Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_720.14d19619610451e-147
Kwal_56.239583561111333e-09
AFL072C3141541156e-07
KLLA0E19393g3361201156e-07
YGL081W32078971e-04
Sklu_2440.2263163651.9
Sklu_2437.732744623.2
Scas_609.12138579616.6
KLLA0F14256g96683606.8
YNL091W (NST1)1240137607.4
Scas_270.118556588.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_720.14d
         (196 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_720.14d                                                          407   e-147
Kwal_56.23958                                                          56   3e-09
AFL072C [3121] [Homologous to ScYGL081W - SH] (300464..301408) [...    49   6e-07
KLLA0E19393g 1720040..1721050 no similarity, hypothetical start        49   6e-07
YGL081W (YGL081W) [1901] chr7 (357378..358340) Protein containin...    42   1e-04
Sklu_2440.22 YDR419W, Contig c2440 40876-42771                         30   1.9  
Sklu_2437.7 YOL096C, Contig c2437 14114-15097                          28   3.2  
Scas_609.12                                                            28   6.6  
KLLA0F14256g 1321231..1324131 weakly similar to sp|P12954 Saccha...    28   6.8  
YNL091W (NST1) [4500] chr14 (452408..456130) Protein involved in...    28   7.4  
Scas_270.1                                                             27   8.4  

>Scas_720.14d
          Length = 196

 Score =  407 bits (1045), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 196/196 (100%), Positives = 196/196 (100%)

Query: 1   MNDDRSSLHYYNPRGKGRYIEIMTTHFKRNIYFKEQEALREEGINIPIGYGDPQIANLEF 60
           MNDDRSSLHYYNPRGKGRYIEIMTTHFKRNIYFKEQEALREEGINIPIGYGDPQIANLEF
Sbjct: 1   MNDDRSSLHYYNPRGKGRYIEIMTTHFKRNIYFKEQEALREEGINIPIGYGDPQIANLEF 60

Query: 61  SNSALEKKHARLVIKMFPSVSNEGIPVPNFRAHVEDLTEGNGIVDLYSKKDPSFNNIVEL 120
           SNSALEKKHARLVIKMFPSVSNEGIPVPNFRAHVEDLTEGNGIVDLYSKKDPSFNNIVEL
Sbjct: 61  SNSALEKKHARLVIKMFPSVSNEGIPVPNFRAHVEDLTEGNGIVDLYSKKDPSFNNIVEL 120

Query: 121 KNGESFAISGKDNTMNDQEATLFISVTVSFIHGDIFLCEVRPSLPWSTNHRKELEISNTS 180
           KNGESFAISGKDNTMNDQEATLFISVTVSFIHGDIFLCEVRPSLPWSTNHRKELEISNTS
Sbjct: 121 KNGESFAISGKDNTMNDQEATLFISVTVSFIHGDIFLCEVRPSLPWSTNHRKELEISNTS 180

Query: 181 KFKRRDWNPIKFCIPS 196
           KFKRRDWNPIKFCIPS
Sbjct: 181 KFKRRDWNPIKFCIPS 196

>Kwal_56.23958
          Length = 356

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 60/111 (54%), Gaps = 16/111 (14%)

Query: 29  RNIYF--KEQEALREEGINIPIG---YGDPQIA----NLEFSNSALEKKHARLVIK-MFP 78
           R I F  KE E     G+  PIG   + DPQ +    N  +   +L KKHA L IK + P
Sbjct: 10  RKITFNIKETEGA---GLQFPIGRASFKDPQRSDRNDNFMYHEKSLSKKHAMLCIKRLIP 66

Query: 79  SVSNEGIPV-PNFRAHVEDLTEGNGIVDLYSKKDPSFNNIVELKNGESFAI 128
           S  +  +P+   FR  V+DL   +G+VDL S+   S  +I++LKNGE F +
Sbjct: 67  SDDDPFVPLLCQFRISVQDLGSTHGLVDLQSQD--SEASIIDLKNGERFGL 115

>AFL072C [3121] [Homologous to ScYGL081W - SH] (300464..301408) [945
           bp, 314 aa]
          Length = 314

 Score = 48.9 bits (115), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 69/154 (44%), Gaps = 19/154 (12%)

Query: 20  IEIMTTHFKRNIYFKEQEALREEGINIPIGYGDPQIA-------NLEFSNSALEKKHARL 72
           +E   +H +R + F   E L E      IG    + A       NL F+  +L K+HA L
Sbjct: 1   MEHFGSHEQRRLIFNINEGLAE-----VIGRASERDAERVARADNLFFAERSLSKQHAML 55

Query: 73  VIKMF--PSVSNEGIPVPNFRAHVEDLTEGNGIVDLYSKKDPSFNNIVELKNGESFAISG 130
            +K F  P  + +G    N R  VEDL   +G+VDL S      + +++LKNGE F +  
Sbjct: 56  YVKRFTGPGGAQDG-DEENIRIWVEDLGSTHGLVDLQSTAR-GVSQLIDLKNGERFGVVY 113

Query: 131 KDNTMNDQE---ATLFISVTVSFIHGDIFLCEVR 161
            D  +   +   A L   V V    G ++   VR
Sbjct: 114 MDKPITSTQSRGARLKFQVNVMQKQGPLWELLVR 147

>KLLA0E19393g 1720040..1721050 no similarity, hypothetical start
          Length = 336

 Score = 48.9 bits (115), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 58/120 (48%), Gaps = 15/120 (12%)

Query: 19  YIEIMTTHFKRNIYFKEQEALREEGINIPIG-------YGDPQIANLEFSNSALEKKHAR 71
           Y  I T H  R I F         GI + IG             +NL F +  L  +HA+
Sbjct: 2   YQFIKTPHTTRTIEFNGSH-----GIEVIIGKEVKEDESKHSSESNLIFDDDDLFVEHAK 56

Query: 72  LVIKMFPSVSNE-GIP--VPNFRAHVEDLTEGNGIVDLYSKKDPSFNNIVELKNGESFAI 128
           LV+K  P  ++E  +P  + +FR ++E L + + IVDL S    +   I++LKNG+ F +
Sbjct: 57  LVVKKLPPTNDEESLPMNIDSFRIYLESLGDADRIVDLESADSNTDGKIIDLKNGDRFGL 116

>YGL081W (YGL081W) [1901] chr7 (357378..358340) Protein containing a
           forkhead associated (FHA) domain, which bind
           phosphopeptides [963 bp, 320 aa]
          Length = 320

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 57  NLEFSNSALEKKHARLVIKMFPSVSNEGIP-VPNFRAHVEDLTEGNGIVDLYSKKDPSFN 115
           NL F    L ++HA L IK  P    EG+P +   R  + DL    G V+L S      N
Sbjct: 40  NLYFDEPELSRQHAVLCIKT-PIPKIEGVPSIEQLRICIRDLNNKTGTVNLVSDGP---N 95

Query: 116 NIVELKNGESFAISGKDN 133
           + ++LKNG++F +   DN
Sbjct: 96  DEIDLKNGDAFGLIAIDN 113

>Sklu_2440.22 YDR419W, Contig c2440 40876-42771
          Length = 631

 Score = 29.6 bits (65), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 135 MNDQEATLFISVTVSFIHGDIFLCEVRPSLPWSTNHRKELEISN-TSKFKRRDWNPIKFC 193
           M D+E   F S+   F+HGD  + ++ P +P   + + E  + N  ++    DW+ I FC
Sbjct: 172 MLDEEIKGFDSLRKQFVHGDYDIDDLLPPIPRDLDIQFEGYVYNPENRPLFEDWDDIIFC 231

Query: 194 IPS 196
           + S
Sbjct: 232 LNS 234

>Sklu_2437.7 YOL096C, Contig c2437 14114-15097
          Length = 327

 Score = 28.5 bits (62), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 21/44 (47%)

Query: 87  VPNFRAHVEDLTEGNGIVDLYSKKDPSFNNIVELKNGESFAISG 130
           VP+   H+E   +   IVD +S+  P    +V LK    F + G
Sbjct: 264 VPDGTHHLEKYIDSREIVDWFSQNKPGQFELVNLKGAMYFPLQG 307

>Scas_609.12
          Length = 1385

 Score = 28.1 bits (61), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 8/79 (10%)

Query: 32  YFKEQEALREEGINIP-IGYGDPQIANLEFSNSALEKKHARLVIKMFPSVSNEGIPVPNF 90
           Y K+QE   ++ + IP +   DP I+ +  S+   ++    LV     S+    I V   
Sbjct: 219 YNKDQEDF-QQTVKIPSVALPDPSISTISSSDGTTKETATWLVTDFMQSLQETNISVDFL 277

Query: 91  RAHVEDLTEGNGIVDLYSK 109
                 L + NG VDL  K
Sbjct: 278 ------LQKANGFVDLLKK 290

>KLLA0F14256g 1321231..1324131 weakly similar to sp|P12954
           Saccharomyces cerevisiae YJL092w HPR5 ATP-dependent DNA
           helicase, start by similarity
          Length = 966

 Score = 27.7 bits (60), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 9/83 (10%)

Query: 74  IKMFPSVSNEGIPVP--NFRAHVEDLTE----GNGIVDL--YSKKDPSFNNIVE-LKNGE 124
           +   PS++   IP    + R  +EDL E    G    DL   S     F+NI E L+  E
Sbjct: 644 VVFIPSINEGLIPFTEQSARQRLEDLAELRRDGEACNDLNNCSMGSGEFDNIKEELRGKE 703

Query: 125 SFAISGKDNTMNDQEATLFISVT 147
           S  I   + T+N++    F+++T
Sbjct: 704 SDLIDDLETTLNEERRIFFVALT 726

>YNL091W (NST1) [4500] chr14 (452408..456130) Protein involved in
           regulation of salt tolerance, has similarity to Uso1p
           and human NF2 neurofibromatosis type 2 gene product
           [3723 bp, 1240 aa]
          Length = 1240

 Score = 27.7 bits (60), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 63/137 (45%), Gaps = 31/137 (22%)

Query: 26  HFKRNIYFKEQEA---------LREEGIN-IPIGYGDPQI-ANL-EFSNSALEKKHA--- 70
           HFK+    K+++A         L EE +N I I     +I AN    S+  L++K++   
Sbjct: 219 HFKQKQLSKQEQAHNETADNTSLLEENLNNIHINKTSSEISANFNSVSDEELQQKYSNFT 278

Query: 71  RLVIKMFPSVSNEGIP----VPNFRAHVEDLTEGNGIVDLYSKKDPSFNNIVE--LKNGE 124
           +  I   P ++ E +      PN RA  +DL   NG           F N +E  +++G+
Sbjct: 279 KTFISSHPKIAEEYVQKMMMYPNIRALTDDLMNSNG---------QGFLNAIEDFVRDGQ 329

Query: 125 SFAISGKDNTMNDQEAT 141
               S KD+++ + EA+
Sbjct: 330 -IQASKKDDSITEDEAS 345

>Scas_270.1
          Length = 185

 Score = 26.9 bits (58), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%)

Query: 136 NDQEATLFISVTVSFIHGDIFLCEVRPSLPWSTNHRKELEISNTSKFKRRDWNPIK 191
           ND +  L I V     HG  ++ ++ P L   TN   + ++ +T +F+  D + IK
Sbjct: 65  NDSKEILKIGVESGGCHGYQYVLKLIPELTEGTNTCLQGKMEDTDEFEHNDIDSIK 120

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,237,679
Number of extensions: 326926
Number of successful extensions: 879
Number of sequences better than 10.0: 24
Number of HSP's gapped: 876
Number of HSP's successfully gapped: 24
Length of query: 196
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 100
Effective length of database: 13,272,781
Effective search space: 1327278100
Effective search space used: 1327278100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)