Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_721.1312381246733e-89
CAGL0K11572g2181224993e-63
Sklu_2430.141681224667e-59
ABL057W2341224682e-58
YKL117W (SBA1)2161244654e-58
Kwal_26.76772021224592e-57
Scas_254.1*1371224281e-53
KLLA0C14322g1841203842e-46
Kwal_47.1923667034671.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_721.131
         (238 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_721.131                                                          263   3e-89
CAGL0K11572g complement(1120136..1120792) similar to sp|P28707 S...   196   3e-63
Sklu_2430.14 YKL117W, Contig c2430 26534-27040                        184   7e-59
ABL057W [535] [Homologous to ScYKL117W (SBA1) - SH] complement(2...   184   2e-58
YKL117W (SBA1) [3147] chr11 (219970..220620) Ste5p-associated pr...   183   4e-58
Kwal_26.7677                                                          181   2e-57
Scas_254.1*                                                           169   1e-53
KLLA0C14322g complement(1243993..1244547) similar to sp|P28707 S...   152   2e-46
Kwal_47.19236                                                          30   1.6  

>Scas_721.131
          Length = 238

 Score =  263 bits (673), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 124/124 (100%), Positives = 124/124 (100%)

Query: 1   MASKILTPEVRWAQRSNETDSEKNYLLITVTIPDCEEPKLDLQSTFFELTALSKGHVGDE 60
           MASKILTPEVRWAQRSNETDSEKNYLLITVTIPDCEEPKLDLQSTFFELTALSKGHVGDE
Sbjct: 1   MASKILTPEVRWAQRSNETDSEKNYLLITVTIPDCEEPKLDLQSTFFELTALSKGHVGDE 60

Query: 61  ATHQYKLHIDFFKEVVPEKSVGRVANGQHYFLKIFKKDLGLEYWPRLTKEKVKYNYIKTD 120
           ATHQYKLHIDFFKEVVPEKSVGRVANGQHYFLKIFKKDLGLEYWPRLTKEKVKYNYIKTD
Sbjct: 61  ATHQYKLHIDFFKEVVPEKSVGRVANGQHYFLKIFKKDLGLEYWPRLTKEKVKYNYIKTD 120

Query: 121 FDKW 124
           FDKW
Sbjct: 121 FDKW 124

 Score = 51.6 bits (122), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 26/44 (59%)

Query: 195 KTPSMEELQKILAQHGGAPXXXXXXXXXXXXXXXXXXSHAEPVA 238
           KTPSMEELQKILAQHGGAP                  SHAEPVA
Sbjct: 195 KTPSMEELQKILAQHGGAPGADDGKDSDSEEEADKDESHAEPVA 238

>CAGL0K11572g complement(1120136..1120792) similar to sp|P28707
           Saccharomyces cerevisiae YKL117w SBA1 Hsp90 Associated
           Co-chaperone, hypothetical start
          Length = 218

 Score =  196 bits (499), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 108/122 (88%)

Query: 3   SKILTPEVRWAQRSNETDSEKNYLLITVTIPDCEEPKLDLQSTFFELTALSKGHVGDEAT 62
           SK+LTPEV WAQRS+E+D+EKNYLLITV+IPDCE P++ +++   +L A S+GHVGDE  
Sbjct: 2   SKVLTPEVAWAQRSSESDAEKNYLLITVSIPDCESPEVKIEAGSLDLEAQSRGHVGDEHK 61

Query: 63  HQYKLHIDFFKEVVPEKSVGRVANGQHYFLKIFKKDLGLEYWPRLTKEKVKYNYIKTDFD 122
           H YKLHIDF+K++VPEKS+ ++ANGQHYFLK+FKKDL LEYWPRLTKEK+KY+ IKTDFD
Sbjct: 62  HTYKLHIDFYKDIVPEKSLHKIANGQHYFLKLFKKDLELEYWPRLTKEKIKYSNIKTDFD 121

Query: 123 KW 124
           KW
Sbjct: 122 KW 123

>Sklu_2430.14 YKL117W, Contig c2430 26534-27040
          Length = 168

 Score =  184 bits (466), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 79/122 (64%), Positives = 104/122 (85%)

Query: 3   SKILTPEVRWAQRSNETDSEKNYLLITVTIPDCEEPKLDLQSTFFELTALSKGHVGDEAT 62
           SK++TPEV WAQRS+++D ++NYLL+T+ + DCE PKLDL+  + E TA S GHVGDE+ 
Sbjct: 2   SKVITPEVLWAQRSSDSDPKRNYLLLTIGVRDCESPKLDLKPGYLEFTANSPGHVGDESA 61

Query: 63  HQYKLHIDFFKEVVPEKSVGRVANGQHYFLKIFKKDLGLEYWPRLTKEKVKYNYIKTDFD 122
           H Y+LHIDF+K+++PE S+ +VANGQ YFLK++KKDL  EYWPRLTKEK+KY++IKTDFD
Sbjct: 62  HSYRLHIDFYKDIIPEDSLNKVANGQDYFLKLYKKDLDSEYWPRLTKEKLKYHFIKTDFD 121

Query: 123 KW 124
           KW
Sbjct: 122 KW 123

>ABL057W [535] [Homologous to ScYKL117W (SBA1) - SH]
           complement(293539..294243) [705 bp, 234 aa]
          Length = 234

 Score =  184 bits (468), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 85/122 (69%), Positives = 102/122 (83%)

Query: 3   SKILTPEVRWAQRSNETDSEKNYLLITVTIPDCEEPKLDLQSTFFELTALSKGHVGDEAT 62
           SK +TPEV WAQRS+ETD +KNY+L+T+ IPDCEEPKL L+ST  E +A S GH G++  
Sbjct: 2   SKTITPEVHWAQRSHETDEDKNYVLLTLVIPDCEEPKLKLESTSLEFSARSPGHTGEKDG 61

Query: 63  HQYKLHIDFFKEVVPEKSVGRVANGQHYFLKIFKKDLGLEYWPRLTKEKVKYNYIKTDFD 122
           H Y+LHIDFFKE+ PEKS  RVANGQ Y+LK+ KK+LG EYWPRLTKEK+KY+YIKTDFD
Sbjct: 62  HTYQLHIDFFKEIDPEKSQHRVANGQGYYLKLVKKELGKEYWPRLTKEKLKYHYIKTDFD 121

Query: 123 KW 124
           KW
Sbjct: 122 KW 123

>YKL117W (SBA1) [3147] chr11 (219970..220620) Ste5p-associated
           protein, putative cochaperone with Hsp90 family proteins
           (Hsp82p, Hsc82p) [651 bp, 216 aa]
          Length = 216

 Score =  183 bits (465), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 103/124 (83%)

Query: 1   MASKILTPEVRWAQRSNETDSEKNYLLITVTIPDCEEPKLDLQSTFFELTALSKGHVGDE 60
           M+ K++ P+V WAQRS+ TD E+NY+LITV+I DC+ P+L ++ ++ EL A SK HVGDE
Sbjct: 1   MSDKVINPQVAWAQRSSTTDPERNYVLITVSIADCDAPELTIKPSYIELKAQSKPHVGDE 60

Query: 61  ATHQYKLHIDFFKEVVPEKSVGRVANGQHYFLKIFKKDLGLEYWPRLTKEKVKYNYIKTD 120
             H Y+LHID +KE++PEK++ +VANGQHYFLK++KKDL  EYWPRLTKEKVKY YIKTD
Sbjct: 61  NVHHYQLHIDLYKEIIPEKTMHKVANGQHYFLKLYKKDLESEYWPRLTKEKVKYPYIKTD 120

Query: 121 FDKW 124
           FDKW
Sbjct: 121 FDKW 124

>Kwal_26.7677
          Length = 202

 Score =  181 bits (459), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 100/122 (81%)

Query: 3   SKILTPEVRWAQRSNETDSEKNYLLITVTIPDCEEPKLDLQSTFFELTALSKGHVGDEAT 62
           S  LTPEV WAQRS+++D+EKNYLL+T+ IPDC EP LDL ST  E  A S GH GDE  
Sbjct: 2   SSTLTPEVLWAQRSSDSDAEKNYLLVTIVIPDCSEPTLDLTSTHLEFKAKSPGHTGDEQE 61

Query: 63  HQYKLHIDFFKEVVPEKSVGRVANGQHYFLKIFKKDLGLEYWPRLTKEKVKYNYIKTDFD 122
           HQYKL IDF+KE+  EKS+ RVANG++YFLK++KK+L  EYWPRLTKEK+KY+YIKTDF+
Sbjct: 62  HQYKLRIDFYKEIDAEKSLSRVANGRNYFLKLYKKELESEYWPRLTKEKLKYHYIKTDFN 121

Query: 123 KW 124
           KW
Sbjct: 122 KW 123

>Scas_254.1*
          Length = 137

 Score =  169 bits (428), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 73/122 (59%), Positives = 100/122 (81%)

Query: 3   SKILTPEVRWAQRSNETDSEKNYLLITVTIPDCEEPKLDLQSTFFELTALSKGHVGDEAT 62
           SK++TPEV WAQRS+++D ++NYLL+T+ + DCE PKLDL+  + E TA S GHVGDE+ 
Sbjct: 2   SKVITPEVLWAQRSSDSDPKRNYLLLTIGVRDCESPKLDLKPGYLEFTANSPGHVGDESA 61

Query: 63  HQYKLHIDFFKEVVPEKSVGRVANGQHYFLKIFKKDLGLEYWPRLTKEKVKYNYIKTDFD 122
           H Y+LHIDF+K+++PE S+ ++   +  FLK++KKDL  EYWPRLTKEK+KY++IKTDFD
Sbjct: 62  HSYRLHIDFYKDIIPEDSLTKLLMARTTFLKLYKKDLDSEYWPRLTKEKLKYHFIKTDFD 121

Query: 123 KW 124
           KW
Sbjct: 122 KW 123

>KLLA0C14322g complement(1243993..1244547) similar to sp|P28707
           Saccharomyces cerevisiae YKL117w SBA1 Hsp90 (Ninety)
           Associated Co-chaperone singleton, start by similarity
          Length = 184

 Score =  152 bits (384), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 74/120 (61%), Positives = 89/120 (74%), Gaps = 2/120 (1%)

Query: 5   ILTPEVRWAQRSNETDSEKNYLLITVTIPDCEEPKLDLQSTFFELTALSKGHVGDEATHQ 64
           + TPEV WAQRS+E+D  KN L IT+ IPDC  PK++L     E +ALSK H  D    +
Sbjct: 3   VHTPEVLWAQRSSESDDTKNNLFITINIPDCTNPKMELTENSLEFSALSKYHSKDGI--K 60

Query: 65  YKLHIDFFKEVVPEKSVGRVANGQHYFLKIFKKDLGLEYWPRLTKEKVKYNYIKTDFDKW 124
           Y LHIDF+K +  E S  RVANG++YFL + KKDLGLEYWPRLTKEK+KY+YIKTDFDKW
Sbjct: 61  YHLHIDFYKPIDTENSEQRVANGRNYFLVLRKKDLGLEYWPRLTKEKLKYHYIKTDFDKW 120

>Kwal_47.19236
          Length = 670

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 2/34 (5%)

Query: 47  FELTALSKGH--VGDEATHQYKLHIDFFKEVVPE 78
           F LT L + H  VGDE  ++YK H D F +VV +
Sbjct: 481 FRLTDLGRQHGVVGDERWNRYKAHRDIFLKVVSQ 514

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,255,071
Number of extensions: 191656
Number of successful extensions: 455
Number of sequences better than 10.0: 10
Number of HSP's gapped: 454
Number of HSP's successfully gapped: 11
Length of query: 238
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 139
Effective length of database: 13,168,927
Effective search space: 1830480853
Effective search space used: 1830480853
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)