Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_721.13335935919200.0
YKL114C (APN1)36736013920.0
CAGL0K11528g35435913770.0
Kwal_26.768536036012721e-176
KLLA0C14256g36832112091e-166
ABL054C35935811991e-165
Kwal_55.2079352096720.65
CAGL0K09834g132054710.87
Sklu_2283.4106044691.8
YJL061W (NUP82)71386663.8
Kwal_55.2178632749645.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_721.133
         (359 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_721.133                                                          744   0.0  
YKL114C (APN1) [3149] chr11 complement(222998..224101) AP endonu...   540   0.0  
CAGL0K11528g 1116427..1117491 highly similar to sp|P22936 Saccha...   535   0.0  
Kwal_26.7685                                                          494   e-176
KLLA0C14256g 1239373..1240479 similar to sp|P22936 Saccharomyces...   470   e-166
ABL054C [538] [Homologous to ScYKL114C (APN1) - SH] (297682..298...   466   e-165
Kwal_55.20793                                                          32   0.65 
CAGL0K09834g complement(960064..964026) similar to sp|P53935 Sac...    32   0.87 
Sklu_2283.4 YLR336C, Contig c2283 3943-7125                            31   1.8  
YJL061W (NUP82) [2850] chr10 (319932..322073) Nuclear pore prote...    30   3.8  
Kwal_55.21786                                                          29   5.5  

>Scas_721.133
          Length = 359

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/359 (100%), Positives = 359/359 (100%)

Query: 1   MSKFIRSTTSKYKFGAHMSGAGGISNSVLNAHNTGCNAFAMFLKSPRKWVSPAFTKEEIA 60
           MSKFIRSTTSKYKFGAHMSGAGGISNSVLNAHNTGCNAFAMFLKSPRKWVSPAFTKEEIA
Sbjct: 1   MSKFIRSTTSKYKFGAHMSGAGGISNSVLNAHNTGCNAFAMFLKSPRKWVSPAFTKEEIA 60

Query: 61  KFNDNCEKFNYNPLTDILPHGHYLINLANPDLEKVDKSYESFLDDLKRCESLGIGLYNFH 120
           KFNDNCEKFNYNPLTDILPHGHYLINLANPDLEKVDKSYESFLDDLKRCESLGIGLYNFH
Sbjct: 61  KFNDNCEKFNYNPLTDILPHGHYLINLANPDLEKVDKSYESFLDDLKRCESLGIGLYNFH 120

Query: 121 PGSVLKGDRQVQLKQLAQFLNRAIKETKFVKILLENMAGTGNLVGSNLKDLHDVIEMVED 180
           PGSVLKGDRQVQLKQLAQFLNRAIKETKFVKILLENMAGTGNLVGSNLKDLHDVIEMVED
Sbjct: 121 PGSVLKGDRQVQLKQLAQFLNRAIKETKFVKILLENMAGTGNLVGSNLKDLHDVIEMVED 180

Query: 181 KTRIGVCVDTCHTFAAGYDISNQESFDKFWKDFDSIIGLKYLHAMHLNDSKAPLGANRDL 240
           KTRIGVCVDTCHTFAAGYDISNQESFDKFWKDFDSIIGLKYLHAMHLNDSKAPLGANRDL
Sbjct: 181 KTRIGVCVDTCHTFAAGYDISNQESFDKFWKDFDSIIGLKYLHAMHLNDSKAPLGANRDL 240

Query: 241 HEKLGEGFLGLEVFRIIAHADHLRGIPIILETPQPDEEGYGHEIKLLEWLESVENPEDQE 300
           HEKLGEGFLGLEVFRIIAHADHLRGIPIILETPQPDEEGYGHEIKLLEWLESVENPEDQE
Sbjct: 241 HEKLGEGFLGLEVFRIIAHADHLRGIPIILETPQPDEEGYGHEIKLLEWLESVENPEDQE 300

Query: 301 LITKSEEKQQLGSKSRKEQLSKWEIKQKKATKVPRKRKTASSEGADIAAQLTNSKKAKK 359
           LITKSEEKQQLGSKSRKEQLSKWEIKQKKATKVPRKRKTASSEGADIAAQLTNSKKAKK
Sbjct: 301 LITKSEEKQQLGSKSRKEQLSKWEIKQKKATKVPRKRKTASSEGADIAAQLTNSKKAKK 359

>YKL114C (APN1) [3149] chr11 complement(222998..224101) AP
           endonuclease, DNA (apurinic or apyrimidinic site) lyase
           (3'-repair diesterase) [1104 bp, 367 aa]
          Length = 367

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/360 (70%), Positives = 302/360 (83%), Gaps = 4/360 (1%)

Query: 4   FIRSTTSKYKFGAHMSGAGGISNSVLNAHNTGCNAFAMFLKSPRKWVSPAFTKEEIAKFN 63
           F+RS  SKYKFGAHMSGAGGISNSV NA NTGCN+FAMFLKSPRKWVSP +T+EEI KF 
Sbjct: 7   FVRSAVSKYKFGAHMSGAGGISNSVTNAFNTGCNSFAMFLKSPRKWVSPQYTQEEIDKFK 66

Query: 64  DNCEKFNYNPLTDILPHGHYLINLANPDLEKVDKSYESFLDDLKRCESLGIGLYNFHPGS 123
            NC  +NYNPLTD+LPHG Y INLANPD EK +KSYESF+DDL RCE LGIGLYN HPGS
Sbjct: 67  KNCATYNYNPLTDVLPHGQYFINLANPDREKAEKSYESFMDDLNRCEQLGIGLYNLHPGS 126

Query: 124 VLKGDRQVQLKQLAQFLNRAIKETKFVKILLENMAGTGNLVGSNLKDLHDVIEMVEDKTR 183
            LKGD Q+QLKQLA +LN+AIKETKFVKI+LENMAGTGNLVGS+L DL +VI M+EDK+R
Sbjct: 127 TLKGDHQLQLKQLASYLNKAIKETKFVKIVLENMAGTGNLVGSSLVDLKEVIGMIEDKSR 186

Query: 184 IGVCVDTCHTFAAGYDISNQESFDKFWKDFDSIIGLKYLHAMHLNDSKAPLGANRDLHEK 243
           IGVC+DTCHTFAAGYDIS  E+F+ FWK+F+ +IG KYL A+HLNDSKAPLGANRDLHE+
Sbjct: 187 IGVCIDTCHTFAAGYDISTTETFNNFWKEFNDVIGFKYLSAVHLNDSKAPLGANRDLHER 246

Query: 244 LGEGFLGLEVFRIIAHADHLRGIPIILETPQPDEEGYGHEIKLLEWLES---VENPEDQE 300
           LG+G+LG++VFR+IAH+++L+GIPI+LETP  ++EGYG+EIKL+EWLES    E  ED+E
Sbjct: 247 LGQGYLGIDVFRMIAHSEYLQGIPIVLETPYENDEGYGNEIKLMEWLESKSESELLEDKE 306

Query: 301 LITKSEEKQQLGSKSRKEQLSKWEIKQKK-ATKVPRKRKTASSEGADIAAQLTNSKKAKK 359
              K++  Q+LG+KSRKEQL K+E+KQKK A    RK+ TA     DI +Q+T  +K KK
Sbjct: 307 YKEKNDTLQKLGAKSRKEQLDKFEVKQKKRAGGTKRKKATAEPSDNDILSQMTKKRKTKK 366

>CAGL0K11528g 1116427..1117491 highly similar to sp|P22936
           Saccharomyces cerevisiae YKL114c APN1 AP endonuclease,
           hypothetical start
          Length = 354

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/359 (71%), Positives = 300/359 (83%), Gaps = 8/359 (2%)

Query: 1   MSKFIRSTTSKYKFGAHMSGAGGISNSVLNAHNTGCNAFAMFLKSPRKWVSPAFTKEEIA 60
           MS F RST SKYKFGAHMSGAGGISNSV NA N GCN+FAMFLKSPRKWVSPAFT+EEIA
Sbjct: 1   MSTFARSTVSKYKFGAHMSGAGGISNSVTNAFNAGCNSFAMFLKSPRKWVSPAFTQEEIA 60

Query: 61  KFNDNCEKFNYNPLTDILPHGHYLINLANPDLEKVDKSYESFLDDLKRCESLGIGLYNFH 120
           KF +NCEK+ YNPLTDILPHG Y INLANPD EK +KSYESF+DDL RCE LG+GLYNFH
Sbjct: 61  KFKENCEKYGYNPLTDILPHGQYFINLANPDPEKAEKSYESFIDDLTRCEQLGVGLYNFH 120

Query: 121 PGSVLKGDRQVQLKQLAQFLNRAIKETKFVKILLENMAGTGNLVGSNLKDLHDVIEMVED 180
           PGS LKGD   QLKQLA ++N+A+ ETKFVKI+LENMAGTGNLVGS+L DL  VI+MV D
Sbjct: 121 PGSTLKGDHDEQLKQLASYINKALGETKFVKIVLENMAGTGNLVGSDLTDLRKVIDMVTD 180

Query: 181 KTRIGVCVDTCHTFAAGYDISNQESFDKFWKDFDSIIGLKYLHAMHLNDSKAPLGANRDL 240
           K+RIGVC+DTCHTFAAGYDI ++++FDKFWKDFD IIG KYL ++HLNDSKAPLGANRDL
Sbjct: 181 KSRIGVCIDTCHTFAAGYDIQSKDAFDKFWKDFDDIIGYKYLASVHLNDSKAPLGANRDL 240

Query: 241 HEKLGEGFLGLEVFRIIAHADHLRGIPIILETPQPDEEGYGHEIKLLEWLESVENPED-- 298
           HEKLGEG+LGL+ FR +AH DHL+GIPI+LETPQPD+ GY  E+KLLEWLE++E+ +   
Sbjct: 241 HEKLGEGYLGLDFFRNLAHYDHLKGIPIVLETPQPDDAGYAKEVKLLEWLETIEDGDTDK 300

Query: 299 -QELITKSEEKQQLGSKSRKEQLSKWEIKQKKATKVPRKRKTASSEGADIAAQLTNSKK 356
            +E+  K+EE Q+LG KSRKEQ+SK+E K+   T     +K  ++  ADI AQL  +KK
Sbjct: 301 LKEMEAKNEELQKLGEKSRKEQMSKFEKKKTTTT-----KKRKATGAADITAQLKKAKK 354

>Kwal_26.7685
          Length = 360

 Score =  494 bits (1272), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 236/360 (65%), Positives = 292/360 (81%), Gaps = 3/360 (0%)

Query: 1   MSKFIRSTTSKYKFGAHMSGAGGISNSVLNAHNTGCNAFAMFLKSPRKWVSPAFTKEEIA 60
           MS+F R ++SKYKFGAH+S AGGISNSV NA N GCNAFAMFLKSPRKWVSP +++EEI 
Sbjct: 1   MSQFTRCSSSKYKFGAHISTAGGISNSVTNAFNIGCNAFAMFLKSPRKWVSPDYSQEEIE 60

Query: 61  KFNDNCEKFNYNPLTDILPHGHYLINLANPDLEKVDKSYESFLDDLKRCESLGIGLYNFH 120
           KF +NC++  YNPLTD+LPHG Y INLANP+ EK +KSY SF+DDL+RCE LG+GLYNFH
Sbjct: 61  KFKENCKELGYNPLTDVLPHGQYFINLANPEHEKAEKSYASFIDDLRRCEQLGVGLYNFH 120

Query: 121 PGSVLKGDRQVQLKQLAQFLNRAIKETKFVKILLENMAGTGNLVGSNLKDLHDVIEMVED 180
           PGS LK D   QL+QLA ++N+AI ET FVKI+LENMAGTG LVGS L DL +VI++V+D
Sbjct: 121 PGSSLKADHPTQLRQLASYINKAISETSFVKIVLENMAGTGTLVGSELSDLKEVIDLVDD 180

Query: 181 KTRIGVCVDTCHTFAAGYDISNQESFDKFWKDFDSIIGLKYLHAMHLNDSKAPLGANRDL 240
           K+R+GVC+DTCHTFAAGYDIS++E+FDKFW+ FD  IG KYL A+HLNDSKAPL ANRDL
Sbjct: 181 KSRVGVCIDTCHTFAAGYDISSKEAFDKFWQLFDETIGFKYLAAIHLNDSKAPLAANRDL 240

Query: 241 HEKLGEGFLGLEVFRIIAHADHLRGIPIILETPQPDEEGYGHEIKLLEWLESVENPED-Q 299
           HEKLGEGF+GLE+F+++A +D L+GIPIILETP   +EGYGHEIKLLEWLE+ +   D  
Sbjct: 241 HEKLGEGFIGLEIFKLVAQSDFLKGIPIILETPHTKDEGYGHEIKLLEWLENFKEDTDLA 300

Query: 300 ELITKSEEKQQLGSKSRKEQLSKWEIKQKKATKVPRKRKTASSEGADIAAQLTNSKKAKK 359
           E  +K+++    G+KSR EQ +K++ K+   T    K++ A+S G DIA Q+  SKKAKK
Sbjct: 301 EFESKAQDLLSKGAKSRDEQAAKFDKKKSTKTTKGGKKR-ANSAGPDIAQQMM-SKKAKK 358

>KLLA0C14256g 1239373..1240479 similar to sp|P22936 Saccharomyces
           cerevisiae YKL114c APN1 AP endonuclease singleton, start
           by similarity
          Length = 368

 Score =  470 bits (1209), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 216/321 (67%), Positives = 264/321 (82%)

Query: 4   FIRSTTSKYKFGAHMSGAGGISNSVLNAHNTGCNAFAMFLKSPRKWVSPAFTKEEIAKFN 63
           F+RSTTSK+KFGAH+SGAGGISNSV NAH  GCN+FAMFLKSPR+W S  + + EI KFN
Sbjct: 16  FVRSTTSKFKFGAHVSGAGGISNSVTNAHEIGCNSFAMFLKSPRQWNSKPYPESEITKFN 75

Query: 64  DNCEKFNYNPLTDILPHGHYLINLANPDLEKVDKSYESFLDDLKRCESLGIGLYNFHPGS 123
           +NC K +Y+P TDILPHG Y INL NPD EK +K+Y++FLDDL RCE LGIG YNFHPGS
Sbjct: 76  ENCAKLSYDPKTDILPHGSYFINLGNPDHEKAEKAYDAFLDDLVRCEQLGIGHYNFHPGS 135

Query: 124 VLKGDRQVQLKQLAQFLNRAIKETKFVKILLENMAGTGNLVGSNLKDLHDVIEMVEDKTR 183
            L GD   QLKQLA ++N+AI +TKFV I+LENMAG GNL+GSNL+DL  VI+M+EDK R
Sbjct: 136 SLDGDHDTQLKQLAGYINKAINDTKFVNIVLENMAGHGNLIGSNLEDLKTVIDMIEDKNR 195

Query: 184 IGVCVDTCHTFAAGYDISNQESFDKFWKDFDSIIGLKYLHAMHLNDSKAPLGANRDLHEK 243
           +GVCVDTCHT+AAGYDIS + +FD+FWK FD+IIG KYL A+HLNDSKAPL AN D HE 
Sbjct: 196 VGVCVDTCHTYAAGYDISTKNAFDQFWKKFDAIIGFKYLKAIHLNDSKAPLAANADRHEI 255

Query: 244 LGEGFLGLEVFRIIAHADHLRGIPIILETPQPDEEGYGHEIKLLEWLESVENPEDQELIT 303
           LG+GFLGLEVF+IIAH++ L+GIPI+LETPQ ++ GYG EIKLLEWLE+++  E+++ I 
Sbjct: 256 LGQGFLGLEVFKIIAHSEFLQGIPIVLETPQKEDAGYGEEIKLLEWLETIDEEENKDYIE 315

Query: 304 KSEEKQQLGSKSRKEQLSKWE 324
           K     +LG KSRKE  +K++
Sbjct: 316 KRLALNKLGEKSRKEFQAKFD 336

>ABL054C [538] [Homologous to ScYKL114C (APN1) - SH]
           (297682..298761) [1080 bp, 359 aa]
          Length = 359

 Score =  466 bits (1199), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 226/358 (63%), Positives = 282/358 (78%), Gaps = 4/358 (1%)

Query: 4   FIRSTTSKYKFGAHMSGAGGISNSVLNAHNTGCNAFAMFLKSPRKWVSPAFTKEEIAKFN 63
           F+R T S+YKFGAH+SGAGGISNSV+NAH  GCNAFAMFLKSP++WVS A++ EEI +F+
Sbjct: 3   FVRCTASRYKFGAHVSGAGGISNSVVNAHRIGCNAFAMFLKSPKQWVSKAYSAEEIKRFH 62

Query: 64  DNCEKFNYNPLTDILPHGHYLINLANPDLEKVDKSYESFLDDLKRCESLGIGLYNFHPGS 123
           DNCE+  YNP TD+LPHG Y INLANPD EK +K+Y +FLDDL+RCE LGIGLYNFHPGS
Sbjct: 63  DNCEELGYNPRTDVLPHGLYFINLANPDREKAEKAYGAFLDDLQRCEQLGIGLYNFHPGS 122

Query: 124 VLKGDRQVQLKQLAQFLNRAIKETKFVKILLENMAGTGNLVGSNLKDLHDVIEMVEDKTR 183
            LKG+   QL+QLA ++NRAI ETKFVKI+LENMAG GN++GS L+DL  VI++VE K R
Sbjct: 123 ALKGEYDAQLRQLAMYINRAISETKFVKIVLENMAGHGNIIGSKLEDLRTVIDLVEQKDR 182

Query: 184 IGVCVDTCHTFAAGYDISNQESFDKFWKDFDSIIGLKYLHAMHLNDSKAPLGANRDLHEK 243
           +GVCVDTCHTFAAGYDI ++ +FD FW  F + +G++YL +MH+NDSKAPL AN D HE 
Sbjct: 183 VGVCVDTCHTFAAGYDIRSRAAFDSFWDKFRTTLGMQYLASMHINDSKAPLAANADRHEL 242

Query: 244 LGEGFLGLEVFRIIAHADHLRGIPIILETPQPDEEGYGHEIKLLEWLESVENPE--DQEL 301
           LG+GFLGLE FR+IA +D L+ IPIILETPQ +++GYG EIK+LEWLE V++     QE 
Sbjct: 243 LGQGFLGLEAFRLIARSDFLQNIPIILETPQKEDDGYGEEIKMLEWLEGVDDEAALQQEY 302

Query: 302 ITKSEEKQQLGSKSRKEQLSKWEIKQKKATKVPRKRKTASSEGADIAAQLTNSKKAKK 359
             K  E QQ G+KSR+E  +K+E K+ KA K    RK A+ + ADI +Q+   K A+K
Sbjct: 303 KDKCAELQQRGAKSRQEFAAKFEKKKAKAEKATGSRKRAAGQ-ADIVSQM-GRKAARK 358

>Kwal_55.20793
          Length = 520

 Score = 32.3 bits (72), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 39/96 (40%), Gaps = 4/96 (4%)

Query: 57  EEIAKFNDNCEKFNYNPLTDILPHGHYLINLANP----DLEKVDKSYESFLDDLKRCESL 112
           E +    DNC  F   P++  L   H L  LA+     D+   + S+  F  DLK    L
Sbjct: 4   ELLKYLADNCATFMAVPISGDLSIIHVLFALASNQEFNDIGSQNASFVQFWRDLKYIADL 63

Query: 113 GIGLYNFHPGSVLKGDRQVQLKQLAQFLNRAIKETK 148
             G  +F P +V  G    Q  ++      A+K  +
Sbjct: 64  CPGSMSFQPNAVDSGAVSQQDAKIEHIDTDALKAIR 99

>CAGL0K09834g complement(960064..964026) similar to sp|P53935
           Saccharomyces cerevisiae YNL091w, start by similarity
          Length = 1320

 Score = 32.0 bits (71), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 6/54 (11%)

Query: 57  EEIAKFNDNCEKFNYNPLTDILPHGHYLINLANPDLEKVDKSYESFLDDLKRCE 110
           EE  +++   EK+NY+       HG     +A+ D + +D+ YES +DD++R E
Sbjct: 566 EENLQYDTPQEKYNYSD------HGKDHGTIADEDEDSIDEGYESSIDDMERLE 613

>Sklu_2283.4 YLR336C, Contig c2283 3943-7125
          Length = 1060

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 29/44 (65%), Gaps = 3/44 (6%)

Query: 122 GSVLKGDRQVQLKQ-LAQFLN--RAIKETKFVKILLENMAGTGN 162
           G +++GD  + LK+ L+Q LN  ++IK+T  +K LLE M+   N
Sbjct: 651 GQLIRGDDPMALKEILSQLLNNVKSIKQTPRMKFLLETMSDLKN 694

>YJL061W (NUP82) [2850] chr10 (319932..322073) Nuclear pore protein
           (nucleoporin), required for export of poly(A)+ RNA,
           functions as a component of Nup82p-Nup159p-Nsp1p complex
           in export of pre-40S and pre-60S ribosomal particles
           [2142 bp, 713 aa]
          Length = 713

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 39/86 (45%), Gaps = 6/86 (6%)

Query: 53  AFTK--EEIAKFNDNCEKFNYNPLTDILPHGHYLINLANP----DLEKVDKSYESFLDDL 106
           +FT+   EI   NDN +K   +P   I+P     I L N      LE      + FL  +
Sbjct: 480 SFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQRI 539

Query: 107 KRCESLGIGLYNFHPGSVLKGDRQVQ 132
            + ++LG+ ++N       +  RQ+Q
Sbjct: 540 VKAQTLGVSIHNRIHEQQFELTRQLQ 565

>Kwal_55.21786
          Length = 327

 Score = 29.3 bits (64), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 51  SPAF--TKEEIAKFNDNCEKFNYNPLTDILPHGHYLINLANPDLEKVDK 97
           SPA   T++EIA++N+  EK +   L  +      L+N+   +L+ V+K
Sbjct: 200 SPAIETTEQEIAQYNEAVEKLSQQQLQILEAEHDNLLNIKTQELQNVEK 248

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,587,259
Number of extensions: 599707
Number of successful extensions: 2818
Number of sequences better than 10.0: 80
Number of HSP's gapped: 2723
Number of HSP's successfully gapped: 104
Length of query: 359
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 256
Effective length of database: 13,030,455
Effective search space: 3335796480
Effective search space used: 3335796480
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)