Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_721.125*59659628070.0
ABL027W62562317940.0
Kwal_26.764356852917650.0
YKL125W (RRN3)62731113630.0
CAGL0M05203g54731012971e-174
KLLA0B12738g65830311951e-157
Sklu_2430.672671337e-10
YER092W (IES5)12587750.14
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_721.125*
         (596 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_721.125*                                                        1085   0.0  
ABL027W [565] [Homologous to ScYKL125W (RRN3) - SH] complement(3...   695   0.0  
Kwal_26.7643                                                          684   0.0  
YKL125W (RRN3) [3141] chr11 (207893..209776) RNA polymerase I tr...   529   0.0  
CAGL0M05203g 560851..562494 highly similar to sp|P36070 Saccharo...   504   e-174
KLLA0B12738g 1112500..1114476 similar to sp|P36070 Saccharomyces...   464   e-157
Sklu_2430.6 YKL125W, Contig c2430 10577-10795                          56   7e-10
YER092W (IES5) [1524] chr5 (342851..343228) Protein of unknown f...    33   0.14 

>Scas_721.125*
          Length = 596

 Score = 1085 bits (2807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/596 (89%), Positives = 536/596 (89%)

Query: 1   MMAFENNNKRSPQDIMNPIEPKKRKVEFSNEITLHPLNQENGTNEEFSAALYARYIKSAL 60
           MMAFENNNKRSPQDIMNPIEPKKRKVEFSNEITLHPLNQENGTNEEFSAALYARYIKSAL
Sbjct: 1   MMAFENNNKRSPQDIMNPIEPKKRKVEFSNEITLHPLNQENGTNEEFSAALYARYIKSAL 60

Query: 61  ENLEKVKWDCRQGVPTASKLRILNILLDVLSNNINRIDSSRGITLIQSIINFEKWWELPS 120
           ENLEKVKWDCRQGVPTASKLRILNILLDVLSNNINRIDSSRGITLIQSIINFEKWWELPS
Sbjct: 61  ENLEKVKWDCRQGVPTASKLRILNILLDVLSNNINRIDSSRGITLIQSIINFEKWWELPS 120

Query: 121 LTLSKYVFFIKILCSSIPKWWQDVSMILVSNFTLDTVKTKCHHDMLKYFLRMIPSSMGFI 180
           LTLSKYVFFIKILCSSIPKWWQDVSMILVSNFTLDTVKTKCHHDMLKYFLRMIPSSMGFI
Sbjct: 121 LTLSKYVFFIKILCSSIPKWWQDVSMILVSNFTLDTVKTKCHHDMLKYFLRMIPSSMGFI 180

Query: 181 DAYLAKFFPNKNDTSEKLVNYISNILLLTDYCKELKFQVWSLLVEKIISIDVELQXXXXX 240
           DAYLAKFFPNKNDTSEKLVNYISNILLLTDYCKELKFQVWSLLVEKIISIDVELQ     
Sbjct: 181 DAYLAKFFPNKNDTSEKLVNYISNILLLTDYCKELKFQVWSLLVEKIISIDVELQNELDE 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKNTXXXXXXXXXXXXXYNVDVTQGIKELS 300
                                         PKNT             YNVDVTQGIKELS
Sbjct: 241 LDDEIEEDLEEENEEEEDDEDDDENENELEPKNTIEDQDGEIEGDEEYNVDVTQGIKELS 300

Query: 301 TKLDSILTLITERITSEFTAENLESGDGVTLFNILTTLFKTHILSTYYTRSIQYIMFHVS 360
           TKLDSILTLITERITSEFTAENLESGDGVTLFNILTTLFKTHILSTYYTRSIQYIMFHVS
Sbjct: 301 TKLDSILTLITERITSEFTAENLESGDGVTLFNILTTLFKTHILSTYYTRSIQYIMFHVS 360

Query: 361 QQQLELMDSFLVTLIDIAFXXXXXXXXXXXXLQYLGSYIARAKKLSRTQIIFVASYLTSW 420
           QQQLELMDSFLVTLIDIAF            LQYLGSYIARAKKLSRTQIIFVASYLTSW
Sbjct: 361 QQQLELMDSFLVTLIDIAFSPSESSEKKIKSLQYLGSYIARAKKLSRTQIIFVASYLTSW 420

Query: 421 LNRYVIEREEEVDQPGGMERFKHFYATFQALCYIFCFRHSIFRDTEGAWECELDKFFQRM 480
           LNRYVIEREEEVDQPGGMERFKHFYATFQALCYIFCFRHSIFRDTEGAWECELDKFFQRM
Sbjct: 421 LNRYVIEREEEVDQPGGMERFKHFYATFQALCYIFCFRHSIFRDTEGAWECELDKFFQRM 480

Query: 481 IISKFNPLKYCNENVMLMFARITQHEDVAYCFSIIENNNNERLRGIIGKVDNDKKEYNTG 540
           IISKFNPLKYCNENVMLMFARITQHEDVAYCFSIIENNNNERLRGIIGKVDNDKKEYNTG
Sbjct: 481 IISKFNPLKYCNENVMLMFARITQHEDVAYCFSIIENNNNERLRGIIGKVDNDKKEYNTG 540

Query: 541 GSTSGWSLATRQQFIDLQSYFPYDPLFLKNYKKIMKAYYIEWSEASGEYESDESDD 596
           GSTSGWSLATRQQFIDLQSYFPYDPLFLKNYKKIMKAYYIEWSEASGEYESDESDD
Sbjct: 541 GSTSGWSLATRQQFIDLQSYFPYDPLFLKNYKKIMKAYYIEWSEASGEYESDESDD 596

>ABL027W [565] [Homologous to ScYKL125W (RRN3) - SH]
           complement(348503..350380) [1878 bp, 625 aa]
          Length = 625

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/623 (56%), Positives = 435/623 (69%), Gaps = 30/623 (4%)

Query: 1   MMAFENNNKRSP-QDI---MNPIEPKKRKVEFSNEITLHPLNQENGTNEE---FSAALYA 53
           MM+ E   KRS  QD+    +  E KKRKVEF++ + +H  ++    +E+   FS  LY 
Sbjct: 1   MMSIEKVQKRSSSQDLPLSSDKGEGKKRKVEFADGL-VHSRHRNELADEQPQDFSTKLYK 59

Query: 54  RYIKSALENLEKVKWDCRQGVPTASKLRI------------LNILLDVLSNNINRIDSSR 101
            YI+ AL++LE  K D  +    A++L +              ILL++L NNI +ID+ R
Sbjct: 60  GYIRDALDDLETSK-DTGKLDTIANQLSLSASSPDRISAENFAILLEMLGNNITKIDNKR 118

Query: 102 GITLIQSIINFEKWWELPSLTLSKYVFFIKILCSSIPKWWQDVSMILVSNFTLDTVKTKC 161
           G+ ++++++NFEKWW+LP LTL  YVFF++ILCSSIPKWWQDVSM+L+SNF L   KT  
Sbjct: 119 GVAIVRAVLNFEKWWDLPPLTLGNYVFFLQILCSSIPKWWQDVSMLLISNFRLPVDKTTK 178

Query: 162 HHDMLKYFLRMIPSSMGFIDAYLAKFFPNKNDTSEKLVNYISNILLLTDYCKELKFQVWS 221
           HH++LKYFLR IPSS  FID+Y+AK+FPNKND+ + LVNYISN+L LT+YC+EL+FQ WS
Sbjct: 179 HHEILKYFLRAIPSSSNFIDSYIAKYFPNKNDSKKNLVNYISNVLTLTEYCEELRFQAWS 238

Query: 222 LLVEKIISIDVELQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKNTXXXXXXX 281
           +++EKII++DVELQ                                     +T       
Sbjct: 239 MIIEKIIAVDVELQNELDELDDDVDEEIDDKLADSDDGEDELPGDDDAAEASTHSADDTS 298

Query: 282 XXXX-------XXYNVDVTQGIKELSTKLDSILTLITERITSEFTAENLESGDGVTLFNI 334
                        YN++VT+ IKELS KLD IL+++T R++   T E LESG+GV  FN 
Sbjct: 299 FDSEDEQLEGNEEYNIEVTRNIKELSKKLDVILSMLTTRLSDALTPETLESGEGVNTFNT 358

Query: 335 LTTLFKTHILSTYYTRSIQYIMFHVSQQQLELMDSFLVTLIDIAFXXXXXXXXXXXXLQY 394
           L +LFK+HIL TYYTRS+QY+MFHVSQQQ +LMD+FLVTLIDIAF            LQY
Sbjct: 359 LVSLFKSHILPTYYTRSVQYLMFHVSQQQPQLMDAFLVTLIDIAFSPNETMEKKIKSLQY 418

Query: 395 LGSYIARAKKLSRTQIIFVASYLTSWLNRYVIEREEEVDQPGGMERFKHFYATFQALCYI 454
           LGS+IARAKKL+ TQI FVASYLTSWLNRYV+EREEEVD PGGM+RFKHFYA FQALCYI
Sbjct: 419 LGSFIARAKKLTHTQITFVASYLTSWLNRYVLEREEEVDLPGGMDRFKHFYAAFQALCYI 478

Query: 455 FCFRHSIFRDTEGAWECELDKFFQRMIISKFNPLKYCNENVMLMFARITQHEDVAYCFSI 514
           FCFRH++FRD   AWEC++D FFQR +ISKFNPLKYCNENVMLMFARI QHE + YCFSI
Sbjct: 479 FCFRHALFRDG-NAWECDIDAFFQRTVISKFNPLKYCNENVMLMFARIAQHEGIVYCFSI 537

Query: 515 IENNNNERLRGIIGKVDNDKKEYNTG-GSTSGWSLATRQQFIDLQSYFPYDPLFLKNYKK 573
           IENNNNERLRGI+GK         +  G+ S WSLA RQQFIDLQSYFPYDPLFLK YK 
Sbjct: 538 IENNNNERLRGIMGKSSERSDGLASATGAASTWSLAARQQFIDLQSYFPYDPLFLKQYKN 597

Query: 574 IMKAYYIEWSEASGEYESDESDD 596
           +M+ YYIEWSE S +YESD+S++
Sbjct: 598 LMRDYYIEWSEISADYESDDSNE 620

>Kwal_26.7643
          Length = 568

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/529 (62%), Positives = 399/529 (75%), Gaps = 10/529 (1%)

Query: 73  GVPTASKLRI----LNILLDVLSNNINRIDSSRGITLIQSIINFEKWWELPSLTLSKYVF 128
            +P  S  RI    L++LL  LS+N++++D     +LIQSIINFEKWWELP+ TL  Y+F
Sbjct: 37  SLPYGSPDRISADNLSVLLQTLSHNVSKLDHQLCTSLIQSIINFEKWWELPAATLGTYIF 96

Query: 129 FIKILCSSIPKWWQDVSMILVSNFTLDTVKTKCHHDMLKYFLRMIPSSMGFIDAYLAKFF 188
           FIKILCSS+PKWWQDVS+ L+SNFTL    T  HH+MLKYFLR IP+  G+ID+Y+A+ F
Sbjct: 97  FIKILCSSLPKWWQDVSLPLISNFTLPLEHTVQHHEMLKYFLRTIPTCTGYIDSYIARSF 156

Query: 189 PNKNDTSEKLVNYISNILLLTDYCKELKFQVWSLLVEKIISIDVELQXXXXXXXXXXXXX 248
           PNKND+ + LVNYISN+L LTDYC EL+FQ WSL++EK+ISIDVELQ             
Sbjct: 157 PNKNDSKKNLVNYISNVLALTDYCNELRFQSWSLVIEKVISIDVELQNELDELDDDMENN 216

Query: 249 XXXXXXXXXXXXXXXXXXXXXXP-KNTXXXXXXXXXXXXXYNVDVTQGIKELSTKLDSIL 307
                                    +              YNVD++Q IK+LS+KLD+IL
Sbjct: 217 IDDLDDEDMNNDEAQLSDVDGDDYSSAESGEEGMMEGEEEYNVDISQNIKQLSSKLDAIL 276

Query: 308 TLITERITSEFTAENLESGDGVTLFNILTTLFKTHILSTYYTRSIQYIMFHVSQQQLELM 367
           +LIT++++   TAE++E+GDGV++FN L +LFK+HIL TYYTRSIQYI+FH+SQQQLELM
Sbjct: 277 SLITKKLSQSLTAESIENGDGVSIFNTLISLFKSHILPTYYTRSIQYILFHISQQQLELM 336

Query: 368 DSFLVTLIDIAFXXXXXXXXXXXXLQYLGSYIARAKKLSRTQIIFVASYLTSWLNRYVIE 427
           D+FLVTLIDIAF            LQY+GS+IARAK LS TQIIFVASYLTSWLNRYV+E
Sbjct: 337 DAFLVTLIDIAFSPNETIEKRIKSLQYIGSFIARAKMLSNTQIIFVASYLTSWLNRYVLE 396

Query: 428 REEEVDQPGGMERFKHFYATFQALCYIFCFRHSIFRDTEGAWECELDKFFQRMIISKFNP 487
           REEEV+QPGG+ERFKHFYA FQALCY+FCFRH+ FRD +  WECE+DKFFQRMI+SKFNP
Sbjct: 397 REEEVNQPGGVERFKHFYAAFQALCYVFCFRHATFRDGD-TWECEIDKFFQRMILSKFNP 455

Query: 488 LKYCNENVMLMFARITQHEDVAYCFSIIENNNNERLRGIIGKVDNDKKEYNTGGSTSGWS 547
           LKYCNENVMLMFARI QHE VAYCFSIIENNNNER++GI+GK D+     + G   S WS
Sbjct: 456 LKYCNENVMLMFARIAQHEGVAYCFSIIENNNNERMKGIMGKSDSK----SPGSIVSSWS 511

Query: 548 LATRQQFIDLQSYFPYDPLFLKNYKKIMKAYYIEWSEASGEYESDESDD 596
           LA RQQFIDLQSYFPYDPLFLKNYK++MK YYIEWS+ S EYESDESD+
Sbjct: 512 LAARQQFIDLQSYFPYDPLFLKNYKRMMKGYYIEWSDVSREYESDESDE 560

>YKL125W (RRN3) [3141] chr11 (207893..209776) RNA polymerase I
           transcription factor [1884 bp, 627 aa]
          Length = 627

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/311 (81%), Positives = 273/311 (87%), Gaps = 2/311 (0%)

Query: 288 YNVDVTQGIKELSTKLDSILTLITERITSEFTAENLESGDGVTLFNILTTLFKTHILSTY 347
           YNV++TQGIKELSTKLDSILTL++  +  + T E+LESG+GV +FN LTTLFKTH+L TY
Sbjct: 317 YNVELTQGIKELSTKLDSILTLVSTHVEEQVTPESLESGEGVGVFNTLTTLFKTHVLPTY 376

Query: 348 YTRSIQYIMFHVSQQQLELMDSFLVTLIDIAFXXXXXXXXXXXXLQYLGSYIARAKKLSR 407
           YTRSIQYIMFHVSQQQLELMDSFLVTLIDI+F            LQYLGSYIARAKKLSR
Sbjct: 377 YTRSIQYIMFHVSQQQLELMDSFLVTLIDISFAVNEAAEKKIKSLQYLGSYIARAKKLSR 436

Query: 408 TQIIFVASYLTSWLNRYVIEREEEVDQPGGMERFKHFYATFQALCYIFCFRHSIFRDTEG 467
           TQIIFVASYLTSWLNRYVIEREEEVDQ GGMERFKHFYA FQALCYIFCFRH+IFRDT+G
Sbjct: 437 TQIIFVASYLTSWLNRYVIEREEEVDQRGGMERFKHFYAAFQALCYIFCFRHNIFRDTDG 496

Query: 468 AWECELDKFFQRMIISKFNPLKYCNENVMLMFARITQHEDVAYCFSIIENNNNERLRGII 527
            WECELDKFFQRM+ISKFNPLK+CNENVMLMFARI Q E VAYCFSIIENNNNERLRGII
Sbjct: 497 NWECELDKFFQRMVISKFNPLKFCNENVMLMFARIAQQESVAYCFSIIENNNNERLRGII 556

Query: 528 GKVDNDKKEYNTGGST--SGWSLATRQQFIDLQSYFPYDPLFLKNYKKIMKAYYIEWSEA 585
           GK D+DKKE +   +T  S WSLATRQQFIDLQSYFPYDPLFLKNYK +MK YYIEWSEA
Sbjct: 557 GKADSDKKENSAQANTTSSSWSLATRQQFIDLQSYFPYDPLFLKNYKILMKEYYIEWSEA 616

Query: 586 SGEYESDESDD 596
           SGEYESD SDD
Sbjct: 617 SGEYESDGSDD 627

 Score =  325 bits (833), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 166/247 (67%), Positives = 191/247 (77%), Gaps = 14/247 (5%)

Query: 1   MMAFENNNKRSPQDIMNPIEPKKRKVEFSNEITLHPLNQENGTNEEFSAALYARYIKSAL 60
           MMAFEN +KR PQD + PI+ KKRKV+FS+   L  L  E   +E FSAA+Y+R++KSAL
Sbjct: 1   MMAFENTSKRPPQDFVAPIDQKKRKVQFSDSTGLVTLQPEEIKDEVFSAAMYSRFVKSAL 60

Query: 61  ENLEKVKWDCRQ--------GVPTASKLRI----LNILLDVLSNNINRIDSSRGITLIQS 108
           ++L+K   D  Q         +P+ +  RI    LNILLD+LS+NINRI+SSRG  LIQS
Sbjct: 61  DDLDKN--DSTQIGIIANQVALPSKNPERINDKNLNILLDILSSNINRIESSRGTFLIQS 118

Query: 109 IINFEKWWELPSLTLSKYVFFIKILCSSIPKWWQDVSMILVSNFTLDTVKTKCHHDMLKY 168
           IINFEKWWELP  TLSKY++FIKILCSSIPKWWQDVSMILVS F L   +T CHHDMLKY
Sbjct: 119 IINFEKWWELPPHTLSKYIYFIKILCSSIPKWWQDVSMILVSCFILPIKQTVCHHDMLKY 178

Query: 169 FLRMIPSSMGFIDAYLAKFFPNKNDTSEKLVNYISNILLLTDYCKELKFQVWSLLVEKII 228
           FLRMIPSSMGFID YLAKFFPNKNDT  KLVNY SN+L L  YC EL FQ+WSLL+EKII
Sbjct: 179 FLRMIPSSMGFIDTYLAKFFPNKNDTRRKLVNYTSNLLKLRGYCSELGFQIWSLLIEKII 238

Query: 229 SIDVELQ 235
           SIDVELQ
Sbjct: 239 SIDVELQ 245

>CAGL0M05203g 560851..562494 highly similar to sp|P36070
           Saccharomyces cerevisiae YKL125w RRN3 Cter fragment,
           hypothetical start
          Length = 547

 Score =  504 bits (1297), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 237/310 (76%), Positives = 262/310 (84%), Gaps = 1/310 (0%)

Query: 288 YNVDVTQGIKELSTKLDSILTLITERITSEFTAENLESGDGVTLFNILTTLFKTHILSTY 347
           YN+D+TQGIKELS KLD+IL+L++  I  + T E LESG+G+  FN LTTLFKTHIL TY
Sbjct: 238 YNIDLTQGIKELSNKLDAILSLLSSEIIKDMTPEKLESGEGIGTFNTLTTLFKTHILPTY 297

Query: 348 YTRSIQYIMFHVSQQQLELMDSFLVTLIDIAFXXXXXXXXXXXXLQYLGSYIARAKKLSR 407
           YTRS+QYIMFH+SQQQLELMDS+LVTLIDI+F            LQYLGSYIARAKKLSR
Sbjct: 298 YTRSVQYIMFHLSQQQLELMDSYLVTLIDISFAANETSEKRIKSLQYLGSYIARAKKLSR 357

Query: 408 TQIIFVASYLTSWLNRYVIEREEEVDQPGGMERFKHFYATFQALCYIFCFRHSIFRDTEG 467
           TQI+FVASYLTSWLNRYVIEREEEV+QPGGM+RFKHFYA FQALCYIFCFRH   RD +G
Sbjct: 358 TQIVFVASYLTSWLNRYVIEREEEVNQPGGMDRFKHFYAAFQALCYIFCFRHKDLRDVDG 417

Query: 468 AWECELDKFFQRMIISKFNPLKYCNENVMLMFARITQHEDVAYCFSIIENNNNERLRGII 527
           +WECELDKFF RM+ISKFNPLKYCNENVMLMFARI Q EDVAYCFSIIENNNNE LRGI+
Sbjct: 418 SWECELDKFFTRMVISKFNPLKYCNENVMLMFARIAQEEDVAYCFSIIENNNNELLRGIM 477

Query: 528 GKVDNDKKEYNTG-GSTSGWSLATRQQFIDLQSYFPYDPLFLKNYKKIMKAYYIEWSEAS 586
           GK D+ +    T  G  + WSLATRQQFIDLQSYFPYDPLFLKNYK +MK YYIEWSEA 
Sbjct: 478 GKADSSRGGTPTPMGPATSWSLATRQQFIDLQSYFPYDPLFLKNYKNMMKEYYIEWSEAG 537

Query: 587 GEYESDESDD 596
           GEYESD SD+
Sbjct: 538 GEYESDGSDE 547

 Score =  241 bits (616), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 134/151 (88%)

Query: 85  ILLDVLSNNINRIDSSRGITLIQSIINFEKWWELPSLTLSKYVFFIKILCSSIPKWWQDV 144
           ILL+VLSNNIN++DSS+G+ LIQ IINFEKWWELP   L KY+FFIK+LCSSIPKWWQDV
Sbjct: 27  ILLEVLSNNINKVDSSKGLPLIQCIINFEKWWELPDPALGKYIFFIKVLCSSIPKWWQDV 86

Query: 145 SMILVSNFTLDTVKTKCHHDMLKYFLRMIPSSMGFIDAYLAKFFPNKNDTSEKLVNYISN 204
           +MI++S+F L + KT  HH++LKYFLRMIPSSM +ID+YL ++FPNKND+ + +VNYISN
Sbjct: 87  AMIMISSFILSSEKTTQHHELLKYFLRMIPSSMSYIDSYLIRYFPNKNDSKKNIVNYISN 146

Query: 205 ILLLTDYCKELKFQVWSLLVEKIISIDVELQ 235
           +L+LT YC+ELKFQ WSL++E++ISIDVELQ
Sbjct: 147 VLMLTSYCQELKFQAWSLIMERVISIDVELQ 177

>KLLA0B12738g 1112500..1114476 similar to sp|P36070 Saccharomyces
           cerevisiae YKL125w RRN3 RNA polymerase I specific
           transcription factor singleton, start by similarity
          Length = 658

 Score =  464 bits (1195), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 219/303 (72%), Positives = 248/303 (81%), Gaps = 6/303 (1%)

Query: 288 YNVDVTQGIKELSTKLDSILTLITERITSEFTAENLESGDGVTLFNILTTLFKTHILSTY 347
           Y VD++  IKELS+KLD IL +IT +++   T E+LE GDGVT+FN LT+LFKTHIL TY
Sbjct: 346 YYVDLSHNIKELSSKLDDILAVITSKLSCALTPESLEDGDGVTIFNTLTSLFKTHILPTY 405

Query: 348 YTRSIQYIMFHVSQQQLELMDSFLVTLIDIAFXXXXXXXXXXXXLQYLGSYIARAKKLSR 407
           YTRS+QY+MFHVSQQQ ELMD+FLVTLIDI+F            LQY+GS+IARAKKL+R
Sbjct: 406 YTRSVQYLMFHVSQQQPELMDAFLVTLIDISFSPNETMEKKIKSLQYIGSFIARAKKLTR 465

Query: 408 TQIIFVASYLTSWLNRYVIEREEEVDQPGGMERFKHFYATFQALCYIFCFRHSIFRDTEG 467
           TQI+FV SYLTSWLNRYV+EREEEVDQ GGMERFKHFYA FQA+CYIFCFRHSI RD   
Sbjct: 466 TQIVFVTSYLTSWLNRYVLEREEEVDQQGGMERFKHFYAVFQAICYIFCFRHSILRDGND 525

Query: 468 AWECELDKFFQRMIISKFNPLKYCNENVMLMFARITQHEDVAYCFSIIENNNNERLRGII 527
           AWEC+LDKFFQRM+ISKFNPLKYCN NVM+MFA+I Q+E V YCFSIIENNNNERLRGI 
Sbjct: 526 AWECDLDKFFQRMVISKFNPLKYCNGNVMMMFAKIAQNEGVVYCFSIIENNNNERLRGIT 585

Query: 528 GKVDNDKKEYNTGGSTSG-WSLATRQQFIDLQSYFPYDPLFLKNYKKIMKAYYIEWSEAS 586
           G     K   + G S SG WSLATRQQFIDLQSYFPYDPLFL NYK +MK YYIEW+E S
Sbjct: 586 G-----KSAESGGSSISGTWSLATRQQFIDLQSYFPYDPLFLTNYKSMMKDYYIEWTEVS 640

Query: 587 GEY 589
            +Y
Sbjct: 641 KDY 643

 Score =  249 bits (637), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 125/259 (48%), Positives = 177/259 (68%), Gaps = 24/259 (9%)

Query: 1   MMAFENNNKRSPQDIMNPI----EPKKRKVEFSNEITLHPLNQ----------ENGTNEE 46
           MMA EN  KR   D+ + +    + K+R+VEFS  +     N            +G +++
Sbjct: 1   MMAMENGQKRQCTDLSSAMISGSDKKRRRVEFSETVLDQDGNSVLSGSNTRKDGSGNDKK 60

Query: 47  FSAALYARYIKSALENLEKVK------WDCRQGVPTASKLRI----LNILLDVLSNNINR 96
           F+  ++  ++  AL+ ++  +         +  +P +S  RI     ++LL +L NNI +
Sbjct: 61  FALEMFESFVIRALKEIDAGEDSGIESLSMQVSLPASSADRISADNFSLLLRMLGNNITK 120

Query: 97  IDSSRGITLIQSIINFEKWWELPSLTLSKYVFFIKILCSSIPKWWQDVSMILVSNFTLDT 156
           ID+ RG+T+I+SIINFEKWWELP+ TLS Y+ FI+ILCSS+PKWWQDVSM L+SNF L  
Sbjct: 121 IDNKRGLTIIRSIINFEKWWELPATTLSSYISFIRILCSSLPKWWQDVSMALISNFQLSM 180

Query: 157 VKTKCHHDMLKYFLRMIPSSMGFIDAYLAKFFPNKNDTSEKLVNYISNILLLTDYCKELK 216
            KT  HH+ML+YFL+ IPSS+ FID+Y+AKFFPNKND+ + L+N+ISN+L LT+YC EL+
Sbjct: 181 SKTVQHHEMLRYFLKTIPSSVHFIDSYIAKFFPNKNDSKKVLLNFISNVLALTEYCHELR 240

Query: 217 FQVWSLLVEKIISIDVELQ 235
           FQ WSL++EK+ISIDVELQ
Sbjct: 241 FQAWSLVIEKVISIDVELQ 259

>Sklu_2430.6 YKL125W, Contig c2430 10577-10795
          Length = 72

 Score = 55.8 bits (133), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 45/67 (67%), Gaps = 3/67 (4%)

Query: 2  MAFENNNKRSPQDIMNPIEPKKRKVEFSNEITLHPLNQENG--TNEEFSAALYARYIKSA 59
          MA E   KR  Q + + +EPKKRKV F++E+ +  +++ N    N+EFS  LY  ++++A
Sbjct: 1  MAVEKTAKRPSQGLASSVEPKKRKVGFADEV-MSKIDRNNDVQNNKEFSMTLYRNFVRNA 59

Query: 60 LENLEKV 66
          LE+LEKV
Sbjct: 60 LEDLEKV 66

>YER092W (IES5) [1524] chr5 (342851..343228) Protein of unknown
           function [378 bp, 125 aa]
          Length = 125

 Score = 33.5 bits (75), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/87 (21%), Positives = 40/87 (45%), Gaps = 3/87 (3%)

Query: 423 RYVIEREEE-VDQPGGMERFKHFYATFQALCYIFCFRHSIFRDTEGAWECELDKFFQRMI 481
           R +  R +E + Q G ++R   +    + +  +    +SI     G+ E EL +   +  
Sbjct: 15  RKISARNDELIKQDGTLKR--EYTTLLRKVSSVITVLNSIDDADTGSAETELPRLISQAT 72

Query: 482 ISKFNPLKYCNENVMLMFARITQHEDV 508
           + K   LK+ N+ + L+  ++   ED+
Sbjct: 73  VEKVPELKWYNDQISLITEKLEDDEDI 99

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,479,455
Number of extensions: 802234
Number of successful extensions: 2357
Number of sequences better than 10.0: 12
Number of HSP's gapped: 2386
Number of HSP's successfully gapped: 17
Length of query: 596
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 489
Effective length of database: 12,891,983
Effective search space: 6304179687
Effective search space used: 6304179687
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)