Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_721.12356956930220.0
CAGL0K07480g56756726140.0
YMR105C (PGM2)56956925580.0
Scas_717.7056956925180.0
YKL127W (PGM1)57057024950.0
Sklu_2430.457157124270.0
CAGL0K03421g56856624130.0
Kwal_26.762857057023920.0
KLLA0B12694g56857023320.0
ABL029W56856922320.0
Kwal_27.10258620504950.002
CAGL0M02981g617549920.005
KLLA0F14861g58949770.28
AEL112C53564750.51
KLLA0D01573g607188740.66
Scas_696.42625108721.0
Sklu_1870.5347142711.2
YMR278W622140711.4
CAGL0G02541g129565684.1
CAGL0H02123g55549674.4
YDL205C (HEM3)32797664.9
Kwal_55.2015452247665.1
Sklu_1994.2624133666.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_721.123
         (569 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_721.123                                                         1168   0.0  
CAGL0K07480g complement(739633..741336) highly similar to sp|P37...  1011   0.0  
YMR105C (PGM2) [4062] chr13 complement(475896..477605) Phosphogl...   989   0.0  
Scas_717.70                                                           974   0.0  
YKL127W (PGM1) [3139] chr11 (203187..204899) Phosphoglucomutase,...   965   0.0  
Sklu_2430.4 YMR105C, Contig c2430 6115-7830                           939   0.0  
CAGL0K03421g complement(313851..315557) highly similar to sp|P37...   934   0.0  
Kwal_26.7628                                                          926   0.0  
KLLA0B12694g 1107696..1109402 highly similar to sp|P37012 Saccha...   902   0.0  
ABL029W [563] [Homologous to ScYKL127W (PGM1) - SH; ScYMR105C (P...   864   0.0  
Kwal_27.10258                                                          41   0.002
CAGL0M02981g 335863..337716 similar to sp|Q03262 Saccharomyces c...    40   0.005
KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539 S...    34   0.28 
AEL112C [2394] [Homologous to ScYJL162C - SH] (412116..413723) [...    33   0.51 
KLLA0D01573g complement(139183..141006) similar to sp|Q03262 Sac...    33   0.66 
Scas_696.42                                                            32   1.0  
Sklu_1870.5 YFL029C, Contig c1870 6101-7144                            32   1.2  
YMR278W (YMR278W) [4232] chr13 (822762..824630) Protein containi...    32   1.4  
CAGL0G02541g 231428..235315 similar to sp|P36168 Saccharomyces c...    31   4.1  
CAGL0H02123g complement(188454..190121) similar to sp|Q00539 Sac...    30   4.4  
YDL205C (HEM3) [669] chr4 complement(92763..93746) Porphobilinog...    30   4.9  
Kwal_55.20154                                                          30   5.1  
Sklu_1994.2 YMR278W, Contig c1994 3654-5528                            30   6.2  

>Scas_721.123
          Length = 569

 Score = 1168 bits (3022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/569 (100%), Positives = 569/569 (100%)

Query: 1   MSLQIETIETKPYQDQKPGTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQDATLVVG 60
           MSLQIETIETKPYQDQKPGTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQDATLVVG
Sbjct: 1   MSLQIETIETKPYQDQKPGTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQDATLVVG 60

Query: 61  GDGRFYNDVIMNKIAAISAANGVKKLIIGQNGLLSTPAASHIIRSYEEKVTGGIILTASH 120
           GDGRFYNDVIMNKIAAISAANGVKKLIIGQNGLLSTPAASHIIRSYEEKVTGGIILTASH
Sbjct: 61  GDGRFYNDVIMNKIAAISAANGVKKLIIGQNGLLSTPAASHIIRSYEEKVTGGIILTASH 120

Query: 121 NPGGPENDLGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKYG 180
           NPGGPENDLGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKYG
Sbjct: 121 NPGGPENDLGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKYG 180

Query: 181 PLLVDIIDVTKDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVD 240
           PLLVDIIDVTKDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVD
Sbjct: 181 PLLVDIIDVTKDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVD 240

Query: 241 EFDLPANEVLQNWHPKPDFGGLHPDPNLTYAKTLVERVDREKIEFGAASDGDGDRNMIYG 300
           EFDLPANEVLQNWHPKPDFGGLHPDPNLTYAKTLVERVDREKIEFGAASDGDGDRNMIYG
Sbjct: 241 EFDLPANEVLQNWHPKPDFGGLHPDPNLTYAKTLVERVDREKIEFGAASDGDGDRNMIYG 300

Query: 301 AGPAFVSPGDSVAIIAEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHGLSCYEVPTG 360
           AGPAFVSPGDSVAIIAEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHGLSCYEVPTG
Sbjct: 301 AGPAFVSPGDSVAIIAEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHGLSCYEVPTG 360

Query: 361 WKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIVAWLNVLAIYNKHNPEKDASIKT 420
           WKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIVAWLNVLAIYNKHNPEKDASIKT
Sbjct: 361 WKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIVAWLNVLAIYNKHNPEKDASIKT 420

Query: 421 IQEEFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFVSKPNVIGSAFPGDESLTVVDAG 480
           IQEEFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFVSKPNVIGSAFPGDESLTVVDAG
Sbjct: 421 IQEEFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFVSKPNVIGSAFPGDESLTVVDAG 480

Query: 481 DFSYTDLDGSVSDHQGLFFKLSNGARIVLRLSGTGSSGATIRIYVENYTDDKTKYEESAQ 540
           DFSYTDLDGSVSDHQGLFFKLSNGARIVLRLSGTGSSGATIRIYVENYTDDKTKYEESAQ
Sbjct: 481 DFSYTDLDGSVSDHQGLFFKLSNGARIVLRLSGTGSSGATIRIYVENYTDDKTKYEESAQ 540

Query: 541 DFLAPTIKTVVKFLKFKEFIGTEEPTVRT 569
           DFLAPTIKTVVKFLKFKEFIGTEEPTVRT
Sbjct: 541 DFLAPTIKTVVKFLKFKEFIGTEEPTVRT 569

>CAGL0K07480g complement(739633..741336) highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c PGM2
           phosphoglucomutase, hypothetical start
          Length = 567

 Score = 1011 bits (2614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/567 (84%), Positives = 519/567 (91%)

Query: 3   LQIETIETKPYQDQKPGTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQDATLVVGGD 62
           +Q+ET+ TKPYQDQKPGTSGLRKKT +FM EPNYTENFIQA++DAIPEG++DA LVVGGD
Sbjct: 1   MQVETVPTKPYQDQKPGTSGLRKKTKVFMEEPNYTENFIQAIMDAIPEGAKDAVLVVGGD 60

Query: 63  GRFYNDVIMNKIAAISAANGVKKLIIGQNGLLSTPAASHIIRSYEEKVTGGIILTASHNP 122
           GRFYNDVIM KIAAI AANGV+KLIIGQNGLLSTPAASH+IRSY EK TGGIILTASHNP
Sbjct: 61  GRFYNDVIMQKIAAIGAANGVRKLIIGQNGLLSTPAASHVIRSYAEKCTGGIILTASHNP 120

Query: 123 GGPENDLGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKYGPL 182
           GGPENDLGIKYNLANGGPAPE VTN +WEVSK+LTHYKIIK+FP +D SK+GKDQ+YGPL
Sbjct: 121 GGPENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGPL 180

Query: 183 LVDIIDVTKDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVDEF 242
           LVDIID T+DYV F+KEIFDF+LIK+FIHKQRE KNWKLLFDSLNGITGPYGKAIFVDEF
Sbjct: 181 LVDIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEF 240

Query: 243 DLPANEVLQNWHPKPDFGGLHPDPNLTYAKTLVERVDREKIEFGAASDGDGDRNMIYGAG 302
           DLPA+EVLQNWHP+PDFGGLHPDPNLTYA TLVERVDREKIEFGAASDGDGDRNMIYGAG
Sbjct: 241 DLPADEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVDREKIEFGAASDGDGDRNMIYGAG 300

Query: 303 PAFVSPGDSVAIIAEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHGLSCYEVPTGWK 362
           PAFVSPGDSVAIIAEYA EIPYF KQGIYGLARSFPTS AIDRVAKA GL+CYEVPTGWK
Sbjct: 301 PAFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARSFPTSGAIDRVAKAQGLNCYEVPTGWK 360

Query: 363 FFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIVAWLNVLAIYNKHNPEKDASIKTIQ 422
           FFCALFDAKKLSICGEESFGTGSNHIREKDG+WAI AWLN+LA+YNKHNPEK+ASIKTIQ
Sbjct: 361 FFCALFDAKKLSICGEESFGTGSNHIREKDGVWAICAWLNILALYNKHNPEKEASIKTIQ 420

Query: 423 EEFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFVSKPNVIGSAFPGDESLTVVDAGDF 482
           EEFW KYGRTFFTRYDYE I+ E A+KVVDLL+ FV+ P    + FPGDESLTV D GDF
Sbjct: 421 EEFWAKYGRTFFTRYDYEGITTEKANKVVDLLDKFVNDPKSKNAPFPGDESLTVSDCGDF 480

Query: 483 SYTDLDGSVSDHQGLFFKLSNGARIVLRLSGTGSSGATIRIYVENYTDDKTKYEESAQDF 542
           SYTDLDGSVSDHQGLF KLSNGAR VLRLSGTGS+GATIR+Y+E Y+DDK+ Y +SA  +
Sbjct: 481 SYTDLDGSVSDHQGLFVKLSNGARFVLRLSGTGSAGATIRLYIEEYSDDKSTYTQSADQY 540

Query: 543 LAPTIKTVVKFLKFKEFIGTEEPTVRT 569
           L   IK+V  FL FKE IGT+EPTVRT
Sbjct: 541 LQKMIKSVTSFLNFKELIGTDEPTVRT 567

>YMR105C (PGM2) [4062] chr13 complement(475896..477605)
           Phosphoglucomutase, major isozyme, interconverts Glc-1-P
           and Glc-6-P [1710 bp, 569 aa]
          Length = 569

 Score =  989 bits (2558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/569 (80%), Positives = 523/569 (91%)

Query: 1   MSLQIETIETKPYQDQKPGTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQDATLVVG 60
           MS QIET+ TKPY+DQKPGTSGLRKKT +F +EPNYTENFIQ++++AIPEGS+ ATLVVG
Sbjct: 1   MSFQIETVPTKPYEDQKPGTSGLRKKTKVFKDEPNYTENFIQSIMEAIPEGSKGATLVVG 60

Query: 61  GDGRFYNDVIMNKIAAISAANGVKKLIIGQNGLLSTPAASHIIRSYEEKVTGGIILTASH 120
           GDGR+YNDVI++KIAAI AANG+KKL+IGQ+GLLSTPAASHI+R+YEEK TGGIILTASH
Sbjct: 61  GDGRYYNDVILHKIAAIGAANGIKKLVIGQHGLLSTPAASHIMRTYEEKCTGGIILTASH 120

Query: 121 NPGGPENDLGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKYG 180
           NPGGPEND+GIKYNL+NGGPAPESVTNAIWE+SKKLT YKIIK+FP LDL  +GK++KYG
Sbjct: 121 NPGGPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYG 180

Query: 181 PLLVDIIDVTKDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVD 240
           PLLVDIID+TKDYV+FLKEIFDF+LIKKFI  QR TKNWKLLFDS+NG+TGPYGKAIFVD
Sbjct: 181 PLLVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVD 240

Query: 241 EFDLPANEVLQNWHPKPDFGGLHPDPNLTYAKTLVERVDREKIEFGAASDGDGDRNMIYG 300
           EF LPA+EVLQNWHP PDFGG+HPDPNLTYA +LV+RVDREKIEFGAASDGDGDRNMIYG
Sbjct: 241 EFGLPADEVLQNWHPSPDFGGMHPDPNLTYASSLVKRVDREKIEFGAASDGDGDRNMIYG 300

Query: 301 AGPAFVSPGDSVAIIAEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHGLSCYEVPTG 360
            GP+FVSPGDSVAIIAEYA+EIPYF KQGIYGLARSFPTS AIDRVAKAHGL+CYEVPTG
Sbjct: 301 YGPSFVSPGDSVAIIAEYAAEIPYFAKQGIYGLARSFPTSGAIDRVAKAHGLNCYEVPTG 360

Query: 361 WKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIVAWLNVLAIYNKHNPEKDASIKT 420
           WKFFCALFDAKKLSICGEESFGTGSNH+REKDG+WAI+AWLN+LAIYNKH+PE +ASIKT
Sbjct: 361 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNKHHPENEASIKT 420

Query: 421 IQEEFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFVSKPNVIGSAFPGDESLTVVDAG 480
           IQ EFW KYGRTFFTRYD+E +  E A+K+VD L  +V+K  V+ SAFP DESL V D G
Sbjct: 421 IQNEFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYVTKSGVVNSAFPADESLKVTDCG 480

Query: 481 DFSYTDLDGSVSDHQGLFFKLSNGARIVLRLSGTGSSGATIRIYVENYTDDKTKYEESAQ 540
           DFSYTDLDGSVSDHQGL+ KLSNGAR VLRLSGTGSSGATIR+Y+E Y DDK++Y+++A+
Sbjct: 481 DFSYTDLDGSVSDHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKTAE 540

Query: 541 DFLAPTIKTVVKFLKFKEFIGTEEPTVRT 569
           ++L P I +V+KFL FK+ +GTEEPTVRT
Sbjct: 541 EYLKPIINSVIKFLNFKQVLGTEEPTVRT 569

>Scas_717.70
          Length = 569

 Score =  974 bits (2518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/569 (79%), Positives = 517/569 (90%)

Query: 1   MSLQIETIETKPYQDQKPGTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQDATLVVG 60
           MS QI+T+ TKPYQDQKPGTSGLRKKT IF + PNYTENFIQA++DAIPEGS+ ATLVVG
Sbjct: 1   MSFQIQTVPTKPYQDQKPGTSGLRKKTKIFKDTPNYTENFIQAIMDAIPEGSKGATLVVG 60

Query: 61  GDGRFYNDVIMNKIAAISAANGVKKLIIGQNGLLSTPAASHIIRSYEEKVTGGIILTASH 120
           GDGR+YNDVI++KIAAI AANGVKKL+IGQ GLLSTPAASHI+R+YEEK  GGIILTASH
Sbjct: 61  GDGRYYNDVILHKIAAIGAANGVKKLVIGQRGLLSTPAASHIMRTYEEKTQGGIILTASH 120

Query: 121 NPGGPENDLGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKYG 180
           NPGG +ND+GIK+NL+NGGPAPE VTN IWE+SKK+T +KIIK+FP L+L  +GK++KYG
Sbjct: 121 NPGGIKNDMGIKFNLSNGGPAPEPVTNKIWEISKKMTSFKIIKDFPELELETLGKNKKYG 180

Query: 181 PLLVDIIDVTKDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVD 240
           PLLVD+ID TK YV+F+K+IFDF+LIKKF+HKQR+TK+WKLLFD +NG+TGPYGKAIFVD
Sbjct: 181 PLLVDVIDTTKAYVEFVKQIFDFDLIKKFVHKQRDTKHWKLLFDGMNGVTGPYGKAIFVD 240

Query: 241 EFDLPANEVLQNWHPKPDFGGLHPDPNLTYAKTLVERVDREKIEFGAASDGDGDRNMIYG 300
           E  LPA+EVLQ WHP PDFGG+HPDPNLTYAK LV+RVDRE IEFGAASDGDGDRNMIYG
Sbjct: 241 ELGLPADEVLQQWHPSPDFGGVHPDPNLTYAKALVDRVDRENIEFGAASDGDGDRNMIYG 300

Query: 301 AGPAFVSPGDSVAIIAEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHGLSCYEVPTG 360
           AGPAFVSPGDSVAIIAEYA+EIPYF KQGIYGLARSFPTS+AIDRVAKAHGL+CYEVPTG
Sbjct: 301 AGPAFVSPGDSVAIIAEYAAEIPYFAKQGIYGLARSFPTSSAIDRVAKAHGLNCYEVPTG 360

Query: 361 WKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIVAWLNVLAIYNKHNPEKDASIKT 420
           WKFFCALFDAKKLSICGEESFGTGSNH+REKDG+WAI+AWLN+LAIYNKH+P++D SIK 
Sbjct: 361 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGIWAILAWLNLLAIYNKHHPDRDVSIKI 420

Query: 421 IQEEFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFVSKPNVIGSAFPGDESLTVVDAG 480
           IQ+EFWNKYGRTFFTRYDYE ++ EDA+KV+D L   V     +   FP DESLTVV+AG
Sbjct: 421 IQDEFWNKYGRTFFTRYDYEKVATEDAAKVIDNLRKHVESKTFVNHKFPTDESLTVVEAG 480

Query: 481 DFSYTDLDGSVSDHQGLFFKLSNGARIVLRLSGTGSSGATIRIYVENYTDDKTKYEESAQ 540
           DFSYTDLDGSVS HQGLFFKLSNGAR+V+RLSGTGSSGATIR+YVE YTDDK+ Y ++AQ
Sbjct: 481 DFSYTDLDGSVSAHQGLFFKLSNGARVVVRLSGTGSSGATIRLYVEKYTDDKSVYGQNAQ 540

Query: 541 DFLAPTIKTVVKFLKFKEFIGTEEPTVRT 569
            +L P I++VVKFL FKEFIGTEEPTVRT
Sbjct: 541 VYLKPVIQSVVKFLNFKEFIGTEEPTVRT 569

>YKL127W (PGM1) [3139] chr11 (203187..204899) Phosphoglucomutase,
           minor isoform, interconverts Glc-1-P and Glc-6-P [1713
           bp, 570 aa]
          Length = 570

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/570 (80%), Positives = 507/570 (88%), Gaps = 1/570 (0%)

Query: 1   MSLQIETIETKPYQDQKPGTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQDATLVVG 60
           MSL I+++ T  Y+DQKPGTSGLRKKT +FM+EP+YTENFIQA + +IP GS+  TLVVG
Sbjct: 1   MSLLIDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVG 60

Query: 61  GDGRFYNDVIMNKIAAISAANGVKKLIIGQNGLLSTPAASHIIRSYEEKVTGG-IILTAS 119
           GDGRFYNDVIMNKIAA+ AANGV+KL+IGQ GLLSTPAASHIIR+YEEK TGG IILTAS
Sbjct: 61  GDGRFYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTAS 120

Query: 120 HNPGGPENDLGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKY 179
           HNPGGPENDLGIKYNL NGGPAPESVTNAIWE SKKLTHYKIIKNFP L+L+K+GK+QKY
Sbjct: 121 HNPGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYKIIKNFPKLNLNKLGKNQKY 180

Query: 180 GPLLVDIIDVTKDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFV 239
           GPLLVDIID  K YV FLKEIFDF+LIK F+ KQR+ K WKLLFDSLNGITGPYGKAIFV
Sbjct: 181 GPLLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFV 240

Query: 240 DEFDLPANEVLQNWHPKPDFGGLHPDPNLTYAKTLVERVDREKIEFGAASDGDGDRNMIY 299
           DEF LPA EVLQNWHP PDFGGLHPDPNLTYA+TLV+RVDREKI FGAASDGDGDRNMIY
Sbjct: 241 DEFGLPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIY 300

Query: 300 GAGPAFVSPGDSVAIIAEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHGLSCYEVPT 359
           G GPAFVSPGDSVAIIAEYA EIPYF KQGIYGLARSFPTS+AIDRVA   GL CYEVPT
Sbjct: 301 GYGPAFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPT 360

Query: 360 GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIVAWLNVLAIYNKHNPEKDASIK 419
           GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAI+AWLN+LAIY++ NPEK+ASIK
Sbjct: 361 GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIIAWLNILAIYHRRNPEKEASIK 420

Query: 420 TIQEEFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFVSKPNVIGSAFPGDESLTVVDA 479
           TIQ+EFWN+YGRTFFTRYDYEHI  E A KVV LL+ FVS+PNV GS FP DESLTV+D 
Sbjct: 421 TIQDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRPNVCGSHFPADESLTVIDC 480

Query: 480 GDFSYTDLDGSVSDHQGLFFKLSNGARIVLRLSGTGSSGATIRIYVENYTDDKTKYEESA 539
           GDFSY DLDGS+S++QGLF K SNG + VLRLSGTGSSGATIR+YVE YTD K  Y ++A
Sbjct: 481 GDFSYRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQTA 540

Query: 540 QDFLAPTIKTVVKFLKFKEFIGTEEPTVRT 569
             FL P I ++VKFL+FKE +GT+EPTVRT
Sbjct: 541 DVFLKPVINSIVKFLRFKEILGTDEPTVRT 570

>Sklu_2430.4 YMR105C, Contig c2430 6115-7830
          Length = 571

 Score =  939 bits (2427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/571 (78%), Positives = 504/571 (88%), Gaps = 2/571 (0%)

Query: 1   MSLQIETIETKPYQDQKPGTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQDATLVVG 60
           MS +IETI T PY DQKPGTSGLRKKT +FM EPNYTENFIQA++DAIPEGSQDATLVVG
Sbjct: 1   MSFKIETIPTTPYTDQKPGTSGLRKKTKVFMEEPNYTENFIQAVMDAIPEGSQDATLVVG 60

Query: 61  GDGRFYNDVIMNKIAAISAANGVKKLIIGQNGLLSTPAASHIIRSY-EEKVTGGIILTAS 119
           GDGRFYNDV++ KIAAI AANGV KL+IGQNG+LSTPAASHIIR+Y   K+TGGIILTAS
Sbjct: 61  GDGRFYNDVVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTAS 120

Query: 120 HNPGGPENDLGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKY 179
           HNPGG +ND GIKYNL+NGGPAPESVTN I+E SK+LT YKI+ NFP LDLSK G DQ+Y
Sbjct: 121 HNPGGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRY 180

Query: 180 GPLLVDIIDVTKDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFV 239
           GPLLVDIID T+ YV  +K IFDF+LIKKFI  Q+ET  +KLLFDSLNG+TGPYGKA+FV
Sbjct: 181 GPLLVDIIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFV 240

Query: 240 DEFDLPANEVLQNWHPKPDFGGLHPDPNLTYAKTLVERVDREKIEFGAASDGDGDRNMIY 299
           DE  L A E LQN+ PKPDFGGLHPDPNLTYA TLVERVD++KI FGAASDGDGDRNMIY
Sbjct: 241 DELGLSAEESLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKDKIAFGAASDGDGDRNMIY 300

Query: 300 GAGPAFVSPGDSVAIIAEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHGLSCYEVPT 359
           G GPAFVSPGDSVAIIAEYASEIPYF KQGIYGLARSFPTSAAIDRVAKAHGL+CYEVPT
Sbjct: 301 GYGPAFVSPGDSVAIIAEYASEIPYFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYEVPT 360

Query: 360 GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIVAWLNVLAIYNKHNPEKDASIK 419
           GWKFFCALFDAKKLSICGEESFGTGSNH+REKDG+WAI+AWLN+LAIYN+ NP K+ASIK
Sbjct: 361 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNRKNPTKEASIK 420

Query: 420 TIQEEFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFVSKPN-VIGSAFPGDESLTVVD 478
           TIQEEFWNKYGRTFFTRYD+E I++E+A KV+ LL+NFVSK + V+  AFP    LTVVD
Sbjct: 421 TIQEEFWNKYGRTFFTRYDFEQIASENADKVIQLLHNFVSKKDSVVNKAFPAATDLTVVD 480

Query: 479 AGDFSYTDLDGSVSDHQGLFFKLSNGARIVLRLSGTGSSGATIRIYVENYTDDKTKYEES 538
           AGDFSYTDLDGSVS +QGLF KLSNG + V+RLSGTGSSGATIR+YVE Y+D+K+ Y  +
Sbjct: 481 AGDFSYTDLDGSVSSNQGLFVKLSNGCKFVVRLSGTGSSGATIRLYVERYSDNKSDYSLT 540

Query: 539 AQDFLAPTIKTVVKFLKFKEFIGTEEPTVRT 569
           A  FL   IK V++FLKFKEF+GT+EPTVRT
Sbjct: 541 ADQFLGNDIKHVLQFLKFKEFLGTDEPTVRT 571

>CAGL0K03421g complement(313851..315557) highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c Phosphoglucomutase 2,
           start by similarity
          Length = 568

 Score =  934 bits (2413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/566 (76%), Positives = 503/566 (88%)

Query: 4   QIETIETKPYQDQKPGTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQDATLVVGGDG 63
           QIE++ TKPYQDQKPGTSGLRKKT +F ++PNY ENFIQ++++AIPEG++ A LVVGGDG
Sbjct: 3   QIESVPTKPYQDQKPGTSGLRKKTKVFEDQPNYVENFIQSVMEAIPEGAKGAVLVVGGDG 62

Query: 64  RFYNDVIMNKIAAISAANGVKKLIIGQNGLLSTPAASHIIRSYEEKVTGGIILTASHNPG 123
           R+YNDVI+ KIAAI AANGVKKL+IGQNGLLSTPAASHI+R+Y+EK TGGIILTASHNPG
Sbjct: 63  RYYNDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIMRTYKEKCTGGIILTASHNPG 122

Query: 124 GPENDLGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKYGPLL 183
           GPEND+GIKYNL+NGGPAPE VTN IWE+SKKLTHYKI+K+FP LDL+K+ +++KYGPLL
Sbjct: 123 GPENDMGIKYNLSNGGPAPEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGPLL 182

Query: 184 VDIIDVTKDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVDEFD 243
           VD+ID T  Y+  LKEIFDFELI KFI KQR+ K WKLL DS+NG+TGPY KAIFVDEF 
Sbjct: 183 VDVIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEFG 242

Query: 244 LPANEVLQNWHPKPDFGGLHPDPNLTYAKTLVERVDREKIEFGAASDGDGDRNMIYGAGP 303
           L + EVLQNWHP+PDFGGLHPDPNLTYA TLVERV++EKIEFGAASDGDGDRNMIYG GP
Sbjct: 243 LDSKEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVNKEKIEFGAASDGDGDRNMIYGYGP 302

Query: 304 AFVSPGDSVAIIAEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHGLSCYEVPTGWKF 363
           AFVSPGDSVAIIAEYA+EIPYF KQGIYGLARSFPT++AIDRVAK HGL+CYEVPTGWKF
Sbjct: 303 AFVSPGDSVAIIAEYANEIPYFKKQGIYGLARSFPTASAIDRVAKKHGLNCYEVPTGWKF 362

Query: 364 FCALFDAKKLSICGEESFGTGSNHIREKDGLWAIVAWLNVLAIYNKHNPEKDASIKTIQE 423
           FCALFDAKKLSICGEESFGTGSNH+REKDG+WAI+AWLN+LAI+N+ +P+K+ASIKTIQ 
Sbjct: 363 FCALFDAKKLSICGEESFGTGSNHVREKDGIWAIMAWLNILAIFNQRHPDKEASIKTIQN 422

Query: 424 EFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFVSKPNVIGSAFPGDESLTVVDAGDFS 483
           EFW+ YGRTFFTRYDYE +  + A+KV++ L  +V+     GS FP D +LTVVDAGDFS
Sbjct: 423 EFWDTYGRTFFTRYDYEKVETDKANKVIENLRQYVADSGTKGSKFPTDSALTVVDAGDFS 482

Query: 484 YTDLDGSVSDHQGLFFKLSNGARIVLRLSGTGSSGATIRIYVENYTDDKTKYEESAQDFL 543
           YTDLDG++S HQGL+  LSNGAR V+RLSGTGSSGATIR+Y+E YTDDK+KY   AQ++L
Sbjct: 483 YTDLDGTISSHQGLYVILSNGARFVVRLSGTGSSGATIRLYIERYTDDKSKYSLDAQEYL 542

Query: 544 APTIKTVVKFLKFKEFIGTEEPTVRT 569
            P IK++V+FL  K  +GTEEPTVRT
Sbjct: 543 KPIIKSIVQFLDLKTILGTEEPTVRT 568

>Kwal_26.7628
          Length = 570

 Score =  926 bits (2392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/570 (76%), Positives = 503/570 (88%), Gaps = 1/570 (0%)

Query: 1   MSLQIETIETKPYQDQKPGTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQDATLVVG 60
           MSL IE++ TKP+ DQKPGTSGLRKKT +F +EP+YTENFIQA+L+AIPEGS++ATLVVG
Sbjct: 1   MSLTIESVPTKPFDDQKPGTSGLRKKTKVFKDEPHYTENFIQAILEAIPEGSENATLVVG 60

Query: 61  GDGRFYNDVIMNKIAAISAANGVKKLIIGQNGLLSTPAASHIIRSYEEKVTGGIILTASH 120
           GDGR+YN+ +M  I AI+AANGV+K+I+GQNG+LSTPAASHIIRSY EK TGGIILTASH
Sbjct: 61  GDGRYYNNEVMQIIGAIAAANGVRKMILGQNGILSTPAASHIIRSYPEKCTGGIILTASH 120

Query: 121 NPGGPENDLGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKYG 180
           NPGGPEND GIKYNL+NGGPAPESVTNAI+E SK+LTHYKI+KNFP +D SK+GKDQKYG
Sbjct: 121 NPGGPENDFGIKYNLSNGGPAPESVTNAIFEKSKQLTHYKIVKNFPKIDFSKIGKDQKYG 180

Query: 181 PLLVDIIDVTKDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVD 240
           PLLVD++D T DYV  +KEIFDF+LIKKFI  QR TK +K+LFDSLNG+TGPYG+AIFV 
Sbjct: 181 PLLVDVVDSTADYVALMKEIFDFDLIKKFIDNQRSTKGFKILFDSLNGVTGPYGEAIFVK 240

Query: 241 EFDLPANEVLQNWHPKPDFGGLHPDPNLTYAKTLVERVDREKIEFGAASDGDGDRNMIYG 300
           E  LPA EVLQN+ PKPDFGGLHPDPNLTYA TLVERVD+E+I FGAASDGDGDRNMIYG
Sbjct: 241 ELGLPAEEVLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKEQIAFGAASDGDGDRNMIYG 300

Query: 301 AGPAFVSPGDSVAIIAEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHGLSCYEVPTG 360
            GPAFVSPGDSVAIIAEYASEIPYF KQGIYGLARSFPTSAAIDRVAK  GL+CYEVPTG
Sbjct: 301 CGPAFVSPGDSVAIIAEYASEIPYFKKQGIYGLARSFPTSAAIDRVAKEQGLACYEVPTG 360

Query: 361 WKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIVAWLNVLAIYNKHNPEKDASIKT 420
           WKFFCALFDAKKLSICGEESFGTGSNH+REKDG+WAIVAWLN+LAIYN+ +P+ D SIK 
Sbjct: 361 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIVAWLNILAIYNRDHPDSDVSIKV 420

Query: 421 IQEEFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFV-SKPNVIGSAFPGDESLTVVDA 479
           IQE+FW KYGRTFFTRYD+E +S+E A++V+ +L + V +K + +G  F G+ +LTV D 
Sbjct: 421 IQEKFWAKYGRTFFTRYDFEQVSSESAAQVLQVLEDLVAAKDSSVGKPFAGNPALTVADC 480

Query: 480 GDFSYTDLDGSVSDHQGLFFKLSNGARIVLRLSGTGSSGATIRIYVENYTDDKTKYEESA 539
           GDFSYTDLDGSVS+HQGL+ KLSNG R V+RLSGTGSSGATIR+YVE YTDD +KY    
Sbjct: 481 GDFSYTDLDGSVSEHQGLYAKLSNGCRFVVRLSGTGSSGATIRLYVEKYTDDASKYSLDV 540

Query: 540 QDFLAPTIKTVVKFLKFKEFIGTEEPTVRT 569
           + FL   IK+++KFLKF E++GT+EPTVRT
Sbjct: 541 EQFLGDDIKSILKFLKFCEYLGTDEPTVRT 570

>KLLA0B12694g 1107696..1109402 highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c PGM2
           phosphoglucomutase, major isoform, start by similarity
          Length = 568

 Score =  902 bits (2332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/570 (74%), Positives = 499/570 (87%), Gaps = 3/570 (0%)

Query: 1   MSLQIETIETKPYQDQKPGTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQDATLVVG 60
           MSL+  ++ T PY DQKPGTSGLRKKT +F   PNYTENFIQA+++AIPEGSQ ATLV+G
Sbjct: 1   MSLKTVSVATNPYPDQKPGTSGLRKKTKVFEETPNYTENFIQAIMEAIPEGSQGATLVIG 60

Query: 61  GDGRFYNDVIMNKIAAISAANGVKKLIIGQNGLLSTPAASHIIRSYEEKVTGGIILTASH 120
           GDGR+YNDV++ KIAAI +ANGV+K++IG NG+LSTPAASHIIR+Y EK TGGIILTASH
Sbjct: 61  GDGRYYNDVVIQKIAAIGSANGVRKIVIGHNGILSTPAASHIIRAYHEKCTGGIILTASH 120

Query: 121 NPGGPENDLGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKYG 180
           NPGGP ND GIKYNLANGGPAPESVTN+IW  S++LTHYKI+++FP +DL+K+G+DQKYG
Sbjct: 121 NPGGPTNDFGIKYNLANGGPAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYG 180

Query: 181 PLLVDIIDVTKDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVD 240
            LLVDI+D T  YV+ +KEIFDF LIK FI  Q +   +K+LFD++NG+TGPYG+A+FV 
Sbjct: 181 DLLVDIVDSTAAYVELMKEIFDFPLIKSFIDTQAKN-GFKILFDAMNGVTGPYGEALFVK 239

Query: 241 EFDLPANEVLQNWHPKPDFGGLHPDPNLTYAKTLVERVDREKIEFGAASDGDGDRNMIYG 300
           E  LP +  LQN+HPKPDFGGLHPDPNLTYA TLVERVD+  I+FGAASDGDGDRNMIYG
Sbjct: 240 ELGLPESS-LQNYHPKPDFGGLHPDPNLTYAHTLVERVDKYGIQFGAASDGDGDRNMIYG 298

Query: 301 AGPAFVSPGDSVAIIAEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHGLSCYEVPTG 360
           AGPAFVSPGDSVAIIAEYAS IPYF KQGIYGLARSFPTS+AIDRVAK  GL+CYEVPTG
Sbjct: 299 AGPAFVSPGDSVAIIAEYASAIPYFKKQGIYGLARSFPTSSAIDRVAKEQGLNCYEVPTG 358

Query: 361 WKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIVAWLNVLAIYNKHNPEKDASIKT 420
           WKFFCALFDAKKLSICGEESFGTGSNH+REKDG+WAI+AWLN+LAIYN+  P K+ASIK+
Sbjct: 359 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNQRFPNKEASIKS 418

Query: 421 IQEEFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFVSKPNVI-GSAFPGDESLTVVDA 479
           IQ +FW KYGRTFFTRYD+E++S+EDA KV+ LL N+V+ P  I G+ FP D+SLTVV+ 
Sbjct: 419 IQTDFWQKYGRTFFTRYDFENLSSEDAGKVILLLQNYVADPESIKGTKFPADDSLTVVEG 478

Query: 480 GDFSYTDLDGSVSDHQGLFFKLSNGARIVLRLSGTGSSGATIRIYVENYTDDKTKYEESA 539
           GDFSYTDLDGSVS HQGL+ +LSNG R V+RLSGTGSSGATIR+YVE YT+D +KYE++A
Sbjct: 479 GDFSYTDLDGSVSSHQGLYVRLSNGVRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQTA 538

Query: 540 QDFLAPTIKTVVKFLKFKEFIGTEEPTVRT 569
           ++FL   IKT++KFLKFKE IGTEEPTVRT
Sbjct: 539 EEFLGKDIKTILKFLKFKEAIGTEEPTVRT 568

>ABL029W [563] [Homologous to ScYKL127W (PGM1) - SH; ScYMR105C
           (PGM2) - SH] complement(343852..345558) [1707 bp, 568
           aa]
          Length = 568

 Score =  864 bits (2232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/569 (72%), Positives = 479/569 (84%), Gaps = 1/569 (0%)

Query: 1   MSLQIETIETKPYQDQKPGTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQDATLVVG 60
           MS+ IE++ TK + DQKPGTSGLRKKT +F    +YTENFIQA++++IPEGS++A LV+G
Sbjct: 1   MSITIESVPTKAFADQKPGTSGLRKKTKVFEQTEHYTENFIQAIMESIPEGSENAVLVIG 60

Query: 61  GDGRFYNDVIMNKIAAISAANGVKKLIIGQNGLLSTPAASHIIRSYEEKVTGGIILTASH 120
           GDGR+YND +M KIA + +ANGV+KLIIGQNGLLSTPAASHIIR+Y +KVTGGIILTASH
Sbjct: 61  GDGRYYNDAVMQKIAEVGSANGVRKLIIGQNGLLSTPAASHIIRTYHDKVTGGIILTASH 120

Query: 121 NPGGPENDLGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKYG 180
           NPGGP+ND GIKYNLANG PAPE VTN+++E S+ LTHYKI +  P LDL K+G++Q+YG
Sbjct: 121 NPGGPDNDFGIKYNLANGAPAPEKVTNSMFERSRNLTHYKITRGMPKLDLGKIGENQQYG 180

Query: 181 PLLVDIIDVTKDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVD 240
            LLVD+ID T+ YV  +KEIFDF LIKKF+   ++    K+LFD+LNGITGPYGKAIFVD
Sbjct: 181 NLLVDVIDPTEAYVRLMKEIFDFPLIKKFLEHAQKEYGLKVLFDALNGITGPYGKAIFVD 240

Query: 241 EFDLPANEVLQNWHPKPDFGGLHPDPNLTYAKTLVERVDREKIEFGAASDGDGDRNMIYG 300
           E  L + + LQN+ PKPDFGGLHPDPNLTYA TLV RVDRE I FGAASDGDGDRNMIYG
Sbjct: 241 ELGL-SEDSLQNFVPKPDFGGLHPDPNLTYAHTLVSRVDRENIAFGAASDGDGDRNMIYG 299

Query: 301 AGPAFVSPGDSVAIIAEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHGLSCYEVPTG 360
           AGPAFVSPGDSVAIIAEYASEIPYF+K GI+GLARSFPTS AID VAK   L CYEVPTG
Sbjct: 300 AGPAFVSPGDSVAIIAEYASEIPYFIKNGIHGLARSFPTSGAIDLVAKEKNLDCYEVPTG 359

Query: 361 WKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIVAWLNVLAIYNKHNPEKDASIKT 420
           WKFFC LFD+KKLSICGEESFGTGS+H+REKDGLWAIVAWLNVLAIY++ +P+++ SIKT
Sbjct: 360 WKFFCNLFDSKKLSICGEESFGTGSDHVREKDGLWAIVAWLNVLAIYHRRHPDREPSIKT 419

Query: 421 IQEEFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFVSKPNVIGSAFPGDESLTVVDAG 480
           IQEEFW KYGRTFFTRYD+E    EDA+KV++LL  F   P V+G  FP    ++V  AG
Sbjct: 420 IQEEFWAKYGRTFFTRYDFEECDTEDANKVIELLRTFAENPAVVGQPFPAWHEVSVSAAG 479

Query: 481 DFSYTDLDGSVSDHQGLFFKLSNGARIVLRLSGTGSSGATIRIYVENYTDDKTKYEESAQ 540
           DFSYTDLDGSVS+HQGL+ KLSNG R V+RLSGTGSSGATIR+YVE YT+D   Y ++A 
Sbjct: 480 DFSYTDLDGSVSEHQGLYIKLSNGTRYVVRLSGTGSSGATIRLYVERYTNDPAYYAQTAD 539

Query: 541 DFLAPTIKTVVKFLKFKEFIGTEEPTVRT 569
            FLAP IK V+KFL+FK+ IGTEEPTVRT
Sbjct: 540 QFLAPDIKAVLKFLRFKDLIGTEEPTVRT 568

>Kwal_27.10258
          Length = 620

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 121/504 (24%), Positives = 200/504 (39%), Gaps = 97/504 (19%)

Query: 19  GTSGLRKKTAIFMNEPNYTENFIQA-------MLDAIPEGSQDATLVVGGDGRFYNDVIM 71
           GT+GLR K     +  N T   +QA       + +  PE   + T+ VG D RF +    
Sbjct: 55  GTAGLRSKMEAGFSRMN-TLTVLQASQGLAKYIAEKFPE---NKTVAVGHDHRFNSRDFA 110

Query: 72  NKIAAISAANGVKKLIIGQNG------LLSTPAASHIIRSYEEKVTGGIILTASHNPGGP 125
              +        K   +G N        + TP     I       + G+++TASHN   P
Sbjct: 111 EVTSVAFLQLRFKVYSLGFNADPKKDAFVHTPMVPFAIDRL--GASAGVMITASHN---P 165

Query: 126 ENDLGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGK-------DQK 178
           + D G K   +NG          I     +L    I+ N  P + +   K       ++ 
Sbjct: 166 KMDNGYKVYYSNGC--------QIIPPHDRLIAQSILDNLNPWERAWDCKAVIAEATEKG 217

Query: 179 YGPLLVDIIDVTKDYVD-FLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAI 237
           Y       +D+ K  VD ++KEI D +L+   I  +  +K W  ++  L+G+    G  I
Sbjct: 218 Y------FVDMKKPMVDHYVKEISD-KLVSSDIGDR--SKPW-FVYTPLHGV----GFEI 263

Query: 238 FVDEFDLPANEVL------------QNWHPKPDFGGLH-PDPNLTYAKTL-VERVDREKI 283
               F+  A+EVL            ++  P P F  +  P+P    A  L +   D+  I
Sbjct: 264 ----FERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEAGALDLAIALADKNGI 319

Query: 284 EFGAASDGDGDR--NMIYGAGPAFVSPGDSVAII------AEYASEIPYFVKQGIYGLAR 335
            F   +D D DR    +   G      G+ +  +       +Y  E   F  +    L  
Sbjct: 320 SFVLGNDPDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALIN 379

Query: 336 SFPTSAAIDRVAKAHGLSCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNH 387
           S  +S  I ++A        +  TG+K+      A++L   G       EE+ G   S+ 
Sbjct: 380 STVSSQMIKKLAGVEKFHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAIGFMFSDI 437

Query: 388 IREKDGLWAIVAWLNVLAIYNKHNPEKDASIKTIQEEFWNKYGRTFFTRYD-YEHISNED 446
           + +KDG+ A V +L +L  + K   +  + I  +Q  F  KYG   F  Y+ Y  + +  
Sbjct: 438 VHDKDGVSAAVVFLQMLWSWKK---QALSPIDVLQSAF-GKYG--VFKEYNGYYTVPDLS 491

Query: 447 ASKVV--DLLNNFVSKPNVIGSAF 468
            +  +  D+ +++ S P  IG+ F
Sbjct: 492 LTDRIFSDIRSSYDSYPKHIGNQF 515

>CAGL0M02981g 335863..337716 similar to sp|Q03262 Saccharomyces
           cerevisiae YMR278w, hypothetical start
          Length = 617

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 122/549 (22%), Positives = 211/549 (38%), Gaps = 74/549 (13%)

Query: 19  GTSGLRKKTAIFMNEPN------YTENFIQAMLDAIPEGSQDATLVVGGDGRFYNDVIMN 72
           GT+GLR +     N  N       ++     + D  P   Q+ T VVG D R+++     
Sbjct: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFP---QNLTAVVGHDHRYHSQEFAQ 109

Query: 73  KIAAISAANGVKKLIIG-QNGLLSTPAASHIIRSYEEKVTGGIILTASHNPGGPENDLGI 131
             AA     G K   +   +  + TP   + +      V  G+++TASHN   P+ D G 
Sbjct: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHLNASV--GVMITASHN---PKMDNGY 164

Query: 132 KYNLANGGPAPESVTNAIWE-VSKKLTHYKIIKNFPPLDLSKMGKDQKYGPLLVDIIDVT 190
           K    NG        + I E ++  L  +    NF  + LS    D K   +   ++   
Sbjct: 165 KVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKI-LSNAETDGKIEYVRKRML--- 220

Query: 191 KDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVDEFDLPAN--- 247
                +L  + + +LI++      E K W  ++  ++G+       I  +  +L  N   
Sbjct: 221 ---TSYLNSVVN-QLIQRDFAAPDE-KPW-FVYTPMHGVGHQIFSTILNESLNLKDNIDY 274

Query: 248 -EVLQNWHPKPDFGGLH-PDPN----LTYAKTLVERVDREKIEFGAASDGDGDRNMIY-- 299
             V +   P P F  +  P+P     L  A TL E      I+   A+D + DR  +   
Sbjct: 275 ITVPEQKDPDPSFRTVSFPNPEEKGALNLAITLAE---ANGIKLVLANDPNADRFSVAVR 331

Query: 300 --GAGPAFVSPGDSVAII------AEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHG 351
                      G+ + ++        Y       +K     +  S  ++  I R+A+  G
Sbjct: 332 DDSKNEWKQLTGNEIGLLFAFYEFKMYQKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEG 391

Query: 352 LSCYEVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHI-REKDGLWAIVAWLNV 403
               +  TG+K+     +A KL   G       EE+ G     +  +KDG+ A + +L  
Sbjct: 392 FLYKDTLTGFKWIGN--EAAKLEEKGYFVPFGYEEAIGYMFPAMEHDKDGVSAAIVFLQA 449

Query: 404 LA--IYNKHNPEKDASIKTIQEEFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFVSKP 461
            A  + +  NP        I  E ++KYG +    Y+  +I + D SK   +  +  S  
Sbjct: 450 YANWLQSSSNP------IDIIHECYDKYGVS--AEYNGYYIVS-DPSKTDKVFESIRSSY 500

Query: 462 NVIGSAFPGD--ESLTVVDAGDFSYTDLDGSVSDHQGLFFKLSNGARIVLRL--SGTGSS 517
             +G +FP    E   V +  D +    D + +D + L     N   I +    SG  ++
Sbjct: 501 TSMGLSFPESIGEHFRVTEFRDLT-IGFDSTTADKKPLLPVDKNSQMITITAVPSGASNT 559

Query: 518 GATIRIYVE 526
           G ++R  + 
Sbjct: 560 GESVRFTIR 568

>KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 589

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 26/49 (53%)

Query: 195 DFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVDEFD 243
           D    + + +L + FI +   T N K++FD   G++  YG   FV+E +
Sbjct: 156 DLAPNVTEAQLFELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEME 204

>AEL112C [2394] [Homologous to ScYJL162C - SH] (412116..413723)
           [1608 bp, 535 aa]
          Length = 535

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 7/64 (10%)

Query: 330 IYGLARSFPTSAAIDRVAKAHGLSCYEVPTGWKFFCALFDAKKLSICGEE--SFGTGSNH 387
           +Y + R  PT  A+D       +S  E+PT   F C + D   + +C E+   F T +N 
Sbjct: 408 VYKIDRIPPTEFAMDL-----SVSDIELPTMPSFHCNILDKSDIKLCREKILEFNTKANR 462

Query: 388 IREK 391
           ++++
Sbjct: 463 LKKQ 466

>KLLA0D01573g complement(139183..141006) similar to sp|Q03262
           Saccharomyces cerevisiae YMR278w singleton, start by
           similarity
          Length = 607

 Score = 33.1 bits (74), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 75/188 (39%), Gaps = 35/188 (18%)

Query: 19  GTSGLRKKTAIFMNEPNY------TENFIQAMLDAIPEGSQDATLVVGGDGRFYNDVIMN 72
           GT+GLR +     N  N       ++   + +    PE   + T+VVG D R +N  +  
Sbjct: 57  GTAGLRGRMEAGFNRMNALTVKQASQGLAKYIKKQFPE---NLTVVVGHDHR-HNSRLFG 112

Query: 73  KIAAISAAN-GVKKLIIG---QNGLLSTPAASHIIRSYEEKVTGGIILTASHNPGGPEND 128
           K+   +    G K   +    +  L+ TP     + +    V  GI++TASHN   P+ D
Sbjct: 113 KVTVDTFLQLGFKVFHLNHENEKSLVHTPLVPFTVNATGASV--GIMITASHN---PKMD 167

Query: 129 LGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKYGPLLVDIID 188
            G K    NG          I     KL    II N  P    + G        ++D  +
Sbjct: 168 NGYKVYYTNGC--------QIIPPHDKLIAESIIHNLEPFSSPQTGT-------IIDCKE 212

Query: 189 -VTKDYVD 195
            +TK Y+D
Sbjct: 213 KMTKKYID 220

>Scas_696.42
          Length = 625

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 48/108 (44%), Gaps = 6/108 (5%)

Query: 19  GTSGLRKKTAIFMNEPN--YTENFIQAMLDAIPEG-SQDATLVVGGDGRFYNDVIMNKIA 75
           GT+GLR +     +  N        Q + + I E    + T VVG D RF++       A
Sbjct: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTA 117

Query: 76  AISAANGVKKLIIG-QNGLLSTPAASHIIRSYEEKVTGGIILTASHNP 122
           +I    G K   +   +  + TP     + + +  V  G+++TASHNP
Sbjct: 118 SIFLRAGFKVFYLTPDDQFVHTPLVPFSVLNLKASV--GVMITASHNP 163

>Sklu_1870.5 YFL029C, Contig c1870 6101-7144
          Length = 347

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 62/142 (43%), Gaps = 16/142 (11%)

Query: 25  KKTAIFMNEPNYTENFIQAMLDAIPEGSQDATLVVGGDGRFYND---VIMNKIAAISAAN 81
           K   +F+  P Y +N  Q ML    +  ++  L+   DGR   D    ++NK+    A +
Sbjct: 63  KLDTMFLVFPYYEQNLYQYMLTQFKKKRKNMYLLSDEDGRENGDEEFRLINKMDINHAID 122

Query: 82  GVKKLIIGQNGLLSTPAASHIIRSYEEKVTGGIILTASHNPGGPE---NDLGIKYNLANG 138
            +K+L    +  L    +  II  + +     +++  SH  G P+    D GI Y+  + 
Sbjct: 123 FIKQL----SQALRFVHSHRII--HRDLKPQNVMVDTSHKTGIPQLVLTDFGIAYDTKHP 176

Query: 139 GPAPE----SVTNAIWEVSKKL 156
              P+     V+ +I++  + L
Sbjct: 177 QEPPDDKITDVSTSIYKAPELL 198

>YMR278W (YMR278W) [4232] chr13 (822762..824630) Protein containing
           a phosphoglucomutase or phosphomannomutase
           alpha-beta-alpha domain I, has high similarity to
           uncharacterized C. albicans Orf6.8892p [1869 bp, 622 aa]
          Length = 622

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 59/140 (42%), Gaps = 15/140 (10%)

Query: 19  GTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQ----DATLVVGGDGRFYNDVIMNKI 74
           GT+GLR +     +  N T   IQA         Q    +   VVG D RF++       
Sbjct: 56  GTAGLRSQMQAGFSRMN-TLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARAT 114

Query: 75  AAISAANGVKKLIIG-QNGLLSTPAASHIIRSYEEKVTGGIILTASHNPGGPENDLGIKY 133
           AA     G K   +   +  + TP     +     K + G+++TASHN   P+ D G K 
Sbjct: 115 AAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMITASHN---PKMDNGYKV 169

Query: 134 NLANGG----PAPESVTNAI 149
             +NG     P   +++++I
Sbjct: 170 YYSNGCQIIPPHDHAISDSI 189

>CAGL0G02541g 231428..235315 similar to sp|P36168 Saccharomyces
           cerevisiae YKR096w, start by similarity
          Length = 1295

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%)

Query: 361 WKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIVAWLNVLAIYNKHNPEKDASIKT 420
           W +F      K  ++  EES    S+ +R    L +IV++LNVL  Y   N      I +
Sbjct: 798 WTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIAYALDNSYYSTLISS 857

Query: 421 IQEEF 425
           I EE 
Sbjct: 858 ISEEL 862

>CAGL0H02123g complement(188454..190121) similar to sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 555

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 24/49 (48%)

Query: 195 DFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVDEFD 243
           D    + + +L   FI+K   T + K+++D L GI+  YG   F    D
Sbjct: 196 DLAPSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMD 244

>YDL205C (HEM3) [669] chr4 complement(92763..93746) Porphobilinogen
           deaminase (pre-uroporphyrinogen synthase), catalyzes the
           third step in porphyrin biosynthesis pathway [984 bp,
           327 aa]
          Length = 327

 Score = 30.0 bits (66), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/97 (20%), Positives = 46/97 (47%), Gaps = 9/97 (9%)

Query: 381 FGTGSNHIREKDGLWAIVAWLNVLAIYNKHNPEKDASIKTIQ--------EEFWNKYGRT 432
            G  + HI  +    A++   +VL +  +  P+ D  + T+Q        +  ++  G+ 
Sbjct: 1   MGPETLHIGGRKSKLAVIQSNHVLKLIEEKYPDYDCKVFTLQTLGDQIQFKPLYSFGGKA 60

Query: 433 FFTRYDYEHISNEDASKVVDLL-NNFVSKPNVIGSAF 468
            +T+   +H+ ++D SK +DL+ ++    P ++   F
Sbjct: 61  LWTKELEDHLYHDDPSKKLDLIVHSLKDMPTLLPEGF 97

>Kwal_55.20154
          Length = 522

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 24/47 (51%)

Query: 195 DFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVDE 241
           D    + + +L + FI +   T N K++FD + G++  YG   F  E
Sbjct: 141 DVAPNVTEAQLFELFISRYASTLNAKIVFDQMTGVSKGYGFVKFGQE 187

>Sklu_1994.2 YMR278W, Contig c1994 3654-5528
          Length = 624

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 55/133 (41%), Gaps = 22/133 (16%)

Query: 19  GTSGLRKKTAIFMNEPNYTENFIQA-------MLDAIPEGSQDATLVVGGDGRFYNDVIM 71
           GT+GLR +     +  N T   +QA       +    PE   + +++VG D R++++   
Sbjct: 55  GTAGLRSRMEAGFSRMN-TLTVLQASQGLASYIKSQFPE---NLSVIVGHDHRYHSNEFA 110

Query: 72  NKIAAISAANGVKKLIIGQNG------LLSTPAASHIIRSYEEKVTGGIILTASHNPGGP 125
                     G K   +  +        + TP     I   +   + GI++TASHN   P
Sbjct: 111 RVTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTIN--QLNASAGIMITASHN---P 165

Query: 126 ENDLGIKYNLANG 138
           + D G K   +NG
Sbjct: 166 KMDNGYKVYYSNG 178

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.137    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,416,664
Number of extensions: 964837
Number of successful extensions: 2403
Number of sequences better than 10.0: 29
Number of HSP's gapped: 2445
Number of HSP's successfully gapped: 29
Length of query: 569
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 462
Effective length of database: 12,891,983
Effective search space: 5956096146
Effective search space used: 5956096146
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)