD   +  +    +    YL I++II  AK+ G   I PGY
Sbjct: 1    MKTVAIYSNEDRLSMHRLKADEAYMIGEGGKYTPVGAYLAIDEIISIAKEHGVSFIHPGY 60

Query: 708  GFLSENADFSERCDAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGS-SLITTAH 766
            GFLSENA+F+ +    GIT++GP  +V+  +G K SAR++A KANVP VPG+   I +  
Sbjct: 61   GFLSENAEFAAKVIDAGITWIGPPPEVINSVGDKVSARDLAAKANVPTVPGTPGPIESVE 120

Query: 767  EAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERF 826
            EA+   A+  YP+++K+  GGGG G++ V   DDI   F+    +    FG+   F+ERF
Sbjct: 121  EAEAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIGDAFQRATSEAKTAFGNGTCFVERF 180

Query: 827  IENARHVEVQIMGDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRL 886
            ++  +H+EVQ++ D  GN + + ERDCS+QRR+QK++E  PA  LP+  R  +   A +L
Sbjct: 181  LDKPKHIEVQLLADNYGNVIHLFERDCSVQRRHQKVVEVAPAKTLPKEVRDSILTDAVKL 240

Query: 887  GSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAP 946
                KY+ AGT EF+ D  ++  YF+E+N R+QVEH ITE +TG+D+V   + IAA  + 
Sbjct: 241  AKEAKYRNAGTAEFLVDA-QNRHYFIEINPRIQVEHTITEEITGVDVVAAQIQIAAGAS- 298

Query: 947  DFNQL-----KIDVNGVAMEARLYAENPVHDFKPSPGQLVEVEFPKWA-----RIDTWVS 996
               QL     KI   G A++ R+  E+P  +F+P  G+   +E  + A     R+D   +
Sbjct: 299  -LQQLGLLQDKITTRGFAIQCRITTEDPSKNFQPDTGR---IEVYRSAGGNGVRLDGGNA 354

Query: 997  -KGTIVTPEYDPTLAKIIVHGKDRHDALEKLNKALVETKVSGCITNIDYLRSISSSEMFR 1055
              G +++P YD  L K    G        K+ +AL+E ++ G  TNI +L ++ +  +F+
Sbjct: 355  YAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHSVFK 414

Query: 1056 DAKVSTNILNSYDYKPSAMEII 1077
              +  T  +   D  P   E++
Sbjct: 415  SGEYWTTFI---DDTPQLFEMV 433

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 1777 VTEGEFVKSGQGLIIIEAMKTEMLVPTLHDGKVLKIVHKNGSMVDSGDLVVVIE 1830
            V +G  VK GQ + ++ AMK EM++ +   G V  ++ K+G  VDS DL+VV+E
Sbjct: 1073 VHKGSLVKKGQPVAVLSAMKMEMVISSPAAGLVKDVLIKDGENVDSSDLLVVLE 1126

>KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharomyces
            cerevisiae YNR016c ACC1 acetyl-CoA carboxylase, start by
            similarity
          Length = 2231

 Score =  232 bits (592), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 166/510 (32%), Positives = 255/510 (50%), Gaps = 76/510 (14%)

Query: 627  FTTVLVANRGEIAVRIIKTLKK---------MEIQSVAIFSTPDRY---SQHVIDADLTV 674
             + VL+AN G  AV+ I++++K           +Q VA+ +TP+     ++++  AD  +
Sbjct: 60   ISKVLIANNGIAAVKEIRSVRKWAYETFGDERTVQFVAM-ATPEDLEANAEYIRMADQYI 118

Query: 675  DLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDA--EGITFVGPSG 732
            ++ G +  + Y N++ I++ A++    A+  G+G  SEN    ER  A    I F+GP G
Sbjct: 119  EVPGGTNNNNYANVDLIVEVAERADVDAVWAGWGHASENPLLPERLAASHRKIIFIGPPG 178

Query: 733  DVMRGLGLKHSAREIAKKANVPLVPGSSL-ITTAHEAKEI-------------------- 771
            + MR LG K S+  +A+ A VP +P S   +   H  KE                     
Sbjct: 179  NAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDEVHVDKETNLVSVEDKVYQEGCCSSPED 238

Query: 772  ----AAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFI 827
                A ++ +PIMVK++ GGGG G++KVE+ED+    F ++  Q A     S +F+ +  
Sbjct: 239  GLKKAKEIGFPIMVKASEGGGGKGIRKVENEDE----FLSLYQQAANEIPGSPIFIMKLA 294

Query: 828  ENARHVEVQIMGDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLG 887
              ARH+EVQ++ D  G  +++  RDCS+QRR+QKIIEE P       T  ++ +AA RLG
Sbjct: 295  GKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMEKAAVRLG 354

Query: 888  SLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAP- 946
             L+ Y  AGTVE++Y    D+FYFLE+N RLQVEHP TEMVTG++L    L IA  +   
Sbjct: 355  QLVGYVSAGTVEYLYSHDEDKFYFLELNPRLQVEHPTTEMVTGVNLPSAQLQIAMGIPMH 414

Query: 947  -------------------DFN---------QLKIDVNGVAMEARLYAENPVHDFKPSPG 978
                               DFN         Q K    G     R+ +E+P   FKPS G
Sbjct: 415  RIRDIRLLYGVDPKSASEIDFNFSTPESAKTQRKPTPKGHCTACRITSEDPNEGFKPSGG 474

Query: 979  QLVEVEFPKWARIDTWVSKGTI--VTPEYDPTLAKIIVHGKDRHDALEKLNKALVETKVS 1036
             L E+ F   + +  + S G    +    D     I   G++R  + + +  AL E  + 
Sbjct: 475  ALHELNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIR 534

Query: 1037 GCI-TNIDYLRSISSSEMFRDAKVSTNILN 1065
            G   T ++YL  +  +E F D  ++T  L+
Sbjct: 535  GDFRTTVEYLIKLLETEDFEDNTITTGWLD 564

>Scas_720.74
          Length = 2231

 Score =  230 bits (586), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 165/510 (32%), Positives = 254/510 (49%), Gaps = 76/510 (14%)

Query: 627  FTTVLVANRGEIAVRIIKTLKK---------MEIQSVAIFSTPDRY---SQHVIDADLTV 674
             + +L+AN G  AV+ I++++K           IQ VA+ +TP+     ++++  AD  V
Sbjct: 59   ISKILIANNGIAAVKEIRSVRKWAYETFGNERTIQFVAM-ATPEDLEANAEYIRMADQYV 117

Query: 675  DLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERC--DAEGITFVGPSG 732
            ++ G +    Y N++ I+D A++    A+  G+G  SEN    E+       + F+GP G
Sbjct: 118  EVPGGTNNKNYANVDLIVDIAERADVDAVWAGWGHASENPHLPEKLAMSKRKVVFIGPPG 177

Query: 733  DVMRGLGLKHSAREIAKKANVPLVPGSS-------------LITTAHEAK---------- 769
              MR LG K S+  +A+ A+VP +P S              L++ A E            
Sbjct: 178  SAMRSLGDKISSTIVAQSAHVPCIPWSGTGIDKVQVDKDTGLVSVADEVYAQGCCSSPED 237

Query: 770  --EIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFI 827
              E A K+ +P+M+K++ GGGG G+++VE E+D    F  + HQ A     S +F+ +  
Sbjct: 238  GLEKAKKIGFPVMIKASEGGGGKGIRQVEREED----FIALYHQAANEIPGSPIFIMKLA 293

Query: 828  ENARHVEVQIMGDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLG 887
              ARH+EVQ++ D  GN +++  RDCS+QRR+QKIIEE P       T   + ++A RLG
Sbjct: 294  GKARHLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAAPETFAMMEKSAVRLG 353

Query: 888  SLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAAD---- 943
             L+ Y  AGTVE++Y     +FYFLE+N RLQVEHP TEMVTG++L    L IA      
Sbjct: 354  KLVGYVSAGTVEYLYSHEDKKFYFLELNPRLQVEHPTTEMVTGVNLPATQLQIAMGIPMH 413

Query: 944  ----------MAP------DFN---------QLKIDVNGVAMEARLYAENPVHDFKPSPG 978
                      M P      DF+         Q K    G     R+ +E+P   FKPS G
Sbjct: 414  RISDIRVFYGMNPHTASEIDFDFSTEESLKTQRKPVPKGHCTACRITSEDPDEGFKPSGG 473

Query: 979  QLVEVEFPKWARIDTWVSKGTI--VTPEYDPTLAKIIVHGKDRHDALEKLNKALVETKVS 1036
             L E+ F   + +  + S G    +    D     I   G++R  + + +  AL E  + 
Sbjct: 474  SLHELNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIR 533

Query: 1037 GCI-TNIDYLRSISSSEMFRDAKVSTNILN 1065
            G   T ++YL  +  +E F D  ++T  L+
Sbjct: 534  GDFRTTVEYLIKLLETEDFEDNTITTGWLD 563

>YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein with
            similarity to acetyl-CoA carboxylase [6372 bp, 2123 aa]
          Length = 2123

 Score =  227 bits (579), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 158/476 (33%), Positives = 238/476 (50%), Gaps = 58/476 (12%)

Query: 644  KTLKKMEIQSVAIFSTPDRY---SQHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKTGA 700
            +T    +I    + +TPD     S+++  AD  V + G +  + Y NI+ I+D A++T  
Sbjct: 10   ETFNDEKIIQFVVMATPDDLHANSEYIRMADQYVQVPGGTNNNNYANIDLILDVAEQTDV 69

Query: 701  QAIIPGYGFLSENADFSE--RCDAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPG 758
             A+  G+G  SEN    E        I F+GP G  MR LG K S+  +A+ A +P +P 
Sbjct: 70   DAVWAGWGHASENPCLPELLASSQRKILFIGPPGRAMRSLGDKISSTIVAQSAKIPCIPW 129

Query: 759  S-SLITTAH------------------------EAKEIAAKLEYPIMVKSTAGGGGIGLQ 793
            S S I T H                        +A E A  + +P+M+K++ GGGG G++
Sbjct: 130  SGSHIDTIHIDNKTNFVSVPDDVYVRGCCSSPEDALEKAKLIGFPVMIKASEGGGGKGIR 189

Query: 794  KVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGNALAIGERDC 853
            +V++EDD    F  +  Q       S +F+ + + +ARH+EVQ++ D  G  + +  RDC
Sbjct: 190  RVDNEDD----FIALYRQAVNETPGSPMFVMKVVTDARHLEVQLLADQYGTNITLFGRDC 245

Query: 854  SLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLE 913
            S+QRR+QKIIEE P       T Q++  AA RLG L+ Y  AGTVE++Y    D+FYFLE
Sbjct: 246  SIQRRHQKIIEEAPVTITKPETFQRMERAAIRLGELVGYVSAGTVEYLYSPKDDKFYFLE 305

Query: 914  VNTRLQVEHPITEMVTGIDLVEWMLVIA--------ADMAP------------DFNQLKI 953
            +N RLQVEHP TEM++G++L    L IA        +D+              DF  LK 
Sbjct: 306  LNPRLQVEHPTTEMISGVNLPATQLQIAMGIPMHMISDIRKLYGLDPTGTSYIDFKNLKR 365

Query: 954  -DVNGVAMEARLYAENPVHDFKPSPGQLVEVEFPKWARIDTWVSKGT--IVTPEYDPTLA 1010
                G  +  R+ +E+P   FKPS G++ E+ F   + +  + S G    +    D    
Sbjct: 366  PSPKGHCISCRITSEDPNEGFKPSTGKIHELNFRSSSNVWGYFSVGNNGAIHSFSDSQFG 425

Query: 1011 KIIVHGKDRHDALEKLNKALVETKVSGCI-TNIDYLRSISSSEMFRDAKVSTNILN 1065
             I   G DR DA + +  AL +  + G   T I+YL  +  +  F    +ST  L+
Sbjct: 426  HIFAVGNDRQDAKQNMVLALKDFSIRGEFKTPIEYLIELLETRDFESNNISTGWLD 481

 Score = 38.9 bits (89), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 1760 NSVMIYSEYSGRFWKPLVTEGEFVKSGQGLIIIEAMKTEMLVPTLHDGKVLKIVHKNGSM 1819
            N   + S   G+  K LV  G+ V +GQ    IE MK +M +    DG V++++ + GS+
Sbjct: 618  NPTQVISPTPGKLVKYLVRSGDHVFAGQQYAEIEIMKMQMPLVAKSDG-VIELLRQPGSI 676

Query: 1820 VDSGDLV 1826
            +++GD++
Sbjct: 677  IEAGDVI 683

>YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-CoA
            carboxylase, first and rate-limiting step in fatty acid
            biosynthesis pathway [6702 bp, 2233 aa]
          Length = 2233

 Score =  223 bits (567), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 158/510 (30%), Positives = 253/510 (49%), Gaps = 76/510 (14%)

Query: 627  FTTVLVANRGEIAVRIIKTLKK---------MEIQSVAIFSTPDRY---SQHVIDADLTV 674
             + +L+AN G  AV+ I++++K           +Q VA+ +TP+     ++++  AD  +
Sbjct: 59   ISKILIANNGIAAVKEIRSVRKWAYETFGDDRTVQFVAM-ATPEDLEANAEYIRMADQYI 117

Query: 675  DLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDA--EGITFVGPSG 732
            ++ G +  + Y N++ I+D A++    A+  G+G  SEN    E+       + F+GP G
Sbjct: 118  EVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKVIFIGPPG 177

Query: 733  DVMRGLGLKHSAREIAKKANVPLVPGSSL-ITTAH------------------------E 767
            + MR LG K S+  +A+ A VP +P S   + T H                        +
Sbjct: 178  NAMRSLGDKISSTIVAQSAKVPCIPWSGTGVDTVHVDEKTGLVSVDDDIYQKGCCTSPED 237

Query: 768  AKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFI 827
              + A ++ +P+M+K++ GGGG G+++VE E+D    F  + HQ A     S +F+ +  
Sbjct: 238  GLQKAKRIGFPVMIKASEGGGGKGIRQVEREED----FIALYHQAANEIPGSPIFIMKLA 293

Query: 828  ENARHVEVQIMGDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLG 887
              ARH+EVQ++ D  G  +++  RDCS+QRR+QKIIEE P       T  ++ +AA RLG
Sbjct: 294  GRARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKAETFHEMEKAAVRLG 353

Query: 888  SLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAA----- 942
             L+ Y  AGTVE++Y     +FYFLE+N RLQVEHP TEMV+G++L    L IA      
Sbjct: 354  KLVGYVSAGTVEYLYSHDDGKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMH 413

Query: 943  ---------DMAP------DF---------NQLKIDVNGVAMEARLYAENPVHDFKPSPG 978
                      M P      DF          Q +    G     R+ +E+P   FKPS G
Sbjct: 414  RISDIRTLYGMNPHSASEIDFEFKTQDATKKQRRPIPKGHCTACRITSEDPNDGFKPSGG 473

Query: 979  QLVEVEFPKWARIDTWVSKGT--IVTPEYDPTLAKIIVHGKDRHDALEKLNKALVETKVS 1036
             L E+ F   + +  + S G    +    D     I   G++R  + + +  AL E  + 
Sbjct: 474  TLHELNFRSSSNVWGYFSVGNNGNIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIR 533

Query: 1037 GCI-TNIDYLRSISSSEMFRDAKVSTNILN 1065
            G   T ++YL  +  +E F D  ++T  L+
Sbjct: 534  GDFRTTVEYLIKLLETEDFEDNTITTGWLD 563

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 1770 GRFWKPLVTEGEFVKSGQGLIIIEAMKTEMLVPTLHDGKVLKIVHKNGSMVDSGDLVVVI 1829
            G+  K LV  GE +  GQ    IE MK +M + +  +G +++++ + GS + +GD++ ++
Sbjct: 709  GKLVKFLVENGEHIIKGQPYAEIEVMKMQMPLVSQENG-IVQLLKQPGSTIVAGDIMAIM 767

>AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (HFA1)
            - SH] complement(466791..473486) [6696 bp, 2231 aa]
          Length = 2231

 Score =  222 bits (566), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 161/533 (30%), Positives = 256/533 (48%), Gaps = 80/533 (15%)

Query: 627  FTTVLVANRGEIAVRIIKTLKKMEIQSVA--------IFSTPDRY---SQHVIDADLTVD 675
             + +L+AN G  AV+ I++++K   ++          + +TP+     ++++  AD  V+
Sbjct: 59   ISKILIANNGIAAVKEIRSVRKWAYETFGDGKVVQFVVMATPEDLEANTEYIRMADQYVE 118

Query: 676  LKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERC--DAEGITFVGPSGD 733
            + G +  + Y N++ I+D A++    A+  G+G  SEN    E+       + F+GP G 
Sbjct: 119  VPGGTNNNNYANVDLIVDVAERADVDAVWAGWGHASENPLLPEKLARSKRKVVFIGPPGS 178

Query: 734  VMRGLGLKHSAREIAKKANVPLVPGS-------------SLITTAHEAKEI--------- 771
             MR LG K S+  +A+ A VP +P S              L++ A +  +          
Sbjct: 179  AMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVEIDPHTKLVSVADDIYQKGCCLSPEDG 238

Query: 772  ---AAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIE 828
               A ++ +P+MVK++ GGGG G++KV  E+D    F ++  Q A     S +F+ +   
Sbjct: 239  LNKAKQIGFPVMVKASEGGGGKGIRKVVREED----FISLYQQAANEIPGSPIFIMKLAG 294

Query: 829  NARHVEVQIMGDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGS 888
             ARH+EVQ++ D  G  +++  RDCS+QRR+QKIIEE P       T  ++  AA RLG 
Sbjct: 295  KARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFAEMERAAVRLGK 354

Query: 889  LLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADM---- 944
            L+ Y  AGTVE++Y    D+FYFLE+N RLQVEHP TEMVTG++L    L IA  +    
Sbjct: 355  LVGYVSAGTVEYLYSHEEDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPLHR 414

Query: 945  ----------------APDFNQLKIDV---------NGVAMEARLYAENPVHDFKPSPGQ 979
                              DF     D           G     R+ +E+P   FKPS G 
Sbjct: 415  IRDIRLFYGLDPHTATEIDFEFSSADALQTQRRPIPKGHCTACRITSEDPNEGFKPSGGS 474

Query: 980  LVEVEFPKWARIDTWVSKGTI--VTPEYDPTLAKIIVHGKDRHDALEKLNKALVETKVSG 1037
            L E+ F   + +  + S G    +    D     I   G++R  + + +  AL E  + G
Sbjct: 475  LHELNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRG 534

Query: 1038 CI-TNIDYLRSISSSEMFRDAKVSTNILNSY------DYKPSAMEIILPGSHT 1083
               T ++YL  +  +E F D  ++T  L+          KP  M  ++ G+ T
Sbjct: 535  DFRTTVEYLIKLLETEDFEDNTITTGWLDDLISQKISAEKPDPMLAVICGATT 587

>CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q00955
            Saccharomyces cerevisiae YNR016c ACC1 or sp|P32874
            Saccharomyces cerevisiae YMR207c HFA1, start by
            similarity
          Length = 2233

 Score =  221 bits (564), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 161/510 (31%), Positives = 252/510 (49%), Gaps = 76/510 (14%)

Query: 627  FTTVLVANRGEIAVRIIKTLKKME---------IQSVAIFSTPDRY---SQHVIDADLTV 674
             + VL+AN G  AV+ I++++K           +Q VA+ +TP+     ++++  AD  V
Sbjct: 59   ISKVLIANNGIAAVKEIRSVRKWAYETFGDEKIVQFVAM-ATPEDLEANAEYIRMADQYV 117

Query: 675  DLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERC--DAEGITFVGPSG 732
            ++ G +  + Y N++ I+D A++    A+  G+G  SEN    E+       I F+GP G
Sbjct: 118  EVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLARSKRKILFIGPPG 177

Query: 733  DVMRGLGLKHSAREIAKKANVPLVPGSSL-ITTAH------------------------E 767
            + MR LG K S+  +A+ A VP +P S   + T H                        +
Sbjct: 178  NAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDTVHIDEKNGLVSVDDDIYQKGCCSSPED 237

Query: 768  AKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFI 827
              E A K+ +P+M+K++ GGGG G+++V  E+D    F  + HQ A     S +F+ +  
Sbjct: 238  GLEKAKKIGFPVMIKASEGGGGKGIRQVTREED----FINLYHQAANEIPGSPIFIMKLA 293

Query: 828  ENARHVEVQIMGDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLG 887
              ARH+EVQ++ D  G  +++  RDCS+QRR+QKIIEE P       T  ++ +AA RLG
Sbjct: 294  GKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAGPETFGEMEKAAVRLG 353

Query: 888  SLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADM--- 944
             L+ Y  AGTVE++Y    ++FYFLE+N RLQVEHP TEMVTG++L    L IA  +   
Sbjct: 354  KLVGYVSAGTVEYLYSHDDNKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPMH 413

Query: 945  -----------------APDF---------NQLKIDVNGVAMEARLYAENPVHDFKPSPG 978
                               DF          Q K    G     R+ +E+P   FKPS G
Sbjct: 414  RISDIRIFYGLNPRGSSEIDFEFKSEDSLKTQRKPIPKGHCTACRITSEDPNDGFKPSGG 473

Query: 979  QLVEVEFPKWARIDTWVSKGTI--VTPEYDPTLAKIIVHGKDRHDALEKLNKALVETKVS 1036
             L E+ F   + +  + S G    +    D     I   G++R  + + +  AL E  + 
Sbjct: 474  TLNELNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIR 533

Query: 1037 GCI-TNIDYLRSISSSEMFRDAKVSTNILN 1065
            G   T ++YL  +  +E F +  ++T  L+
Sbjct: 534  GDFRTTVEYLIKLLETEDFEENTITTGWLD 563

>Kwal_23.6157
          Length = 2230

 Score =  221 bits (562), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 162/512 (31%), Positives = 252/512 (49%), Gaps = 80/512 (15%)

Query: 627  FTTVLVANRGEIAVRIIKTLKK---------MEIQSVAIFSTPDRY---SQHVIDADLTV 674
             + VL+AN G  AV+ I++++K           +Q VA+ +TP+     ++++  AD  V
Sbjct: 60   ISKVLIANNGIAAVKEIRSVRKWAYETFGNERAVQFVAM-ATPEDLEANAEYLRMADQYV 118

Query: 675  DLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDA--EGITFVGPSG 732
            ++ G +  + Y N++ I++ A++    A+  G+G  SEN    ER  A    + F+GP G
Sbjct: 119  EVPGGTNNNNYANVDLIVELAERADVDAVWAGWGHASENPLLPERLAASPRKVIFIGPPG 178

Query: 733  DVMRGLGLKHSAREIAKKANVPLVPGSSL-ITTAHEAKE--------------------- 770
            + MR LG K S+  +A+ A VP +P S   +   H  +E                     
Sbjct: 179  NAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVHLDEENGLVSVTDDIYQKGCCDSPED 238

Query: 771  ---IAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFI 827
                A K+ +P+MVK++ GGGG G++KVE E D    F  +  Q A     S +F+ +  
Sbjct: 239  GLAKAKKIGFPVMVKASEGGGGKGIRKVEREQD----FIPLYKQAANEIPGSPIFIMKLA 294

Query: 828  ENARHVEVQIMGDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLG 887
             NARH+EVQ++ D  G  +++  RDCS+QRR+QKIIEE P       T  ++  +A RLG
Sbjct: 295  GNARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMERSAVRLG 354

Query: 888  SLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVI------- 940
             L+ Y  AGTVE++Y    D+FYFLE+N RLQVEHP TEMV+G++L    L I       
Sbjct: 355  KLVGYVSAGTVEYLYSHDDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMH 414

Query: 941  ---------------AADMAPDFN-------QLKIDVNGVAMEARLYAENPVHDFKPSPG 978
                           A ++  DF+       Q +    G     R+ +E+P   FKPS G
Sbjct: 415  RIKDIRLMYGVDPHTATEIDFDFSSKDSTKIQRRPTPKGHCTACRITSEDPNEGFKPSGG 474

Query: 979  QLVEVEFPKWARIDTW----VSKGTIVTPEYDPTLAKIIVHGKDRHDALEKLNKALVETK 1034
             L E+ F   + +  W    VS    +    D     I   G++R  + + +  AL E  
Sbjct: 475  SLHELNFRSSSNV--WGYFSVSSSGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELS 532

Query: 1035 VSGCI-TNIDYLRSISSSEMFRDAKVSTNILN 1065
            + G   T ++YL  +  +E F    ++T  L+
Sbjct: 533  IRGDFRTTVEYLIKLLETEDFEGNSITTGWLD 564

>CAGL0M13585g complement(1335488..1336891) similar to sp|Q03557
           Saccharomyces cerevisiae YMR293c, hypothetical start
          Length = 467

 Score =  105 bits (263), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 127/464 (27%), Positives = 199/464 (42%), Gaps = 80/464 (17%)

Query: 58  LKKQWQILQH------RSGKESLP---LYGVPVAIKDNIDARGFPTTAACPSFL-YEPEK 107
           L+KQ+ I  H      ++  +SL    L G+   IKDNI  +  PTT        Y+   
Sbjct: 12  LQKQYNIFTHIDVEGVKNSYKSLKDGILSGLLCGIKDNIVTKDMPTTCGSEILRGYQSPY 71

Query: 108 DSKVVKLLRNAGAIIIGKTNLDQFATGLVGTRSPYGKT-----PCVFSDKHXXXXXXXXX 162
           D+ VVKLL+  G+I++GKTNLD+F  G  G  S +G T     P   +DK          
Sbjct: 72  DATVVKLLKQEGSIVLGKTNLDEFGMGSRGIHSCFGPTFNPLYPA--ADKVIMGGSSSGS 129

Query: 163 XXXXXRGIVPIALGTDTAGSGRVPAALNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSL 222
                   V  +LGTDT GS R+PA   ++ G KP+ G  S  GV+   +SLD V + + 
Sbjct: 130 AAAVVSEAVDFSLGTDTGGSVRLPATYGSIYGFKPSYGRISRYGVIAYAQSLDTVGILTK 189

Query: 223 NLSDAECCFKILCESD------LEN---DEYSRTYPRSPLRKFSDSVTIGIPKDLLWYGE 273
           N+S     + +L + D      LEN   D+    + R+ +++      IGI K+   + +
Sbjct: 190 NISTLRKVYHVLDKYDDKDPTSLENSYRDQILGIHERNTIKE-RKKYRIGIAKE---FSQ 245

Query: 274 EENPVLYDNA----IKQLEKSGANITKIDFEPLLELARCLYEGPWVAE-----------R 318
           +  P     A    +K+L   G ++  I   P ++ A  +Y     AE           R
Sbjct: 246 DSIPETIMEALLAFVKKLLDLGHDVVPISI-PSIKNALPIYYTLSPAEAVSNLSRFDGIR 304

Query: 319 Y------SAVKDFLQKNPSSKGFDHVVKSIIDSAKKFSAVDAFQFEYKRQ-----GLLQK 367
           Y      S + D +   P+ K F   VK+ I         ++F+  Y R       L+ +
Sbjct: 305 YGYRDQESDMSDNVMFAPTRKQFGREVKNRILLGNYNLCSESFKNNYIRAQKLRVQLIDE 364

Query: 368 IDKLLE----------------NIDALCVPTCPLNP-TFEDVSNEPILVNSRQ---GTWT 407
           +D +                  N+D L   T P  P   ED S   +   +++     +T
Sbjct: 365 MDSVFRYPNVLLNNKETTKSETNVDFLISLTTPSLPKKLEDFSVSDLDTPTKEYINDVFT 424

Query: 408 NFVNLADMAALAIPSGFRSDGLPTGITLIGKKFTDFALLDLAQM 451
             ++LA +  L+IP      G P G+ L+G+   D  +LD A+M
Sbjct: 425 MPMSLAGLPTLSIPI---IPGQPIGVQLVGQYGFDEMVLDFAEM 465

>Kwal_23.4249
          Length = 465

 Score =  104 bits (260), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 87/271 (32%), Positives = 129/271 (47%), Gaps = 29/271 (10%)

Query: 48  AWLSLCSADTLKKQW------------QILQHRSGKESLPLYGVPVAIKDNIDARGFPTT 95
           A   L S  T++KQ+            ++ Q  S  +  PL  +   IKDNI  +  PT+
Sbjct: 6   ALKRLSSLPTVQKQFNAFTYINPKCHERLSQGSSADDEKPLKNILCGIKDNIATKELPTS 65

Query: 96  AACPSFL---YEPEKDSKVVKLLRNAGAIIIGKTNLDQFATGLVGTRSPYGKT--PCVFS 150
             C S +   ++   ++ VV LL  AGA+ +GKTN+D+F  G  GT S +G T  P   S
Sbjct: 66  --CGSKILKDFQSPFNATVVDLLEGAGAVTVGKTNMDEFGMGSGGTHSHFGPTRNPQFPS 123

Query: 151 DKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNNLIGLKPTKGTFSCQGVVPA 210
           D                  +V  A+GTDT GS R+PAA  +++G KP+ G  S  GVV  
Sbjct: 124 DNVIAGGSSSGSAAAVAADVVDFAIGTDTGGSVRLPAAYTSVMGFKPSYGRISRHGVVAY 183

Query: 211 CKSLDCVSVFSLNLSDAECCFKILCESDLENDEYSRTYPRSPLRKFSDSVT---IGIPKD 267
            +SLD V + + ++   +  FK+L + D ++        R  L KF  S T   +GIP++
Sbjct: 184 AQSLDTVGILAKDIDIVQQVFKVLDKYDWKDPTSLDETSREKLAKFHCSKTKLKVGIPQE 243

Query: 268 LLWYGEEENPVLYD----NAIKQLEKSGANI 294
            L   + E P         AI +LE  G +I
Sbjct: 244 FL---QAEIPADLQEALLRAITKLESKGHDI 271

>YMR293C (YMR293C) [4247] chr13 complement(855398..856792) Protein
           with similarity to amidases, may be involved in
           mitochondrial function [1395 bp, 464 aa]
          Length = 464

 Score =  100 bits (249), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 120/444 (27%), Positives = 187/444 (42%), Gaps = 69/444 (15%)

Query: 62  WQILQHRSGKESLPLYGVPVAIKDNIDARGFPTTAACPSFLYEPEK---DSKVVKLLRNA 118
           + I   +  KE+L   G   +IKDNI  + FPTT  C S + E  K   D+ VVKLL+ A
Sbjct: 32  YSITNKKGTKETLT--GCVASIKDNIVTKDFPTT--CASHILENFKSPFDATVVKLLKQA 87

Query: 119 GAIIIGKTNLDQFATGLVGTRSPYGKTPCV-----FSDKHXXXXXXXXXXXXXXRGIVPI 173
           G  I+GKTNLD+F  G  G  S  G  P +       DK                 +V  
Sbjct: 88  GVHILGKTNLDEFGMGSGGVHSIRG--PVINPLYPHEDKKIMGGSSSGAAASVACDLVDF 145

Query: 174 ALGTDTAGSGRVPAALNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKI 233
           ALGTDT GS R+PA   +++G KP+ G  S  GV+   +SLD V + S  ++     F  
Sbjct: 146 ALGTDTGGSVRLPACYGSVLGFKPSYGRLSRFGVIAYSQSLDTVGILSKKINVLRKVFHT 205

Query: 234 LCESDLENDEYSRTYPRSPL---RKFSDSVTIGIPKDLLWYGEEENPV----LYDNAIKQ 286
           L + D+++        R  +   +K    + +GI K+   +  E  P+    LY + +++
Sbjct: 206 LDKYDMKDPTSLSVELRELIEGNKKVRRPLKVGIVKE---FSHESMPIGFHRLYLSLLEK 262

Query: 287 LEKSGANITKIDF----------------EPLLELARCLYEGPWVAERYSA--VKDFLQK 328
           L   G  I  +                  E    L+R  Y+G     R S   +KD +  
Sbjct: 263 LINLGLEIYPVSIPSVKNCLPIYYTLSPAEAASNLSR--YDGIRYGYRDSELDIKDGILF 320

Query: 329 NPSSKGFDHVVKSIIDSAKKFSAVDAF-----QFEYKRQGLLQKIDKLL----------- 372
            P+   F   VK+ I         DAF     + E  R  L+ + D +            
Sbjct: 321 APTRSKFGTEVKNRIILGNYNLCSDAFKNNFIKAEKLRVNLIDEFDGIFRFPNVLTNSKG 380

Query: 373 --ENIDALCVPTCPLNP----TFEDVSNEPILVNSRQGTWTNFVNLADMAALAIPSGFRS 426
             + +D L VPT    P     FE+   +    +     +T  ++LA + +L++P     
Sbjct: 381 NPDGLDLLIVPTSSKLPGSIRDFEEEEAKSPANSYINDVFTVPMSLAGLPSLSMP---LK 437

Query: 427 DGLPTGITLIGKKFTDFALLDLAQ 450
           +  P G+ ++G+   D  +LD  +
Sbjct: 438 EKTPIGLQVVGQYGDDSTVLDFVE 461

>KLLA0A09845g complement(862467..863876) similar to sp|Q03557
           Saccharomyces cerevisiae YMR293c, start by similarity
          Length = 469

 Score = 95.5 bits (236), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 90/275 (32%), Positives = 124/275 (45%), Gaps = 39/275 (14%)

Query: 75  PLYGVPVAIKDNIDARGFPTTAACPSFL---YEPEKDSKVVKLLRNAGAIIIGKTNLDQF 131
           PL     AIKDNI  +  P+T  C S +   Y    D+ VV LL  AG +I GK N+D+F
Sbjct: 46  PLNYTLAAIKDNIATKNMPST--CASKILDGYMSPFDATVVSLLLEAGTVIAGKANMDEF 103

Query: 132 ATGLVGTRSPYGKT--PCV-FSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAA 188
             G  G  S +G T  P     D+                G+V  ALGTDT GS R+PA+
Sbjct: 104 GMGSAGIHSHFGPTFNPLFDHKDRVIAGGSSSGSAAAVASGVVDFALGTDTGGSVRLPAS 163

Query: 189 LNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESD---------- 238
             +  G KP+ G  S  GV+   +SLD V VF+ +LS  +  F +L + D          
Sbjct: 164 YTSTFGFKPSYGRLSRHGVISYAQSLDTVGVFANDLSMIDRVFSLLDKHDKKDPTSLSEE 223

Query: 239 LENDEYSRTYPRSPLRKFSDSVTIGIPKDLLWYGEEENPVLYDNA----IKQLEKSGANI 294
           L +   S T  R  LR       IGIP++   + +E  P  +  A    IK+L K G  +
Sbjct: 224 LRHKFTSLTTKRKTLR-------IGIPEE---FSQESVPAEFRAAMTAIIKRLMKKGHEV 273

Query: 295 TKIDFEPLLELARCLYEGPWVAE------RYSAVK 323
             +   P ++ A  +Y     AE      RY  V+
Sbjct: 274 YPVSI-PSVKNALSIYYTLSPAEAVSNLSRYDGVR 307

>Scas_684.25
          Length = 482

 Score = 94.7 bits (234), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 96/205 (46%), Gaps = 15/205 (7%)

Query: 75  PLYGVPVAIKDNIDARGFPTTAACPSFL---YEPEKDSKVVKLLRNAGAIIIGKTNLDQF 131
           PL     A+KDNI     PTT  C S +   Y+   D+ VVKLLR +G  I+GKTN+D+F
Sbjct: 48  PLSNTLCAVKDNIATNDMPTT--CSSSMLSNYQSPFDATVVKLLRESGTTIVGKTNMDEF 105

Query: 132 ATGLVGTRSPYGK--TPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAAL 189
           A G +G  S YG    P                      G+V  ALGTDT GS R+PA  
Sbjct: 106 AMGSLGIHSHYGPALNPLFHDVDTVSGGSSSGSAGSVTSGVVHFALGTDTGGSVRLPACY 165

Query: 190 NNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESD------LENDE 243
            +++G K + G  S  GVV   +SLD V + + NL   +  F  L + D      L  D 
Sbjct: 166 CSVLGFKGSYGRISRFGVVSFAQSLDTVGIMADNLQRVKDVFNTLDKFDKKDPTSLSEDL 225

Query: 244 YSRTYPRSPLR--KFSDSVTIGIPK 266
            +     S LR  +      IGIPK
Sbjct: 226 RNEINSISKLREKRGRAKFRIGIPK 250

>ABR140C [732] [Homologous to ScYMR293C - SH] (662185..663576) [1392
           bp, 463 aa]
          Length = 463

 Score = 91.7 bits (226), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 101/205 (49%), Gaps = 14/205 (6%)

Query: 75  PLYGVPVAIKDNIDARGFPTTAACPSFL---YEPEKDSKVVKLLRNAGAIIIGKTNLDQF 131
           PL  + V IKDNI  +  PTT  C S +   Y    D+ VV+LL  AGA+  GKTN+D+F
Sbjct: 38  PLGNLVVGIKDNIVTKKLPTT--CSSGVLAGYMSPYDATVVELLDEAGAVTAGKTNMDEF 95

Query: 132 ATGLVGTRSPYGKT--PCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAAL 189
             G  G  S +G T  P                      G+V  ALGTDT GS R+PAA 
Sbjct: 96  GMGSGGIHSFFGPTLNPAFPERPTVAGGSSSGSAAAVAAGVVDFALGTDTGGSVRMPAAY 155

Query: 190 NNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESDLEN-----DEY 244
            + +G KP+ G  S  GV+   +SLD V + + ++      F++L   D ++     DE 
Sbjct: 156 TSTVGFKPSYGRVSRHGVIAYAQSLDTVGIGARDVGLVRRVFEVLDRHDPKDPTSLPDEL 215

Query: 245 SRTYPRSPLRKFSDSVTIGIPKDLL 269
            +    + LR+    + IGIP +LL
Sbjct: 216 RQQ--AAALRREKKHLKIGIPAELL 238

>Kwal_56.22295
          Length = 583

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 106/240 (44%), Gaps = 22/240 (9%)

Query: 75  PLYGVPVAIKDNIDARG-FPTTAACPSFLYEP-EKDSKVVKLLRNAGAIIIGKTNLDQFA 132
           PL+G+P  +KDN   +    TT    + L     +D+ VV  LR+AGA++ G   L ++A
Sbjct: 131 PLHGIPFVVKDNYATKDKMDTTCGSWALLGSVVPRDAHVVAKLRDAGAVLFGHATLSEWA 190

Query: 133 -----TGLVGTRSPYGKTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPA 187
                +   G  +  G+  C F+                   ++P +LGT+T GS   PA
Sbjct: 191 DMRSSSYSEGYSARGGQARCPFNLSVNPGGSSSGSAAAVAANMIPFSLGTETDGSIIDPA 250

Query: 188 ALNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESDLENDEYSRT 247
             N ++G KPT G  S  GVVP  +  D     + ++ DA   F+ +   D E D Y+  
Sbjct: 251 MRNGIVGFKPTVGLTSRAGVVPESEHQDSTGPMARSVRDAVYAFQYMWGVD-ERDVYTLN 309

Query: 248 ----YPRSP--LRKFSD-----SVTIGIPKDLLW--YGEEENPVLYDNAIKQLEKSGANI 294
                P     L+  S+         G+P   LW    ++E P L +  +K +E +GA +
Sbjct: 310 QTGHVPEDGDYLKYLSNKDALKGAKFGLPWQKLWSLAKKDEIPRLLE-VVKMIEDAGATV 368

>Sklu_2417.11 , Contig c2417 20071-21846
          Length = 591

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 105/246 (42%), Gaps = 20/246 (8%)

Query: 66  QHRSGKESLPLYGVPVAIKDNIDARG-FPTTAACPSFLYEP-EKDSKVVKLLRNAGAIII 123
           + ++G    PL+G+P  +KDN   +    TTA   S +     +D+ VV+ LR+AGA++ 
Sbjct: 131 ERKNGNVRGPLHGIPFVVKDNYATKDKMDTTAGSWSLMGSVVPRDAYVVEKLRDAGAVLF 190

Query: 124 GKTNLDQFA-----TGLVGTRSPYGKTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTD 178
           G   + ++A     +   G  +  G+  C F+                   ++  +LGT+
Sbjct: 191 GHATMSEWADMRSNSYSEGYSARGGQARCPFNLTVNPGGSSSGSAGSVAANMIMFSLGTE 250

Query: 179 TAGSGRVPAALNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESD 238
           T GS   PA  N ++G KPT G  S  GV+P  +  D     +  + DA   F+ +   D
Sbjct: 251 TDGSIIDPAMRNGIVGFKPTVGLTSRAGVIPESEHQDSTGPMARTVKDAVYVFQSMWGVD 310

Query: 239 LENDEYS-----RTYPRSPLRKFSDS------VTIGIPKDLLW-YGEEENPVLYDNAIKQ 286
            E D Y+      T       KF  +         G+P   LW Y  ++        +K 
Sbjct: 311 -ERDAYTLNQTGHTPEDGDYLKFLSNKDALKGARFGLPWKKLWSYARKDEIARLLEVVKL 369

Query: 287 LEKSGA 292
           +E +GA
Sbjct: 370 IEAAGA 375

>Sklu_2417.10 , Contig c2417 20071-21846
          Length = 591

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 105/246 (42%), Gaps = 20/246 (8%)

Query: 66  QHRSGKESLPLYGVPVAIKDNIDARG-FPTTAACPSFLYEP-EKDSKVVKLLRNAGAIII 123
           + ++G    PL+G+P  +KDN   +    TTA   S +     +D+ VV+ LR+AGA++ 
Sbjct: 131 ERKNGNVRGPLHGIPFVVKDNYATKDKMDTTAGSWSLMGSVVPRDAYVVEKLRDAGAVLF 190

Query: 124 GKTNLDQFA-----TGLVGTRSPYGKTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTD 178
           G   + ++A     +   G  +  G+  C F+                   ++  +LGT+
Sbjct: 191 GHATMSEWADMRSNSYSEGYSARGGQARCPFNLTVNPGGSSSGSAGSVAANMIMFSLGTE 250

Query: 179 TAGSGRVPAALNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESD 238
           T GS   PA  N ++G KPT G  S  GV+P  +  D     +  + DA   F+ +   D
Sbjct: 251 TDGSIIDPAMRNGIVGFKPTVGLTSRAGVIPESEHQDSTGPMARTVKDAVYVFQSMWGVD 310

Query: 239 LENDEYS-----RTYPRSPLRKFSDS------VTIGIPKDLLW-YGEEENPVLYDNAIKQ 286
            E D Y+      T       KF  +         G+P   LW Y  ++        +K 
Sbjct: 311 -ERDAYTLNQTGHTPEDGDYLKFLSNKDALKGARFGLPWKKLWSYARKDEIARLLEVVKL 369

Query: 287 LEKSGA 292
           +E +GA
Sbjct: 370 IEAAGA 375

>KLLA0E15444g 1370741..1377427 highly similar to sp|P07259
            Saccharomyces cerevisiae YJL130c URA2 multifunctional
            pyrimidine biosynthesis protein, start by similarity
          Length = 2228

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 65/301 (21%), Positives = 137/301 (45%), Gaps = 23/301 (7%)

Query: 639  AVRIIKTLKKMEIQSVAIFSTPDRYSQHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKT 698
            AV  ++TL+K   +++ +   P+  S    +AD              +N+E+I+D  +  
Sbjct: 1000 AVTAVRTLRKNNFKTIMVNYNPETVSTDYDEAD--------RLYFETINLERIMDIYELE 1051

Query: 699  GAQAIIPGYGFLSENADFSERCDAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPG 758
             +  ++   G  + N + +     E +  +G S +++     ++    +  + +V   P 
Sbjct: 1052 SSAGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIDVDQ-PA 1109

Query: 759  SSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGD 818
               +T+  EA++ A K+ YP++V+ +    G  +  V S+DD+E       +Q      +
Sbjct: 1110 WKELTSMDEAEDFAEKVSYPVLVRPSYVLSGAAMNTVYSKDDLESYL----NQAVEVSRE 1165

Query: 819  SGVFMERFIENARHVE---VQIMGDGLGNALAIGERDCSLQRRNQKIIEETPAPNL-PET 874
              V + ++IENA+ +E   V + G+ + + ++    +  +   +  +I   P  +L PET
Sbjct: 1166 YPVVITKYIENAKEIEMDAVALDGELIMHVVSEHVENAGVHSGDATLI--VPPQDLDPET 1223

Query: 875  TRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLV 934
             R ++ EA  ++G  L+      ++FI     +E   +E N R     P    V G++L+
Sbjct: 1224 VR-RIVEATAKIGRALQITGPYNIQFIAK--NNEIKVIECNVRASRSFPFISKVVGVNLI 1280

Query: 935  E 935
            E
Sbjct: 1281 E 1281

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 32/163 (19%), Positives = 64/163 (39%), Gaps = 16/163 (9%)

Query: 777 YPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQ 836
           +P++V++    GG+G     +E       E V     A+     V +ER ++  + +E +
Sbjct: 591 FPVIVRAAYALGGLGSGFASNEK------ELVDLCNVAFASSPQVLVERSMKGWKEIEYE 644

Query: 837 IMGDGLGNALAIGERDCSLQRRNQKIIEE------TPAPNLPETTRQKLREAAQRLGSLL 890
           ++ D   N + +    C+++  +   I         P+  L +     LR  A  +   L
Sbjct: 645 VVRDAFDNCITV----CNMENFDPLGIHTGDSIVIAPSQTLSDEDYNMLRTTAVNVIRHL 700

Query: 891 KYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDL 933
                  +++  +    E+  +EVN RL     +    TG  L
Sbjct: 701 GVVGECNIQYALNPTSKEYCIIEVNARLSRSSALASKATGYPL 743

>CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharomyces
            cerevisiae YJL130c URA2, start by similarity
          Length = 2211

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/300 (20%), Positives = 133/300 (44%), Gaps = 21/300 (7%)

Query: 639  AVRIIKTLKKMEIQSVAIFSTPDRYSQHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKT 698
            AV  ++TL+   I+++ I   P+  S    +AD              +N+E+++D  +  
Sbjct: 1000 AVTAVRTLRANNIKTIMINYNPETVSTDYDEAD--------RLYFETINLERVLDIYEAE 1051

Query: 699  GAQAIIPGYGFLSENADFSERCDAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPG 758
             +  ++   G  + N + +     E +  +G S D++     ++    +  +  V   P 
Sbjct: 1052 ASNGVVVSMGGQTSN-NIAMSLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGVDQ-PA 1109

Query: 759  SSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGD 818
               +T+  EA++ A K+ YP++V+ +    G  +  V S++D+E       +Q      D
Sbjct: 1110 WKELTSMDEAEDFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYL----NQAVEVSRD 1165

Query: 819  SGVFMERFIENARHVEVQIM---GDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETT 875
              V + ++IENA+ +E+  +   G+ + + ++    +  +   +  +I   P  +L   T
Sbjct: 1166 YPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAPET 1223

Query: 876  RQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVE 935
              ++  A  ++G  LK      ++FI  +  +E   +E N R     P    V G++L+E
Sbjct: 1224 VDRIVVATAKIGKALKITGPYNIQFIAKD--NEIKVIECNVRASRSFPFISKVVGVNLIE 1281

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 35/181 (19%), Positives = 68/181 (37%), Gaps = 16/181 (8%)

Query: 759 SSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGD 818
           S    +  EA      + +P++V++    GG+G     +E       E +     A+   
Sbjct: 573 SQAANSVEEALAAVKDIGFPVIVRAAYALGGLGSGFANNEQ------ELIDLCNVAFASS 626

Query: 819 SGVFMERFIENARHVEVQIMGDGLGNALAIGERDCSLQR------RNQKIIEETPAPNLP 872
             V +ER ++  + VE +++ D   N + +    C+++            I   P+  L 
Sbjct: 627 PQVLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLS 682

Query: 873 ETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGID 932
           +     LR  A  +   L       +++  +    E+  +EVN RL     +    TG  
Sbjct: 683 DEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYP 742

Query: 933 L 933
           L
Sbjct: 743 L 743

>YJL130C (URA2) [2788] chr10 complement(165641..172285)
            Multifunctional protein of pyrimidine biosynthesis
            pathway, contains glutamine amidotransferase,
            glutamine-dependent carbamylphosphate synthetase
            (CPSase), dihydroorotase-like (DHOase) domain, and
            aspartate carbamyltransferase (ATCase) [6645 bp, 2214 aa]
          Length = 2214

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/300 (20%), Positives = 132/300 (44%), Gaps = 21/300 (7%)

Query: 639  AVRIIKTLKKMEIQSVAIFSTPDRYSQHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKT 698
            AV  ++TL+   I+++ +   P+  S    +AD              +N+E+++D  +  
Sbjct: 1002 AVTAVRTLRANNIKTIMVNYNPETVSTDYDEAD--------RLYFETINLERVLDIYEIE 1053

Query: 699  GAQAIIPGYGFLSENADFSERCDAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPG 758
             +  ++   G  + N + +     E +  +G S D++     ++    +  +  V   P 
Sbjct: 1054 NSSGVVVSMGGQTSN-NIAMTLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGVDQ-PA 1111

Query: 759  SSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGD 818
               +T+  EA+  A K+ YP++V+ +    G  +  V S++D+E       +Q      D
Sbjct: 1112 WKELTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYL----NQAVEVSRD 1167

Query: 819  SGVFMERFIENARHVEVQIM---GDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETT 875
              V + ++IENA+ +E+  +   G+ + + ++    +  +   +  +I   P  +L   T
Sbjct: 1168 YPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAPET 1225

Query: 876  RQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVE 935
              ++  A  ++G  LK      ++FI  +  +E   +E N R     P    V G++L+E
Sbjct: 1226 VDRIVVATAKIGKALKITGPYNIQFIAKD--NEIKVIECNVRASRSFPFISKVVGVNLIE 1283

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 34/181 (18%), Positives = 70/181 (38%), Gaps = 16/181 (8%)

Query: 759 SSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGD 818
           S    +  EA     ++ +P++V++    GG+G     +E       E V     A+   
Sbjct: 575 SQAANSVDEALAAVKEIGFPVIVRAAYALGGLGSGFANNEK------ELVDLCNVAFSSS 628

Query: 819 SGVFMERFIENARHVEVQIMGDGLGNALAIGERDCSLQR------RNQKIIEETPAPNLP 872
             V +E+ ++  + VE +++ D   N + +    C+++            I   P+  L 
Sbjct: 629 PQVLVEKSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLS 684

Query: 873 ETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGID 932
           +     LR  A  +   L       +++  + +  ++  +EVN RL     +    TG  
Sbjct: 685 DEDYNMLRTTAVNVIRHLGVVGECNIQYALNPVSKDYCIIEVNARLSRSSALASKATGYP 744

Query: 933 L 933
           L
Sbjct: 745 L 745

>ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..834552)
            [6723 bp, 2240 aa]
          Length = 2240

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/301 (20%), Positives = 136/301 (45%), Gaps = 23/301 (7%)

Query: 639  AVRIIKTLKKMEIQSVAIFSTPDRYSQHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKT 698
            AV  ++TL++  ++++ +   P+  S    + D              +N+E+I+D  +  
Sbjct: 1018 AVTAVRTLRQNNVKTIMVNYNPETVSTDYDEVD--------RLYFETINMERILDIYEVE 1069

Query: 699  GAQAIIPGYGFLSENADFSERCDAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPG 758
             +  ++   G  + N + +     E +  +G S +++     ++    +  +  V   P 
Sbjct: 1070 SSAGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIEVDQ-PA 1127

Query: 759  SSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGD 818
               +T+  EA++ A K+ YP++V+ +    G  +  V S+DD+E       +Q      +
Sbjct: 1128 WKELTSMEEAEDFANKVGYPVLVRPSYVLSGAAMNTVYSKDDLESYL----NQAVEVSRE 1183

Query: 819  SGVFMERFIENARHVEVQIM---GDGLGNALAIGERDCSLQRRNQKIIEETPAPNL-PET 874
              V + ++IENA+ +E+  +   G+ + + ++    +  +   +  +I   P  +L PET
Sbjct: 1184 YPVVITKYIENAKEIEMDAVAKDGEMIMHVVSEHVENAGVHSGDATLI--VPPQDLDPET 1241

Query: 875  TRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLV 934
             R ++ +A  ++G  LK      ++FI     +E   +E N R     P    V G++L+
Sbjct: 1242 VR-RIVDATAKIGRALKITGPYNIQFIAK--NNEIKVIECNVRASRSFPFISKVIGVNLI 1298

Query: 935  E 935
            E
Sbjct: 1299 E 1299

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 72/354 (20%), Positives = 134/354 (37%), Gaps = 52/354 (14%)

Query: 688  IEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDAEGITFVGPSGDVM-----RGLGLKH 742
            + K+I   +         G   LS   +  +  +A G+  +G S D +     R L   +
Sbjct: 521  VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFEALGVKVLGTSIDTIITTEDREL-FAN 579

Query: 743  SAREIAKKANVPLVPGSSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIE 802
            +  EI +K        S   +T  EA E    + +P++V++    GG+G     +E    
Sbjct: 580  AMDEINEKC-----AKSKAASTVDEALEAVKDIGFPVIVRAAYALGGLGSGFASNEQ--- 631

Query: 803  RIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGNALAIGERDCSLQR----- 857
               E V     A+     V +ER ++  + VE +++ D   N + +    C+++      
Sbjct: 632  ---ELVDLCNVAFASSPQVLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLG 684

Query: 858  -RNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNT 916
                  I   P+  L +     LR  A  +   L       +++  +    E+  +EVN 
Sbjct: 685  IHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNA 744

Query: 917  RLQVEHPITEMVTGIDLVEWMLVIAADMAPDFNQLKIDVNGVAMEARLYAENPVHDFKPS 976
            RL     +    TG  L       AA +      L I +N V        ++    F+PS
Sbjct: 745  RLSRSSALASKATGYPLA----YTAAKLG-----LNIPLNEVKNSV---TQSTCACFEPS 792

Query: 977  PGQLVEVEFPKW-----ARIDTWVSKGTIVTPEYDPTLAKIIVHGKDRHDALEK 1025
                V V+ P+W      R+ T +S           ++ +++  G+   +A++K
Sbjct: 793  LDYCV-VKMPRWDLKKFTRVSTLLSSSM-------KSVGEVMSVGRTFEEAIQK 838

>Scas_582.4*
          Length = 2193

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 61/300 (20%), Positives = 133/300 (44%), Gaps = 21/300 (7%)

Query: 639  AVRIIKTLKKMEIQSVAIFSTPDRYSQHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKT 698
            AV  ++TL+  +I+++ I   P+  S    +AD              +N+E+I+D  +  
Sbjct: 977  AVTAVRTLRANKIKTIMINYNPETVSTDYDEAD--------RLYFETINLERILDIYEIE 1028

Query: 699  GAQAIIPGYGFLSENADFSERCDAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPG 758
             +  ++   G  + N + +     E +  +G S +++     ++    +  +  V   P 
Sbjct: 1029 NSSGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIGVDQ-PA 1086

Query: 759  SSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGD 818
               +T+  EA+  A K+ YP++V+ +    G  +  V S++D+        +Q      D
Sbjct: 1087 WKELTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLASYL----NQAVEVSRD 1142

Query: 819  SGVFMERFIENARHVEVQIM---GDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETT 875
              V + ++IENA+ +E+  +   G+ + + ++    +  +   +  +I   P  +L + T
Sbjct: 1143 YPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAKET 1200

Query: 876  RQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVE 935
              ++  A  ++G  LK      ++FI  +  +E   +E N R     P    V G++L+E
Sbjct: 1201 VDRIVVATAKIGKALKITGPYNIQFIAKD--NEIKVIECNVRASRSFPFISKVVGVNLIE 1258

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 34/181 (18%), Positives = 68/181 (37%), Gaps = 16/181 (8%)

Query: 759 SSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGD 818
           S    +  EA      + +P++V++    GG+G     +E       E +     A+   
Sbjct: 570 SHAANSVEEALTAVKDIGFPVIVRAAYALGGLGSGFANNEQ------ELIDLCNVAFASS 623

Query: 819 SGVFMERFIENARHVEVQIMGDGLGNALAIGERDCSLQR------RNQKIIEETPAPNLP 872
             V +ER ++  + +E +++ D   N + +    C+++            I   P+  L 
Sbjct: 624 PQVLVERSMKGWKEIEYEVVRDAFDNCVTV----CNMENFDPLGIHTGDSIVVAPSQTLS 679

Query: 873 ETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGID 932
           +     LR  A  +   L       +++  +    E+  +EVN RL     +    TG  
Sbjct: 680 DEEYNMLRNTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYP 739

Query: 933 L 933
           L
Sbjct: 740 L 740

>Scas_721.66
          Length = 573

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 61/129 (47%), Gaps = 3/129 (2%)

Query: 75  PLYGVPVAIKDNIDARGFPTTAACPSFLYEPEK---DSKVVKLLRNAGAIIIGKTNLDQF 131
           PLYG+P+++KD  +  G  TT    S  ++P+K   +S +V  LR+ GAII  KT +   
Sbjct: 141 PLYGIPISLKDQCNVEGVDTTLGYLSRAFKPKKKEDESLIVSFLRDLGAIIYVKTTVPPS 200

Query: 132 ATGLVGTRSPYGKTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNN 191
                 T + +G T   F+                      + LGTD  GS R+PA+ + 
Sbjct: 201 MMATETTSNTFGYTYNSFNQHFSAGGSSGGEGSLIGCYGSVLGLGTDIGGSIRIPASYHG 260

Query: 192 LIGLKPTKG 200
           + G KP+ G
Sbjct: 261 IFGFKPSTG 269

>Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement
          Length = 546

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/269 (23%), Positives = 113/269 (42%), Gaps = 31/269 (11%)

Query: 63  QILQHRSGKESLPLYGVPVAIKDNIDARGFPTTAACPSFLYEPE---KDSKVVKLLRNAG 119
           ++L  R   + LPLYG+P+++KD  +  G+ TT       ++P+   ++S +VK L++ G
Sbjct: 107 KLLDERKPDKLLPLYGIPISLKDQCNVAGYDTTLGYLGRAFKPKTAAEESLLVKFLKDLG 166

Query: 120 AIIIGKTNLDQFATGLVGTRSPYGKT-PCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTD 178
           A++  KT +           + +G T   V ++                 G + + +GTD
Sbjct: 167 AVLYVKTTVPSSMMASETVSNTFGYTLNSVNTNFSSGGSSGGEGSLIGCYGSI-LGIGTD 225

Query: 179 TAGSGRVPAALNNLIGLKPTKG---------TFSCQGVVPACKSLDCVSVFSLNLSDAEC 229
             GS R+P++   L GL+PT G         +F  Q ++P+      +   + NL D E 
Sbjct: 226 IGGSIRIPSSFQGLFGLRPTHGRLPYLKVDNSFEGQELIPS-----VIGPLARNLEDLEF 280

Query: 230 CFKILCE--SDLENDEYSRTYPRSPLRKFSDSVTIGIPKDLLWY--GEEENPVLYDNAIK 285
             +++       E D     Y         D+  +GI     WY  G    P     A+K
Sbjct: 281 FMELIVNKCKPWEYDVKCLEYHWDSKTALHDNYNVGI-----WYTDGIVTPPPSVARALK 335

Query: 286 QLEK---SGANITKIDFEPLLELARCLYE 311
           + E+   S      + + P  +L   +Y+
Sbjct: 336 KCEEIINSAPGFKAVQWAPDTDLNSSIYQ 364

>YDR242W (AMD2) [1076] chr4 (946799..948448) Protein with similarity
           to amidases [1650 bp, 549 aa]
          Length = 549

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 108/257 (42%), Gaps = 30/257 (11%)

Query: 75  PLYGVPVAIKDNIDARGFPTTAACPSFLYEPE---KDSKVVKLLRNAGAIIIGKTNLDQF 131
           PLYG+P+++KD  +  G  T+       ++P+   ++S +V  LR+ GAII  KT +   
Sbjct: 123 PLYGIPISLKDQCNVEGVDTSLGYLCRTFKPKTKNEESLIVSFLRDLGAIIFVKTTVPSS 182

Query: 132 ATGLVGTRSPYGKTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNN 191
                   + +G T    +                      + LGTD  GS R+P++   
Sbjct: 183 MMATDTQSNTFGYTYNSINLSFSSGGSSGGEGSLIGAHGSLLGLGTDIGGSIRIPSSYQG 242

Query: 192 LIGLKPTKG---------TFSCQGVVPACKSLDCVSVFSLNLSDAE---CCFKILCESDL 239
           L GLKPT G         +F  +  +P+      +   + +LSD      C   +C+  +
Sbjct: 243 LFGLKPTFGRVPYLRVDNSFEGRETIPS-----VIGPLARDLSDLRYFMSCVINICQPWV 297

Query: 240 ENDEYSRTYPRSPLRKFSDSVTIGIPKDLLWYGEE--ENPVLYDNAIKQLE---KSGANI 294
           ++ +    +  S   K  D+  +GI     WYG+   + P     A+K  E        +
Sbjct: 298 QDVKCIPYHFDSSTSKLHDNYVVGI-----WYGDGVIDPPPSDIRALKTCEDLVNKTKGM 352

Query: 295 TKIDFEPLLELARCLYE 311
             + +EP  EL+R L++
Sbjct: 353 KAVKWEPSSELSRELFD 369

>Sklu_2331.1 YJL130C, Contig c2331 2029-8691
          Length = 2220

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 58/300 (19%), Positives = 129/300 (43%), Gaps = 21/300 (7%)

Query: 639  AVRIIKTLKKMEIQSVAIFSTPDRYSQHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKT 698
            AV  ++TL+   ++++ +   P+  S    +AD              +N+E+I+D  +  
Sbjct: 1002 AVTAVRTLRANNVKTIMVNYNPETVSTDYDEAD--------RLYFETINLERILDIYEAE 1053

Query: 699  GAQAIIPGYGFLSENADFSERCDAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPG 758
             +  ++   G  + N + +     E +  +G S +++     ++    +  +  V   P 
Sbjct: 1054 ASAGVVISMGGQTSN-NIAMSLHREKVKILGTSPEMIDSAENRYKFSRMLDQIGVDQ-PA 1111

Query: 759  SSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGD 818
               +T+  EA+  A  + YP++V+ +    G  +  V S+DD+        +Q      D
Sbjct: 1112 WKELTSIDEAEGFAENVGYPVLVRPSYVLSGAAMNTVYSKDDLASYL----NQAVEVSRD 1167

Query: 819  SGVFMERFIENARHVEVQIM---GDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETT 875
              V + ++IENA+ +E+  +   G+ + + ++    +  +   +  +I   P  +L   T
Sbjct: 1168 YPVVITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLI--VPPQDLDPET 1225

Query: 876  RQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVE 935
              ++  A  ++G  LK      ++FI     ++   +E N R     P    V G++L+E
Sbjct: 1226 VNRIVVATAKIGKALKITGPYNIQFIAK--NNDIKVIECNVRASRSFPFISKVVGVNLIE 1283

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/278 (20%), Positives = 109/278 (39%), Gaps = 41/278 (14%)

Query: 759  SSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGD 818
            S   +T  EA E   ++ +P++V++    GG+G     +E       E V     A+   
Sbjct: 575  SKAASTVKEALEAVKEIGFPVIVRAAYALGGLGSGFASNET------ELVDLCNVAFASS 628

Query: 819  SGVFMERFIENARHVEVQIMGDGLGNALAIGERDCSLQR------RNQKIIEETPAPNLP 872
              V +ER ++  + VE +++ D   N + +    C+++            I   P+  L 
Sbjct: 629  PQVLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLS 684

Query: 873  ETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGID 932
            +     LR  A  +   L       +++  +    E+  +EVN RL     +    TG  
Sbjct: 685  DEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYP 744

Query: 933  LVEWMLVIAADMAPDFNQLKIDVNGVAMEARLYAENPVHDFKPSPGQLVEVEFPKW---- 988
            L      IAA +      L I +N V        ++    F+PS    V V+ P+W    
Sbjct: 745  LA----FIAAKLG-----LNIPLNEVKNSV---TKSTCACFEPSLDYCV-VKMPRWDLKK 791

Query: 989  -ARIDTWVSKGTIVTPEYDPTLAKIIVHGKDRHDALEK 1025
              R+ T +S           ++ +++  G+   +A++K
Sbjct: 792  FTRVSTQLSSSM-------KSVGEVMSVGRTFEEAIQK 822

>Kwal_33.14061
          Length = 2221

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/300 (19%), Positives = 131/300 (43%), Gaps = 21/300 (7%)

Query: 639  AVRIIKTLKKMEIQSVAIFSTPDRYSQHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKT 698
            AV  ++TL+K +I+S+ +   P+  S    +AD              + +E+I+D  +  
Sbjct: 1002 AVTAVRTLRKEKIKSIMVNYNPETVSTDYDEAD--------RLYFETICLERILDIYEIE 1053

Query: 699  GAQAIIPGYGFLSENADFSERCDAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPG 758
             +  ++   G  + N + +     E +  +G + +++     ++    +  +  V   P 
Sbjct: 1054 SSAGVVVSMGGQTSN-NIAMSLHRENVKILGTTPEMIDSAENRYKFSRMLDQIGVDQ-PA 1111

Query: 759  SSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGD 818
               +T+  EA++ A  + +P++V+ +    G  +  V S+DD+        +Q      D
Sbjct: 1112 WKELTSIEEAEQFADAVSFPVLVRPSYVLSGAAMNTVYSKDDLASYL----NQAVEVSRD 1167

Query: 819  SGVFMERFIENARHVEVQIM---GDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETT 875
              V + ++IENA+ +E+  +   G+ + + ++    +  +   +  +I   P  +L   T
Sbjct: 1168 YPVVITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLI--VPPQDLDPET 1225

Query: 876  RQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVE 935
             +++  A  ++G  LK      ++FI     ++   +E N R     P    V  ++L+E
Sbjct: 1226 VERIVVATAKIGKALKITGPFNIQFIAK--NNDIKVIECNVRASRSFPFISKVVNVNLIE 1283

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 75/356 (21%), Positives = 132/356 (37%), Gaps = 69/356 (19%)

Query: 709  FLSENADF------SERCDAEGITFVGPSG--------DVMRGLGLK-----------HS 743
            FL  NA+F       ER DA  +TF G +         D    LG+K             
Sbjct: 497  FLPVNAEFVRKVILHERPDAIYVTFGGQTALSVGIEMKDEFEALGVKVLGTPIDTVITTE 556

Query: 744  AREIAKKANVPL---VPGSSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDD 800
             RE+   A   +      S    T  EA E   ++ +P++ ++    GG+G     +E  
Sbjct: 557  DRELFSNAMDEINEKCAKSKAAATVEEALEAVKEIGFPVICRAAYALGGLGSGFANNEK- 615

Query: 801  IERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGNALAIGERDCSLQR--- 857
                 E V     A+     V +ER ++  + VE +++ D   N + +    C+++    
Sbjct: 616  -----ELVDLCNIAFASSPQVLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDP 666

Query: 858  ---RNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEV 914
                    I   P+  L +     LR  A  +   L       +++  +    E+  +EV
Sbjct: 667  LGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEV 726

Query: 915  NTRLQVEHPITEMVTGIDLVEWMLVIAADMAPDFNQLKIDVNGVAMEARLYAENPVHDFK 974
            N RL     +    TG  L       AA +      L I +N V        ++    F+
Sbjct: 727  NARLSRSSALASKATGYPLA----YTAAKLG-----LNIPLNEVRNSV---TQSTCACFE 774

Query: 975  PSPGQLVEVEFPKW-----ARIDTWVSKGTIVTPEYDPTLAKIIVHGKDRHDALEK 1025
            PS    V V+ P+W     +R+ T +S           ++ +++  G+   +A++K
Sbjct: 775  PSLDYCV-VKMPRWDLKKFSRVSTALSSSM-------KSVGEVMSIGRTFEEAIQK 822

>Sklu_2136.3 , Contig c2136 3336-5189 reverse complement
          Length = 617

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 75/156 (48%), Gaps = 7/156 (4%)

Query: 48  AWLSLCSADTLKKQWQILQH--RSGKESLPLYGVPVAIKDNIDARGFPTTAACPSFLYEP 105
           A L     + L K  ++  H   +GK   PL+GVPV++K+ ++ +G PT A+  S++   
Sbjct: 159 AALQFLIPEALAKAKELDAHLKATGKLVGPLHGVPVSLKEQMNFKGKPTHASYVSYITNI 218

Query: 106 EKDSKV-VKLLRNAGAIIIGKTNLDQFATGLVGTRSPYGKT--PCVFSDKHXXXXXXXXX 162
            K+S V + +L   GAI   +T+  Q    L    +  G+T  PC  +            
Sbjct: 219 PKNSAVSIDILDKLGAIFHTRTSQPQAIMHLDTWNNITGRTRNPCS-TRLSPGGSSGGES 277

Query: 163 XXXXXRGIVPIALGTDTAGSGRVPAALNNLIGLKPT 198
                 G V I  G+D  GS RVPAA  +L G++PT
Sbjct: 278 AMVGMHGSV-IGHGSDIGGSIRVPAAFVDLFGIRPT 312

>Sklu_2413.4 YJR109C, Contig c2413 10886-14254
          Length = 1122

 Score = 54.7 bits (130), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 87/181 (48%), Gaps = 15/181 (8%)

Query: 762 ITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFG-DSG 820
           +T+ +EAK  A+K+ YP++++ +    G  +  V SED++E     VK   A+    D  
Sbjct: 717 LTSVNEAKIFASKVGYPVLIRPSYVLSGAAMSVVNSEDELE-----VKLTNASDVSPDHP 771

Query: 821 VFMERFIENARHVEVQIM---GDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQ 877
           V + +FIE A+ ++V  +   G  L +A++    +  +   +  +I   P  +L E T+Q
Sbjct: 772 VVISKFIEGAQEIDVDAVAYDGKVLVHAISEHVENAGVHSGDASLI--LPPQHLSEETKQ 829

Query: 878 KLREAAQRLGSLLKYKCAGTVEFIYDEIRDE---FYFLEVNTRLQVEHPITEMVTGIDLV 934
           +L++ A ++           ++ I D+ RD       +E N R     P    V GI+ +
Sbjct: 830 RLKDIADKVAKAWNICGPFNMQIIKDD-RDHGTSLKVIECNIRASRSFPFVSKVLGINFI 888

Query: 935 E 935
           +
Sbjct: 889 D 889

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/191 (21%), Positives = 82/191 (42%), Gaps = 17/191 (8%)

Query: 749 KKANVPLVPGSSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETV 808
           K+ N+P+   S    T  +A E AAK++YP++V+S    GG+G      E +++ +    
Sbjct: 161 KEINIPIAE-SFACETIDQALEAAAKVKYPVIVRSAYALGGLGSGFANDEQEMKELASQS 219

Query: 809 KHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGNALAIGERDCSLQRRNQKIIEE--- 865
                       + +E+ ++  + +E +++ D +GN + +    C+++  +   I     
Sbjct: 220 LSLAPQ------ILVEKSLKGWKEIEYEVVRDRVGNCITV----CNMENFDPLGIHTGDS 269

Query: 866 ---TPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEH 922
               P+  L +     LR AA ++   L       V++       ++  +EVN RL    
Sbjct: 270 IVFAPSQTLSDEEFHMLRSAAIKIIRHLGVVGECNVQYALQPDGLDYRVIEVNARLSRSS 329

Query: 923 PITEMVTGIDL 933
            +    TG  L
Sbjct: 330 ALASKATGYPL 340

>Sklu_2072.3 , Contig c2072 3010-4362 reverse complement
          Length = 450

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 91/433 (21%), Positives = 156/433 (36%), Gaps = 84/433 (19%)

Query: 69  SGKESLPLYGVPVAIKDNIDARGFPTTAACPSFLYE-PEKDSKVVKLLRNAGAIIIGKTN 127
           +GK   P++G+P+++K++   +G  T A   S +    E+D+   ++ R AGA+   +T 
Sbjct: 22  TGKTVGPMHGLPLSLKEHYAYKGKTTNAGFSSMIDNLTEEDALTTEIFRKAGAVFYIRTT 81

Query: 128 LDQFATGLVGTRSPYGKTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPA 187
             Q    L    +  G+     +                     P+  G+D  GS R PA
Sbjct: 82  QPQSLMHLDSFNNITGRCRNPLNTLLSPGGSTSGEGALISLRGSPLGTGSDIGGSIRAPA 141

Query: 188 ALNNLIGLKPTKGTFSCQGVVPACKSLD------CVSVFSLNLSDAECCFKILCESD-LE 240
           A  N+ G KPT    S QG   + + +        V   +    D E   K   +S+   
Sbjct: 142 AFCNIWGFKPTNKRVSLQGAWASYRDMSNDMVLCSVGPMANTPEDLELYMKTFLDSEPWL 201

Query: 241 NDEYSRTYPRSPLRKFSDSVTIGIPKDLLWYGEEENPVL--YDNAIKQLEKSGANITKID 298
            D Y    P   +    D + I I  D     +   PVL   + A K LEK+G       
Sbjct: 202 RDNYVIRLPWREVDLSLDKLKIAIVMD-DGIVKPSPPVLRALELAKKSLEKAG------- 253

Query: 299 FEPLLELARCLYEGPWVAERYSAVKDFLQKNPSSKG-FDHVVK---------SIIDSAKK 348
                 +A+C+    WV    S   D      +  G F+H  +          + +   +
Sbjct: 254 ------VAKCV---EWVPFNTSEGLDICYTAYNCDGNFNHRSRYEESGEPLAPLSEHHMR 304

Query: 349 FS-------AVDAFQFEYKRQGLLQKIDKLLENIDALCVPTCPLNPTFEDVSNEPILVNS 401
           F        +++  Q+ +KR    Q+   ++  ID   V    L P +      P  +  
Sbjct: 305 FGCGDRGLDSLEMLQYLHKRDSYRQRFADMMNEIDVDYV----LTPAY----FAPAAIPD 356

Query: 402 RQGTW--TNFVNLADMAALAIPSGFRS------------------------------DGL 429
           +   W  T   N+ D+  ++ P+G  +                              DG 
Sbjct: 357 KIKYWGYTALYNILDLPGVSFPTGVVTDAKLDAKDANHVPRNALEEYEYPLYDEELYDGF 416

Query: 430 PTGITLIGKKFTD 442
           P G++L G+++ D
Sbjct: 417 PVGLSLHGRRYYD 429

>Kwal_34.15724
          Length = 556

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 78/168 (46%), Gaps = 15/168 (8%)

Query: 76  LYGVPVAIKDNIDARGFPTTAACPSFL-YEPEKDSKVVKLLRNAGAIIIGKTNLDQFATG 134
           L+GVP+++KD ++  G  TT    S +  + EK S + ++L++ GAI   KT +      
Sbjct: 124 LHGVPISLKDQVNLPGIETTIGYISKVGSKSEKVSLLARVLQDQGAIFYVKTAVPTAMLA 183

Query: 135 LVGTRSPYGKTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNNLIG 194
                S +G+T    +                     P+ +GTD  GS R+PAA   L G
Sbjct: 184 SETVSSLHGRTLNAVNIAFSSGGSSGGEGSLIGARGSPLGVGTDIGGSIRIPAAFQGLYG 243

Query: 195 LKPTKG---------TFSCQGVVPAC-----KSLDCVSVFSLNLSDAE 228
           L+P+ G         ++  Q ++P+       SL+ + +F+ ++ DA+
Sbjct: 244 LRPSHGRIPYMHVANSYEGQELIPSVIGPLGTSLNDLELFTKSVIDAK 291

>KLLA0B08800g complement(772732..774444) similar to
           ca|CA4426|CaAMD21 Candida albicans amidase (by
           homology), start by similarity
          Length = 570

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 105/281 (37%), Gaps = 45/281 (16%)

Query: 75  PLYGVPVAIKDNIDARGFPTTAACPSFL-YEPEKDSKVVKLLRNAGAIIIGKTNLDQFAT 133
           PL+GVPV+IK+ +  +G  T A+  S++ + PE+ +  V +L   GA+   +T+  Q   
Sbjct: 141 PLHGVPVSIKEQMCYKGKVTNASYVSYVDFVPEQSAVSVDILIKLGAVCHVRTSQPQTIM 200

Query: 134 GLVGTRSPYGKTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNNLI 193
            L    +  G+T    S K                    I  G+D  GS R PAA  NL 
Sbjct: 201 HLDTWNNYIGRTRNPRSTKLSPGGSSGGESACVGMHGSVIGHGSDIGGSIRAPAAFANLF 260

Query: 194 GLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESDLENDEYSRTYPR--- 250
           GL+PT    S    +   K  + V      L+ +        +S L   +   T P    
Sbjct: 261 GLRPTTKRVSLLNGISGGKGQESVVAVQGPLARSIDELDYYMKSYLNEGKPWETDPSLVP 320

Query: 251 SPLRKFS--DSVTIGI-PKDLL--------------------------------WYGEEE 275
            P RK S  D + IGI P D L                                W+ EEE
Sbjct: 321 IPWRKSSLPDVINIGILPSDGLVTPYPSITRGVKHVADVLSKDPRFNVIDLSEQWFSEEE 380

Query: 276 NPVLYDNAIKQLEKSGANITKIDF-----EPLLELARCLYE 311
              LYD  +  L     N  ++       EP+L L R   E
Sbjct: 381 MKELYDTTL-SLYTCDGNKVQLSMLEPSGEPILPLTRHFLE 420

>KLLA0F03190g complement(296883..300236) highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2 arginine-specific
           carbamoylphosphate synthase, large chain, start by
           similarity
          Length = 1117

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 81/185 (43%), Gaps = 13/185 (7%)

Query: 757 PGSSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYF 816
           P  S +++  EAK  A ++ YP++++ +    G  +  V  E ++E    T         
Sbjct: 709 PEWSELSSVEEAKVFANQVGYPVLIRPSYVLSGAAMSVVTGEHELEVKLTTASDVSP--- 765

Query: 817 GDSGVFMERFIENARHVEVQ-IMGDGLGNALAIGER--DCSLQRRNQKIIEETPAPNLPE 873
            D  V M +FIE A+ ++V  +  +G+    AI E   +  +   +  ++   P  NL +
Sbjct: 766 -DHPVVMSKFIEGAQEIDVDAVAHNGMVLVHAISEHVENAGIHSGDATLV--LPPQNLSQ 822

Query: 874 TTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDE---FYFLEVNTRLQVEHPITEMVTG 930
             + +L+E A ++           ++ I D+ RDE      +E N R     P    V G
Sbjct: 823 NIKDRLKEIADKVAKAWNITGPFNMQIIKDD-RDEGVSLKVIECNIRASRSFPFVSKVLG 881

Query: 931 IDLVE 935
           ++ +E
Sbjct: 882 VNFIE 886

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 34/176 (19%), Positives = 72/176 (40%), Gaps = 16/176 (9%)

Query: 764 TAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFM 823
           T   A E A  + +P++V+S    GG+G     +  +++++                + +
Sbjct: 173 TVDAALEAADIVGFPVIVRSAYALGGLGSGFANNAQEMKQLASQSLSLAPQ------ILV 226

Query: 824 ERFIENARHVEVQIMGDGLGNALAIGERDCSLQRRNQKIIEE------TPAPNLPETTRQ 877
           E+ ++  + VE +++ D +GN + +    C+++  +   I         P+  L +    
Sbjct: 227 EKSLKGWKEVEYEVVRDRVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFH 282

Query: 878 KLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDL 933
            LR AA ++   L       V++       ++  +EVN RL     +    TG  L
Sbjct: 283 MLRSAAIKIIRHLGVIGECNVQYALSPDSLDYRVIEVNARLSRSSALASKATGYPL 338

>Kwal_55.19783
          Length = 1121

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/210 (21%), Positives = 95/210 (45%), Gaps = 13/210 (6%)

Query: 757 PGSSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYF 816
           P  S +++  EAK+ +  + YP++++ +    G  +  V SED++    ET     +   
Sbjct: 712 PEWSELSSVSEAKDFSKSVGYPVLIRPSYVLSGAAMSVVNSEDEL----ETKLTNASDVS 767

Query: 817 GDSGVFMERFIENARHVEVQIM---GDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPE 873
            D  V + +FIE A+ ++V  +   G+ L +A++    +  +   +  +I   P  +L E
Sbjct: 768 PDHPVVISKFIEGAQEIDVDAVAYNGEVLVHAISEHVENAGVHSGDATLI--LPPQSLSE 825

Query: 874 TTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRD--EFYFLEVNTRLQVEHPITEMVTGI 931
           + +++L + A+++    K      ++ I D+  +      +E N R     P    V G 
Sbjct: 826 SIKERLYDIAKKVAHAWKITGPFNMQIIKDDRHEGTSLKVIECNIRASRSFPFVSKVLGC 885

Query: 932 DLVEWML--VIAADMAPDFNQLKIDVNGVA 959
           + ++  +   I  D+    N +  + N VA
Sbjct: 886 NFIDVAVKAFIGEDVPEPVNLMTQEYNYVA 915

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 41/191 (21%), Positives = 80/191 (41%), Gaps = 17/191 (8%)

Query: 749 KKANVPLVPGSSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETV 808
           K+ N+P    S    T  EA   A+++ YP++V+S    GG+G    E+E +++ +    
Sbjct: 161 KEINIPTAE-SFACETVDEALSAASRVGYPVIVRSAYALGGLGSGFAENEAEMKEL---- 215

Query: 809 KHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGNALAIGERDCSLQR------RNQKI 862
                A      + +E+ ++  + VE +++ D + N + +    C+++            
Sbjct: 216 --AAQALSLSPQILVEKSLKGWKEVEYEVVRDRVDNCITV----CNMENFDPLGVHTGDS 269

Query: 863 IEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEH 922
           I   P+  L +     LR AA ++   L       V++       ++  +EVN RL    
Sbjct: 270 IVFAPSQTLSDEEFHMLRTAAIKIIRHLGVVGECNVQYALQPDGLDYRVIEVNARLSRSS 329

Query: 923 PITEMVTGIDL 933
            +    TG  L
Sbjct: 330 ALASKATGYPL 340

>Kwal_27.10438
          Length = 569

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 59/130 (45%), Gaps = 1/130 (0%)

Query: 75  PLYGVPVAIKDNIDARGFPTTAACPSFLYE-PEKDSKVVKLLRNAGAIIIGKTNLDQFAT 133
           PL+GV V++K+ ++ +G  TTA+  ++L    EK+   + +LR  GA+   +T   Q   
Sbjct: 143 PLHGVVVSLKEQMNYKGKVTTASYVAYLRNVTEKEGLSISILRKLGAVFHVRTAQPQGIM 202

Query: 134 GLVGTRSPYGKTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVPAALNNLI 193
            L    +  G+T    S +                    I  G+D  GS R PAA  +L 
Sbjct: 203 HLDTWNNITGRTRNPLSTRLSPGGSSGGESAIVAMHGSVIGHGSDIGGSIRAPAAFADLF 262

Query: 194 GLKPTKGTFS 203
           G++PT    S
Sbjct: 263 GIRPTTKRIS 272

>CAGL0C04917g 457506..460847 highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2, hypothetical
           start
          Length = 1113

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/177 (20%), Positives = 77/177 (43%), Gaps = 10/177 (5%)

Query: 762 ITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGV 821
           +T+  EAK  A K+ YP++++ +    G  +  V +E ++E               D  V
Sbjct: 714 LTSVEEAKTFANKVSYPVLIRPSYVLSGAAMSVVNNEHELEDKLTLASDVSP----DHPV 769

Query: 822 FMERFIENARHVEVQIM---GDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQK 878
            M +FI+ A+ ++V  +   G+ L +A++    D  +   +  +I   P  +L E  + +
Sbjct: 770 VMSKFIQGAQEIDVDAVACNGELLVHAISEHVEDAGVHSGDATLI--LPPQHLSENVKSQ 827

Query: 879 LREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVE 935
           L+  A+++           ++ I     ++   +E N R     P    V G++ +E
Sbjct: 828 LKTIAKKVAKAWNITGPFNMQVI-KAGENDLKVIECNIRASRSFPFVSKVLGVNFIE 883

>YJR109C (CPA2) [3001] chr10 complement(629500..632856)
           Carbamoylphosphate synthetase of arginine biosynthetic
           pathway, synthetase (large) subunit [3357 bp, 1118 aa]
          Length = 1118

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/195 (20%), Positives = 85/195 (43%), Gaps = 12/195 (6%)

Query: 757 PGSSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYF 816
           P  S +T+  EAK  A+K+ YP++++ +    G  +  V +E++++              
Sbjct: 709 PEWSELTSVEEAKLFASKVNYPVLIRPSYVLSGAAMSVVNNEEELKAKLTLASDVSP--- 765

Query: 817 GDSGVFMERFIENARHVEVQIM---GDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPE 873
            D  V M +FIE A+ ++V  +   G+ L +A++    +  +   +  ++   P  +L +
Sbjct: 766 -DHPVVMSKFIEGAQEIDVDAVAYNGNVLVHAISEHVENAGVHSGDASLV--LPPQHLSD 822

Query: 874 TTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDL 933
             +  L++ A ++    K      ++ I D        +E N R     P    V G++ 
Sbjct: 823 DVKIALKDIADKVAKAWKITGPFNMQIIKDG-EHTLKVIECNIRASRSFPFVSKVLGVNF 881

Query: 934 VEWML--VIAADMAP 946
           +E  +   +  D+ P
Sbjct: 882 IEIAVKAFLGGDIVP 896

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 39/191 (20%), Positives = 81/191 (42%), Gaps = 17/191 (8%)

Query: 749 KKANVPLVPGSSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETV 808
           K  N+P+   S    T  EA E A +++YP++V+S    GG+G     +  +++ +    
Sbjct: 158 KDINIPIAE-SFACETVDEALEAAERVKYPVIVRSAYALGGLGSGFANNASEMKEL---- 212

Query: 809 KHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGNALAIGERDCSLQRRNQKIIEE--- 865
                +      + +E+ ++  + VE +++ D +GN + +    C+++  +   +     
Sbjct: 213 --AAQSLSLAPQILVEKSLKGWKEVEYEVVRDRVGNCITV----CNMENFDPLGVHTGDS 266

Query: 866 ---TPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEH 922
               P+  L +     LR AA ++   L       V++       ++  +EVN RL    
Sbjct: 267 MVFAPSQTLSDEEFHMLRSAAIKIIRHLGVIGECNVQYALQPDGLDYRVIEVNARLSRSS 326

Query: 923 PITEMVTGIDL 933
            +    TG  L
Sbjct: 327 ALASKATGYPL 337

>Scas_691.19
          Length = 1117

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 81/198 (40%), Gaps = 11/198 (5%)

Query: 741 KHSAREIAKKANVPLVPGSSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDD 800
           +H    I    NV   P  S +T+  EAK  A K+ YP++++ +    G  +  V +ED+
Sbjct: 694 RHKFSSILDSINVGQ-PAWSELTSVDEAKVFADKVGYPVLIRPSYVLSGAAMSVVNNEDE 752

Query: 801 IERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIM---GDGLGNALAIGERDCSLQR 857
           ++               D  V M +FIE A+ ++V  +   G  L +A++    +  +  
Sbjct: 753 LKLKLTLASDVSP----DHPVVMSKFIEGAQEIDVDAVAYNGKVLIHAISEHVENAGVHS 808

Query: 858 RNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTR 917
            +  +I   P  NL +  +  L+E A ++           ++ I  E       +E N R
Sbjct: 809 GDASLI--LPPQNLSDKVKANLKEIADKVADAWHITGPFNMQII-KEGDKPLKVIECNIR 865

Query: 918 LQVEHPITEMVTGIDLVE 935
                P    V G + +E
Sbjct: 866 ASRSFPFVSKVLGKNFIE 883

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/191 (20%), Positives = 80/191 (41%), Gaps = 17/191 (8%)

Query: 749 KKANVPLVPGSSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETV 808
           K+ N+P +  S    T  EA   A  ++YP++++S    GG+G     ++ +++++    
Sbjct: 158 KEINIP-IANSIACATVDEALAAANSIKYPVIIRSAYALGGLGSGFANNDQELKQLSSQS 216

Query: 809 KHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGNALAIGERDCSLQR------RNQKI 862
                       + +ER ++  + VE +++ D +GN + +    C+++            
Sbjct: 217 LSLSPQ------ILVERSMKGWKEVEYEVVRDRVGNCITV----CNMENFDPLGVHTGDS 266

Query: 863 IEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEH 922
           I   P+  L +     LR AA ++   L       V++       ++  +EVN RL    
Sbjct: 267 IVFAPSQTLSDEEYHMLRSAAIKIIRHLGVIGECNVQYALQPDGLDYCVIEVNARLSRSS 326

Query: 923 PITEMVTGIDL 933
            +    TG  L
Sbjct: 327 ALASKATGYPL 337

>KLLA0D12628g 1071637..1073373 weakly similar to sp|P22580
           Saccharomyces cerevisiae YDR242w AMD2 amidase singleton,
           hypothetical start
          Length = 578

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 62/151 (41%), Gaps = 1/151 (0%)

Query: 68  RSGKESLPLYGVPVAIKDNIDARGFPTTAACPSFLYE-PEKDSKVVKLLRNAGAIIIGKT 126
            +GK   P++G+P+++K+++  +G  T A+  S L     K +  V +    GA+   +T
Sbjct: 136 ENGKLVGPMHGIPISLKEHLSFKGEITHASYVSLLSSVTPKHALTVDIFDKQGALYHVRT 195

Query: 127 NLDQFATGLVGTRSPYGKTPCVFSDKHXXXXXXXXXXXXXXRGIVPIALGTDTAGSGRVP 186
              Q    L       G+T    S K                    I +GTD  GS R P
Sbjct: 196 AQPQTIMHLDTWNIITGRTRNPRSTKLSPGGSSGGESAAIGMHGSVIGIGTDIGGSIRCP 255

Query: 187 AALNNLIGLKPTKGTFSCQGVVPACKSLDCV 217
           AA   + G++PT    S   V P+    + +
Sbjct: 256 AAFAGICGMRPTVKRVSLLDVTPSSGGQESI 286

>ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH]
           complement(695747..699088) [3342 bp, 1113 aa]
          Length = 1113

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 89/216 (41%), Gaps = 17/216 (7%)

Query: 724 GITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGSSLITTAHEAKEIAAKLEYPIMVKS 783
           G+T +G    V+     +       K+ N+P+   S   +T  +A   A  + YP++V+S
Sbjct: 133 GVTVLGTPISVLETTEDRELFARALKEINMPIAE-SVACSTVEDAVAAANDIGYPVIVRS 191

Query: 784 TAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLG 843
               GG+G     ++DD++     +  Q  A      V +E+ ++  + +E +++ D +G
Sbjct: 192 AYALGGLG--SGFADDDLQ--LRQLCAQSLAL--SPQVLVEKSLKGWKEIEYEVVRDRVG 245

Query: 844 NALAIGERDCSLQRRNQKIIEE------TPAPNLPETTRQKLREAAQRLGSLLKYKCAGT 897
           N + +    C+++  +   I         P+  L +     LR AA  +   L       
Sbjct: 246 NCITV----CNMENFDPLGIHTGDSIVLAPSQTLSDEEFHMLRTAAIEIIRHLGVVGECN 301

Query: 898 VEFIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDL 933
           V++        F  +EVN RL     +    TG  L
Sbjct: 302 VQYALQPDGLAFKVIEVNARLSRSSALASKATGYPL 337

 Score = 38.5 bits (88), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 38/197 (19%), Positives = 84/197 (42%), Gaps = 13/197 (6%)

Query: 757 PGSSLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYF 816
           P  S + +  E K     + YP++V+ +    G  +  V + +D+E +FE+      A  
Sbjct: 704 PRWSELKSLSEVKHFLDDVGYPVLVRPSYVLSGAAMSTVYNSEDLEGVFES----AVAVS 759

Query: 817 GDSGVFMERFIENARHVEVQIM---GDGLGNALAIGERDCSLQRRNQKIIEETPAPNLPE 873
            +  V + +FIE A+ +++  +   G  L +A++    +  +   +  ++   P  +L E
Sbjct: 760 PEHPVVISKFIEGAQELDIDAVAYKGSLLVHAISEHVENAGVHSGDATLV--LPPQSLKE 817

Query: 874 TTRQKLREAAQRLGSLLKYKCAGTVEFI--YDEIRDEFYFLEVNTRLQVEHPITEMVTGI 931
             + +L++ A ++ +         ++ I   +        +E N R     P    V G+
Sbjct: 818 EEKTRLKQLAAQVAAAWNITGPFNMQIIKTAEGGHTCLKIIECNIRASRSFPFVSKVLGV 877

Query: 932 DLVEWML--VIAADMAP 946
           + VE  +   +  D+ P
Sbjct: 878 NFVEIAVKAFLGGDLVP 894

>Kwal_27.11485
          Length = 471

 Score = 36.2 bits (82), Expect = 0.28,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 35/75 (46%), Gaps = 9/75 (12%)

Query: 399 VNSRQGTWTNFVNLADM-------AALAIPSGFRSDGLPTGI--TLIGKKFTDFALLDLA 449
           +N+  GT T F +  ++         LAIP  FRSDG+  GI  TLI    + F L  LA
Sbjct: 1   MNTNTGTATAFFSTINLVKTIVGAGMLAIPYAFRSDGVLVGIVLTLIAALTSGFGLFVLA 60

Query: 450 QMYFQIAYPNNSRTF 464
           +    +  P  S  F
Sbjct: 61  KCSKTLTNPRASSFF 75

>Scas_628.24
          Length = 487

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 36/80 (45%), Gaps = 7/80 (8%)

Query: 240 ENDEYSRTYPRSPLRKFSDSVTIGIPKDLLWYGEEENPVLYDNAIKQLEKSGANITKIDF 299
           END   R YP        D  TI    D L    + N V YD+AIK+L++SG +     F
Sbjct: 294 ENDLLPRYYPNG----VDDRETILTRWDSLIDPSKWNTVTYDDAIKKLQESGQDFV---F 346

Query: 300 EPLLELARCLYEGPWVAERY 319
           +P    A       W+AE Y
Sbjct: 347 KPTWGKALQSEHEKWLAESY 366

>CAGL0H07887g 769859..772234 highly similar to sp|P07244
           Saccharomyces cerevisiae YGL234w ADE5, start by
           similarity
          Length = 791

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 57/120 (47%), Gaps = 6/120 (5%)

Query: 724 GITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGSSLITTAHEAKEIAAKLEYPIMVKS 783
           GI   GPS    +  G K  +++  ++ N+P     +   +  EAK    ++ Y +++K+
Sbjct: 92  GIPVFGPSAKAAQLEGSKGFSKDFMQRHNIPTARHKTF-ESYEEAKRHLEEVNYRVVLKA 150

Query: 784 TAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSG--VFMERFIENARHVEVQIMGDG 841
                G G+   E++++  +  + +  +    FGD+G  V +E F+E    + +  + DG
Sbjct: 151 DGVAAGKGVLIPENKEEALKALDVIMVE--KQFGDAGNTVVIEEFLE-GDEISILTISDG 207

>CAGL0L07634g complement(838412..841804) some similarities with
           sp|Q04263 Saccharomyces cerevisiae YML002w, hypothetical
           start
          Length = 1130

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 7/78 (8%)

Query: 303 LELARCLYEGPWVAERYSAVKDFLQKNPSSKGFDHVVKSIIDSAKKFSAVDAFQFEYKRQ 362
           LE   C +E     E Y  + DF   N      + +VK ++ S KK+    A  F  K +
Sbjct: 451 LEAVVCYFEQLKEKENYRKLIDFCNSN------ERLVK-VLSSTKKYETNAALYFLRKYE 503

Query: 363 GLLQKIDKLLENIDALCV 380
           G L+  D L +++ ALC+
Sbjct: 504 GSLRYRDSLGQSLLALCI 521

>YKL162C (YKL162C) [3108] chr11 complement(147635..148843) Protein of
            unknown function [1209 bp, 402 aa]
          Length = 402

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 5/92 (5%)

Query: 1003 PEYDPTLAK-IIVHGKDRHDALEKLNKALVETK----VSGCITNIDYLRSISSSEMFRDA 1057
            P++   LAK ++V+ K        LN   + T     +  C   + YL+S  S  MF+  
Sbjct: 86   PQFSKCLAKWLLVNYKLNDYPYYDLNIVNIYTDLPQAIQICKNLMSYLKSTLSDNMFQKI 145

Query: 1058 KVSTNILNSYDYKPSAMEIILPGSHTSIQDYP 1089
            K     L   D  PS +   +PGS + +QDYP
Sbjct: 146  KYFMVPLYKCDKIPSKLLDGIPGSVSLVQDYP 177

>AGR068W [4378] [Homologous to ScYLR100W (ERG27) - SH]
            complement(845794..846840) [1047 bp, 348 aa]
          Length = 348

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 9/107 (8%)

Query: 1589 FLGSPCAVPLDPRHRLLGSKYNPSRTFTERGAVGLGGMFMCIYAASSPGGYQLMGRTIPI 1648
            +LG+  AV  DP    L +  NP+      G     G+ + ++ A+  G Y L+ R IP 
Sbjct: 114  WLGATKAVLRDP----LDAVTNPTYKIQRVGVKSRDGLGL-VFQANVFGPYYLIRRIIP- 167

Query: 1649 WDKLLLLSSSEQPWLLNPFDQIEFYPVSEKELDRLTDDFDYGKYIVD 1695
               LL    ++  WL +    +++  + + EL R    ++  K +VD
Sbjct: 168  ---LLAKGKAKVVWLSSLMSDVKYLSLEDVELLRTDSSYEGSKRLVD 211

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.137    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 61,551,617
Number of extensions: 2834919
Number of successful extensions: 7147
Number of sequences better than 10.0: 72
Number of HSP's gapped: 7189
Number of HSP's successfully gapped: 105
Length of query: 1834
Length of database: 16,596,109
Length adjustment: 116
Effective length of query: 1718
Effective length of database: 12,580,421
Effective search space: 21613163278
Effective search space used: 21613163278
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)