Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_721.1302121937911e-108
Sklu_2430.122571934049e-49
YKL119C (VPH2)2151983886e-47
Kwal_26.76482021933469e-41
CAGL0K11594g2091643008e-34
KLLA0B12870g2051642266e-23
ABL021C239681005e-05
YBR247C (ENP1)48338642.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_721.130
         (212 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_721.130                                                          309   e-108
Sklu_2430.12 YKL119C, Contig c2430 21414-22187 reverse complement     160   9e-49
YKL119C (VPH2) [3146] chr11 complement(218216..218863) Vacuolar ...   154   6e-47
Kwal_26.7648                                                          137   9e-41
CAGL0K11594g 1121044..1121673 similar to sp|P32341 Saccharomyces...   120   8e-34
KLLA0B12870g complement(1123581..1124198) weakly similar to sp|P...    92   6e-23
ABL021C [571] [Homologous to ScYKL119C (VPH2) - SH] (358274..358...    43   5e-05
YBR247C (ENP1) [426] chr2 complement(712961..714412) Essential n...    29   2.5  

>Scas_721.130
          Length = 212

 Score =  309 bits (791), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 154/193 (79%), Positives = 154/193 (79%)

Query: 1   MFDIKLNVPXXXXXXXXXXXXXDPLRKEIDTLLNNGYIPMKTLLKYHSEYWKNQIPMRQL 60
           MFDIKLNVP             DPLRKEIDTLLNNGYIPMKTLLKYHSEYWKNQIPMRQL
Sbjct: 1   MFDIKLNVPLKEALGELKEKAKDPLRKEIDTLLNNGYIPMKTLLKYHSEYWKNQIPMRQL 60

Query: 61  LNPIEFQFKEKYQPGSTYSPXXXXXXXXXXXXXXXXDYQNMIKNERKTLQIIKEEGETLT 120
           LNPIEFQFKEKYQPGSTYSP                DYQNMIKNERKTLQIIKEEGETLT
Sbjct: 61  LNPIEFQFKEKYQPGSTYSPEFKKQLETLKLKQEELDYQNMIKNERKTLQIIKEEGETLT 120

Query: 121 PAQMNKQIKEQVTTIFNXXXXXXXXXXAIWYWTGTSAHMPVHYRLLLCIFTGILVLVAEV 180
           PAQMNKQIKEQVTTIFN          AIWYWTGTSAHMPVHYRLLLCIFTGILVLVAEV
Sbjct: 121 PAQMNKQIKEQVTTIFNIFVSVISVVFAIWYWTGTSAHMPVHYRLLLCIFTGILVLVAEV 180

Query: 181 VVYNSYLTKIDLA 193
           VVYNSYLTKIDLA
Sbjct: 181 VVYNSYLTKIDLA 193

>Sklu_2430.12 YKL119C, Contig c2430 21414-22187 reverse complement
          Length = 257

 Score =  160 bits (404), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 113/193 (58%), Gaps = 8/193 (4%)

Query: 1   MFDIKLNVPXXXXXXXXXXXXXDPLRKEIDTLLNNGYIPMKTLLKYHSEYWKNQIPMRQL 60
           MF+I+LN                P    ++ LL N  IP+K LL+YH EYW  + P+ +L
Sbjct: 54  MFEIQLN-----DELKELLNGIQPKECRVEELLQNDSIPIKLLLEYHLEYWSER-PISKL 107

Query: 61  LNPIEFQFKEKYQPGSTYSPXXXXXXXXXXXXXXXXDYQNMIKNERKTLQIIKEEGETLT 120
           L+P++F+FKEKY+ G  YS                 +YQ MIK  R  L  +KE  E LT
Sbjct: 108 LSPLKFKFKEKYERGVNYSEEFKRQLEHLKLQQEENEYQEMIK--RDGLGYLKENAEELT 165

Query: 121 PAQMNKQIKEQVTTIFNXXXXXXXXXXAIWYWTGTSAHMPVHYRLLLCIFTGILVLVAEV 180
           P+QM+KQI+EQ+TTIFN          AIWYW+ +S  +  H R+ LC+F G+LVLVAE+
Sbjct: 166 PSQMSKQIREQITTIFNILLSVVSVVWAIWYWSSSSTRIATHNRIFLCLFFGVLVLVAEI 225

Query: 181 VVYNSYLTKIDLA 193
           VVYNSYL KI+ A
Sbjct: 226 VVYNSYLKKIEEA 238

>YKL119C (VPH2) [3146] chr11 complement(218216..218863) Vacuolar
           H(+)-ATPase (V-ATPase) assembly protein acting in the
           endoplasmic reticulum [648 bp, 215 aa]
          Length = 215

 Score =  154 bits (388), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 85/198 (42%), Positives = 115/198 (58%), Gaps = 7/198 (3%)

Query: 1   MFDIKLN--VPXXXXXXXXXXXXXDPLRKEIDTLLNNGYIPMKTLLKYHSEYWKN---QI 55
           MF+IKLN  +              + + ++ID  L    IPM++LL Y  EY K+   Q 
Sbjct: 1   MFEIKLNDRITEFLRKFKNSAKSNEGIDEDIDLFLKRHAIPMQSLLFYVKEYRKDSDLQC 60

Query: 56  PMRQLLNPIEFQFKEKYQPGSTYSPXXXXXXXXXXXXXXXXDYQNMIKNERKTLQIIKEE 115
            +++LL P+EF+FK K   G  YS                 +YQ+M+K  +    +  +E
Sbjct: 61  SIKELLKPLEFEFKPKAVRGLHYSEDFKKKLEFLKYQEQELEYQSMVKRSKSVFSL--QE 118

Query: 116 GETLTPAQMNKQIKEQVTTIFNXXXXXXXXXXAIWYWTGTSAHMPVHYRLLLCIFTGILV 175
            + LTP+Q+NKQIKEQVTT+FN          AIWYWTG+S + PVH RLLLC+F GILV
Sbjct: 119 DDELTPSQINKQIKEQVTTVFNVLVSVISVVVAIWYWTGSSTNFPVHVRLLLCLFFGILV 178

Query: 176 LVAEVVVYNSYLTKIDLA 193
           LVA+VVVYNSYL K++ A
Sbjct: 179 LVADVVVYNSYLKKLEEA 196

>Kwal_26.7648
          Length = 202

 Score =  137 bits (346), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 108/193 (55%), Gaps = 9/193 (4%)

Query: 1   MFDIKLNVPXXXXXXXXXXXXXDPLRKEIDTLLNNGYIPMKTLLKYHSEYWKNQIPMRQL 60
           MF+IKLN                    E   +L+ G I MK+LL +  ++W++ + + +L
Sbjct: 1   MFEIKLNSKLTSQLALLADDG------EAKAILDKGSISMKSLLSFCEKHWQD-VAISEL 53

Query: 61  LNPIEFQFKEKYQPGSTYSPXXXXXXXXXXXXXXXXDYQNMIKNERKTLQIIKEEGETLT 120
           + P++F +K K + G+ YS                 +YQNM++  R  L +  ++ +  T
Sbjct: 54  VTPLDFVYKTKRERGAHYSEEFKLQLERLRLEQEESEYQNMVR--RDGLAVGLQDSDNQT 111

Query: 121 PAQMNKQIKEQVTTIFNXXXXXXXXXXAIWYWTGTSAHMPVHYRLLLCIFTGILVLVAEV 180
           PAQ+ KQ+KEQ+TT+FN          A+WYWTG+SA M    R+L C+F GILVLVAEV
Sbjct: 112 PAQITKQVKEQITTVFNILVSVVSVVFAVWYWTGSSAGMRPQSRVLFCLFGGILVLVAEV 171

Query: 181 VVYNSYLTKIDLA 193
           VVY+SYL K++ A
Sbjct: 172 VVYSSYLRKVEEA 184

>CAGL0K11594g 1121044..1121673 similar to sp|P32341 Saccharomyces
           cerevisiae YKL119c VPH2 H+-ATPase assembly protein,
           start by similarity
          Length = 209

 Score =  120 bits (300), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 65/164 (39%), Positives = 96/164 (58%), Gaps = 11/164 (6%)

Query: 32  LLNNGYIPMKTLLKYHSEYWKNQIPMRQLLNPIEFQFKEK--YQPGSTYSPXXXXXXXXX 89
           L+  G +P   L +     W +++ + + L+ +EF+FK++   +P    SP         
Sbjct: 36  LIERGSVPCGELAEL-CRAWGSEVSVSEALSGLEFKFKDRETRKP----SPEFQAQLARL 90

Query: 90  XXXXXXXDYQNMIKNERKTLQIIKEEGETLTPAQMNKQIKEQVTTIFNXXXXXXXXXXAI 149
                  +YQ ++KN  + L I  E     TPAQ+N++IKEQVTT+FN          AI
Sbjct: 91  RALQQEQEYQQIVKN--RDLAITTES--EATPAQINREIKEQVTTVFNIIISVISVVVAI 146

Query: 150 WYWTGTSAHMPVHYRLLLCIFTGILVLVAEVVVYNSYLTKIDLA 193
           WYW+ TSA + +H+R+ LC+F GILVLVAEVVVY+SYL+KI+ A
Sbjct: 147 WYWSRTSAGLAIHHRIFLCMFFGILVLVAEVVVYSSYLSKIEEA 190

>KLLA0B12870g complement(1123581..1124198) weakly similar to
           sp|P32341 Saccharomyces cerevisiae YKL119c VPH2
           H+-ATPase assembly protein singleton, start by
           similarity
          Length = 205

 Score = 91.7 bits (226), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 85/164 (51%), Gaps = 7/164 (4%)

Query: 33  LNNGYIPMKTLLKYHSEYWKNQ--IPMRQLLNPIEFQFKEKYQPGSTYSPXXXXXXXXXX 90
           L    I  + L + + ++W++   + M+QLL   + ++KEK  PG  YS           
Sbjct: 28  LQQNSISFELLSELYQQFWRDDATVSMKQLLKSGKLRYKEKRVPGEGYSESFKAELENLK 87

Query: 91  XXXXXXDYQNMIKNERKTLQIIKEEGETL-TPAQMNKQIKEQVTTIFNXXXXXXXXXXAI 149
                 +YQ M+K  R +L +     +   + AQ+NK+IKEQV+ + N          A+
Sbjct: 88  ALQQEKEYQEMLK--RDSLHLAGSTADKEPSIAQINKEIKEQVSAVVNVLLTVFGTIYAV 145

Query: 150 WYWTGTSAHMPVHYRLLLCIFTGILVLVAEVVVYNSYLTKIDLA 193
           WY T T     +H R+LLC+F+G+LVL A+V +YN Y  KI+ A
Sbjct: 146 WYVTRTG--WDIHVRVLLCLFSGLLVLTADVAMYNVYNRKIEEA 187

>ABL021C [571] [Homologous to ScYKL119C (VPH2) - SH]
           (358274..358993) [720 bp, 239 aa]
          Length = 239

 Score = 43.1 bits (100), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query: 126 KQIKEQVTTIFNXXXXXXXXXXAIWYWTGTSAHMPVHYRLLLCIFTGILVLVAEVVVYNS 185
           ++++EQ+  + N           +W W   +A +    R+LL +  G+  LVA+V +YN 
Sbjct: 157 REVREQLAAVANVVLTVVGVAYGVW-WVARAAGVGAEARVLLALGCGLTALVADVAMYNV 215

Query: 186 YLTKIDLA 193
           Y  K+  A
Sbjct: 216 YHRKVGEA 223

>YBR247C (ENP1) [426] chr2 complement(712961..714412) Essential
           nuclear protein required for 35S pre-rRNA processing
           into 18S rRNA [1452 bp, 483 aa]
          Length = 483

 Score = 29.3 bits (64), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 5/38 (13%)

Query: 103 KNERKTLQIIKE-----EGETLTPAQMNKQIKEQVTTI 135
           K  RK LQ+ KE     EGE L  ++ NKQ + + TT+
Sbjct: 57  KASRKILQLAKEQQDEIEGEELAESERNKQFEARFTTM 94

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,049,026
Number of extensions: 172441
Number of successful extensions: 454
Number of sequences better than 10.0: 9
Number of HSP's gapped: 445
Number of HSP's successfully gapped: 9
Length of query: 212
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 115
Effective length of database: 13,238,163
Effective search space: 1522388745
Effective search space used: 1522388745
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)