Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_721.1271571446555e-89
YKL122C (SRP21)1671353571e-43
Kwal_26.76621341252993e-35
ABL025C1371262793e-32
Sklu_2430.81581362804e-32
CAGL0K11660g1871392582e-28
KLLA0B12782g1431251978e-20
CAGL0E06314g63163631.9
Kwal_26.9080142855632.0
YBR215W (HPC2)62351613.3
Kwal_27.1185943048588.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_721.127
         (157 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_721.127                                                          256   5e-89
YKL122C (SRP21) [3143] chr11 complement(212141..212644) Signal r...   142   1e-43
Kwal_26.7662                                                          119   3e-35
ABL025C [567] [Homologous to ScYKL122C (SRP21) - SH] (352547..35...   112   3e-32
Sklu_2430.8 YKL122C, Contig c2430 14655-15131 reverse complement      112   4e-32
CAGL0K11660g 1125697..1126260 similar to sp|P32342 Saccharomyces...   103   2e-28
KLLA0B12782g complement(1116729..1117160) weakly similar to sp|P...    80   8e-20
CAGL0E06314g complement(634653..636548) similar to sp|P36056 Sac...    29   1.9  
Kwal_26.9080                                                           29   2.0  
YBR215W (HPC2) [396] chr2 (653403..655274) Protein required for ...    28   3.3  
Kwal_27.11859                                                          27   8.5  

>Scas_721.127
          Length = 157

 Score =  256 bits (655), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 131/144 (90%), Positives = 131/144 (90%)

Query: 1   MSVKPIDTFITSSVKLFEVNPSQTVISLTYKTPTEKKRQSDVIFKTHNPHLGTSYKFSTN 60
           MSVKPIDTFITSSVKLFEVNPSQTVISLTYKTPTEKKRQSDVIFKTHNPHLGTSYKFSTN
Sbjct: 1   MSVKPIDTFITSSVKLFEVNPSQTVISLTYKTPTEKKRQSDVIFKTHNPHLGTSYKFSTN 60

Query: 61  KSKDVSRLLNAVGPRGVSVIPGRIERLNQTAAKVXXXXXXXXXXXXXDVVGLGSLIVNTD 120
           KSKDVSRLLNAVGPRGVSVIPGRIERLNQTAAKV             DVVGLGSLIVNTD
Sbjct: 61  KSKDVSRLLNAVGPRGVSVIPGRIERLNQTAAKVSKKKTSIKKKTIKDVVGLGSLIVNTD 120

Query: 121 VKEYVPIQPGSAGSNISQVSVEGS 144
           VKEYVPIQPGSAGSNISQVSVEGS
Sbjct: 121 VKEYVPIQPGSAGSNISQVSVEGS 144

>YKL122C (SRP21) [3143] chr11 complement(212141..212644) Signal
           recognition particle core subunit [504 bp, 167 aa]
          Length = 167

 Score =  142 bits (357), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 97/135 (71%), Gaps = 4/135 (2%)

Query: 1   MSVKPIDTFITSSVKLFEVNPSQTVISLTYKTPTEKKRQSDVIFKTHNPHLGTSYKFSTN 60
           MSVKPID +IT+SV+LFEVNPSQT+ S++YK PT+K   + V F+THN HL  +YKF+TN
Sbjct: 1   MSVKPIDNYITNSVRLFEVNPSQTLFSISYKPPTQK-TDTKVSFRTHNSHLSLNYKFTTN 59

Query: 61  KSKDVSRLLNAVGPRGVSVIPGRIERLNQTAAK---VXXXXXXXXXXXXXDVVGLGSLIV 117
           KSKDVSRLL+A+GPRGVS+ PG+IE++ Q+  K   +             D+VGL +LIV
Sbjct: 60  KSKDVSRLLSALGPRGVSITPGKIEKIAQSKKKNNKIKESSKKIKGKSIQDIVGLATLIV 119

Query: 118 NTDVKEYVPIQPGSA 132
           NTDV++  P    +A
Sbjct: 120 NTDVEKSDPAAKKTA 134

>Kwal_26.7662
          Length = 134

 Score =  119 bits (299), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 84/125 (67%), Gaps = 16/125 (12%)

Query: 1   MSVKPIDTFITSSVKLFEVNPSQTVISLTYKTPTEKKRQSDVIFKTHNPHLGTSYKFSTN 60
           MSV+P+D+FIT+SVKL E NPS+T++S+TY     K + S V FKTHN  L T YKFST 
Sbjct: 1   MSVEPLDSFITNSVKLLEANPSETILSVTYNC---KGKGSKVAFKTHNASLSTRYKFSTR 57

Query: 61  KSKDVSRLLNAVGPRGVSVIPGRIERLNQTAAKVXXXXXXXXXXXXXDVVGLGSLIVNTD 120
           KSKDVSRLL+A+GPRGVS+  G++E+ N+T  K              DV G+ +L+ N D
Sbjct: 58  KSKDVSRLLSALGPRGVSITNGKVEK-NKTGKKT------------KDVGGMSTLLANVD 104

Query: 121 VKEYV 125
           + E V
Sbjct: 105 IPESV 109

>ABL025C [567] [Homologous to ScYKL122C (SRP21) - SH]
           (352547..352960) [414 bp, 137 aa]
          Length = 137

 Score =  112 bits (279), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 79/126 (62%), Gaps = 13/126 (10%)

Query: 1   MSVKPIDTFITSSVKLFEVNPSQTVISLTYKTPTEKKRQSDVIFKTHNPHLGTSYKFSTN 60
           MSVKP+D+FI  S++L   NPSQT++S  Y+  + +     V F+THN HLG  YKF T 
Sbjct: 1   MSVKPVDSFIKDSLQLLCANPSQTLVSFRYRGGSAEGSAVLVRFRTHNSHLGLHYKFKTR 60

Query: 61  KSKDVSRLLNAVGPRGVSVIPGRIERLNQTAAKVXXXXXXXXXXXXXDVVGLGSLIVNTD 120
           + KDVSR+L+A+GPRGV+V+    ER  +  A               D+VG+ +L+VN D
Sbjct: 61  RQKDVSRVLSALGPRGVNVVAVGTERRKRKQA-------------SRDLVGMATLLVNAD 107

Query: 121 VKEYVP 126
           VK++VP
Sbjct: 108 VKQHVP 113

>Sklu_2430.8 YKL122C, Contig c2430 14655-15131 reverse complement
          Length = 158

 Score =  112 bits (280), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 62/136 (45%), Positives = 85/136 (62%), Gaps = 22/136 (16%)

Query: 3   VKPIDTFITSSVKLFEVNPSQTVISLTYKTPTEKKR-------------QSDVIFKTHNP 49
           VKP+DTFI +S+ L E NPSQT++S++Y +  +K++             +S V FKTHN 
Sbjct: 6   VKPLDTFIINSISLLEANPSQTLVSISYGSEAKKRKLGEKDSSRVLSQHKSLVSFKTHNT 65

Query: 50  HLGTSYKFSTNKSKDVSRLLNAVGPRGVSVIPGRIERLNQTAAKVXXXXXXXXXXXXXDV 109
           HLG SYKF TNK KDVSRLL+A+GPRGV +  G+IE+   +                 D 
Sbjct: 66  HLGISYKFRTNKFKDVSRLLSALGPRGVQISKGKIEKKKTSKKDA---------SDSKDT 116

Query: 110 VGLGSLIVNTDVKEYV 125
           VG+ +L+VNTDVKE++
Sbjct: 117 VGMSTLLVNTDVKEHI 132

>CAGL0K11660g 1125697..1126260 similar to sp|P32342 Saccharomyces
           cerevisiae YKL122c SRP21, start by similarity
          Length = 187

 Score =  103 bits (258), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 82/139 (58%), Gaps = 19/139 (13%)

Query: 1   MSVKPIDTFITSSVKLFEVNPSQTVISLTYKTPTEKKRQSDVIFKTHNPHLGTSYKFSTN 60
           MSVKPIDTFI +SVKLFE NPS + I+++Y       +   V+F+THNPHL T+YK+ T 
Sbjct: 1   MSVKPIDTFIENSVKLFEANPSGSSITISYHGGA---KADPVVFRTHNPHLSTTYKYQTK 57

Query: 61  KSKDVSRLLNAVGPRGVSVIP--------------GRIERLNQT--AAKVXXXXXXXXXX 104
            +K+VSR+LNA+GPRGVS+ P               + +++N +  + K           
Sbjct: 58  MNKEVSRVLNALGPRGVSMNPISKIAKRRNYLDVVKKAKQMNNSKISKKQAKLIRKAQTN 117

Query: 105 XXXDVVGLGSLIVNTDVKE 123
              + +G+G LI N D+KE
Sbjct: 118 PIVNTIGIGKLIANEDIKE 136

>KLLA0B12782g complement(1116729..1117160) weakly similar to
           sp|P32342 Saccharomyces cerevisiae YKL122c SRP21 signal
           recognition particle subunit singleton, start by
           similarity
          Length = 143

 Score = 80.5 bits (197), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 71/125 (56%), Gaps = 14/125 (11%)

Query: 1   MSVKPIDTFITSSVKLFEVNPSQTVISLTYKTPTEKKRQSDVIFKTHNPHLGTSYKFSTN 60
           MSV  +DTFIT S+KL E N SQT I + Y+ P      S V F+T N  +G +YK+ T 
Sbjct: 1   MSVSDLDTFITGSLKLLETNASQTKIMMKYR-PQSDDIHSKVTFRTKNDSVGLTYKYKTA 59

Query: 61  KSKDVSRLLNAVGPRGVSVIPGRIERLNQTAAKVXXXXXXXXXXXXXDVVGLGSLIVNTD 120
            SK++SR L+A+GP GV++  G++ +  Q   K              D+ G+ +L+VN  
Sbjct: 60  HSKELSRGLSAIGPTGVNLQLGKVGK--QVFKK-----------KSKDLPGMTTLLVNQK 106

Query: 121 VKEYV 125
           VK YV
Sbjct: 107 VKPYV 111

>CAGL0E06314g complement(634653..636548) similar to sp|P36056
           Saccharomyces cerevisiae YKL155c CAP1, start by
           similarity
          Length = 631

 Score = 28.9 bits (63), Expect = 1.9,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 26  ISLTYKTPTEKKRQSDVIFKTHNPHLGTSYKFSTNKSKDVSRLLNAVGPRGVSVIPGRIE 85
           I+   +T      + D+I  TH   L T  KF+T   +++S +LN + P G  +I   IE
Sbjct: 247 INTNLRTNLPTASEYDLIIMTHQ-LLKTKEKFNTEVEENLSNVLNLLAPNGQLII---IE 302

Query: 86  RLN 88
           R N
Sbjct: 303 RGN 305

>Kwal_26.9080
          Length = 1428

 Score = 28.9 bits (63), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 3/55 (5%)

Query: 18   EVNPSQTVISLTYKTPTEKKRQSDVIFKTHNP---HLGTSYKFSTNKSKDVSRLL 69
            +V P QT   L  + P+  + Q D+  K HN    H G  Y F     ++  +LL
Sbjct: 1284 DVPPLQTFHKLEPEQPSLSESQEDMTAKEHNAFNLHSGDDYTFRNETDEESEKLL 1338

>YBR215W (HPC2) [396] chr2 (653403..655274) Protein required for
           regulation of histone gene transcription throughout the
           cell cycle [1872 bp, 623 aa]
          Length = 623

 Score = 28.1 bits (61), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 5   PIDTFITSSVKLFEVNPSQTVISLTYKTPTEKKRQSDVIFKTHN-PHLGTS 54
           P + F  ++V+L++ +PS  +   T KT TE+KRQ++      N P  G+S
Sbjct: 109 PTNRFNKNTVELYQHSPSPVMT--TNKTDTEEKRQNNRNMDNKNTPERGSS 157

>Kwal_27.11859
          Length = 430

 Score = 26.9 bits (58), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 23/48 (47%)

Query: 16  LFEVNPSQTVISLTYKTPTEKKRQSDVIFKTHNPHLGTSYKFSTNKSK 63
           +F+    Q V   + K PT   ++    ++  NP +GT   F  NKS+
Sbjct: 235 MFQPQYQQDVAESSVKCPTSSLQRDFEAYRNKNPGVGTRDLFYNNKSR 282

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.129    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,987,046
Number of extensions: 136089
Number of successful extensions: 327
Number of sequences better than 10.0: 15
Number of HSP's gapped: 318
Number of HSP's successfully gapped: 15
Length of query: 157
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 64
Effective length of database: 13,376,635
Effective search space: 856104640
Effective search space used: 856104640
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 57 (26.6 bits)