Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_719.473973936940.0
YLR381W (CTF3)7337648244e-99
CAGL0H05027g7021873984e-40
AER042W6762373087e-29
KLLA0E05291g6243642622e-23
Kwal_23.34856881822339e-20
Kwal_27.1141033187780.28
KLLA0E16126g1969130731.5
AFR420W2462103712.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_719.4
         (739 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_719.4                                                           1427   0.0  
YLR381W (CTF3) [3760] chr12 (879723..881924) Kinetochore protein...   322   4e-99
CAGL0H05027g 481654..483762 similar to tr|Q12748 Saccharomyces c...   157   4e-40
AER042W [2547] [Homologous to ScYLR381W - SH] complement(709326....   123   7e-29
KLLA0E05291g complement(479196..481070) weakly similar to sgd|S0...   105   2e-23
Kwal_23.3485                                                           94   9e-20
Kwal_27.11410                                                          35   0.28 
KLLA0E16126g complement(1432567..1438476) similar to sp|P50077 S...    33   1.5  
AFR420W [3612] [Homologous to ScYKL203C (TOR2) - SH; ScYJR066W (...    32   2.4  

>Scas_719.4
          Length = 739

 Score = 1427 bits (3694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 710/739 (96%), Positives = 710/739 (96%)

Query: 1   MSIELDATIENLTNANSTTPNTQLKAELNELYTLSRKHGLTSTNLIKLITFICHSGLLSE 60
           MSIELDATIENLTNANSTTPNTQLKAELNELYTLSRKHGLTSTNLIKLITFICHSGLLSE
Sbjct: 1   MSIELDATIENLTNANSTTPNTQLKAELNELYTLSRKHGLTSTNLIKLITFICHSGLLSE 60

Query: 61  ETKLIIIKKYLLPNGYINKSVIDLIVKNLGQPTSTKQKYPSKELQAALCNWLVHISILIP 120
           ETKLIIIKKYLLPNGYINKSVIDLIVKNLGQPTSTKQKYPSKELQAALCNWLVHISILIP
Sbjct: 61  ETKLIIIKKYLLPNGYINKSVIDLIVKNLGQPTSTKQKYPSKELQAALCNWLVHISILIP 120

Query: 121 KYTIDLSVWSHLWQFHYLQRSVXXXXXXXXXXXXXXKPWKLKILEQIALNPGYENSEAYA 180
           KYTIDLSVWSHLWQFHYLQRSV              KPWKLKILEQIALNPGYENSEAYA
Sbjct: 121 KYTIDLSVWSHLWQFHYLQRSVTLILIWFTTLTTEIKPWKLKILEQIALNPGYENSEAYA 180

Query: 181 TLILRRYLTLLEKSNRIQALIKTIDCDIKFIKVLQSFQFEDEFRRNLKKVLIAVNPIEFN 240
           TLILRRYLTLLEKSNRIQALIKTIDCDIKFIKVLQSFQFEDEFRRNLKKVLIAVNPIEFN
Sbjct: 181 TLILRRYLTLLEKSNRIQALIKTIDCDIKFIKVLQSFQFEDEFRRNLKKVLIAVNPIEFN 240

Query: 241 KRSIEKSLRYQIIQLQDDPERPLQLIYKERYSDNEIIQLEEIACLGELQRRWGEIELPKS 300
           KRSIEKSLRYQIIQLQDDPERPLQLIYKERYSDNEIIQLEEIACLGELQRRWGEIELPKS
Sbjct: 241 KRSIEKSLRYQIIQLQDDPERPLQLIYKERYSDNEIIQLEEIACLGELQRRWGEIELPKS 300

Query: 301 GEAIFTNENNLAIQFYPMVLTRSRHDNNDVQLEQFWSKMYEWISTQLTRCFQDKKMKSLE 360
           GEAIFTNENNLAIQFYPMVLTRSRHDNNDVQLEQFWSKMYEWISTQLTRCFQDKKMKSLE
Sbjct: 301 GEAIFTNENNLAIQFYPMVLTRSRHDNNDVQLEQFWSKMYEWISTQLTRCFQDKKMKSLE 360

Query: 361 KITVFDHIMKGCQLHTNLIRKVIDEFLILENLSANKDLFMSICTIVFPIIRRPGINDEME 420
           KITVFDHIMKGCQLHTNLIRKVIDEFLILENLSANKDLFMSICTIVFPIIRRPGINDEME
Sbjct: 361 KITVFDHIMKGCQLHTNLIRKVIDEFLILENLSANKDLFMSICTIVFPIIRRPGINDEME 420

Query: 421 STNFQKKILQIINICNLSNNTNSEIKIWSTSQNTILSIVSNSIILMLKNWLLESDVDMAL 480
           STNFQKKILQIINICNLSNNTNSEIKIWSTSQNTILSIVSNSIILMLKNWLLESDVDMAL
Sbjct: 421 STNFQKKILQIINICNLSNNTNSEIKIWSTSQNTILSIVSNSIILMLKNWLLESDVDMAL 480

Query: 481 ISYVLDILNDIRKVLLSNLVHSVENRHXXXXXXXXXXXXXXXATNFHEQFNDPETPDEIV 540
           ISYVLDILNDIRKVLLSNLVHSVENRH               ATNFHEQFNDPETPDEIV
Sbjct: 481 ISYVLDILNDIRKVLLSNLVHSVENRHITITTISLLDLLSFIATNFHEQFNDPETPDEIV 540

Query: 541 QQYLKQIILKNSTMNKLCTIDDPLLLNACCRYLVSVKELLVYREPDDLYVQLQNQYILDL 600
           QQYLKQIILKNSTMNKLCTIDDPLLLNACCRYLVSVKELLVYREPDDLYVQLQNQYILDL
Sbjct: 541 QQYLKQIILKNSTMNKLCTIDDPLLLNACCRYLVSVKELLVYREPDDLYVQLQNQYILDL 600

Query: 601 TNYLWRNRIYKSKKIFNIPSKFIKEVVKNLYLPDINSKTSAIFSIFGIPSTSYLSQQALD 660
           TNYLWRNRIYKSKKIFNIPSKFIKEVVKNLYLPDINSKTSAIFSIFGIPSTSYLSQQALD
Sbjct: 601 TNYLWRNRIYKSKKIFNIPSKFIKEVVKNLYLPDINSKTSAIFSIFGIPSTSYLSQQALD 660

Query: 661 QLERNNSVTMNYCELITEEGFKRFTSELSDKSLWISNISDFNQLKPELLKIISTMQCYNH 720
           QLERNNSVTMNYCELITEEGFKRFTSELSDKSLWISNISDFNQLKPELLKIISTMQCYNH
Sbjct: 661 QLERNNSVTMNYCELITEEGFKRFTSELSDKSLWISNISDFNQLKPELLKIISTMQCYNH 720

Query: 721 IALFLFTYLKSLSKYNEVL 739
           IALFLFTYLKSLSKYNEVL
Sbjct: 721 IALFLFTYLKSLSKYNEVL 739

>YLR381W (CTF3) [3760] chr12 (879723..881924) Kinetochore protein
           required for chromosome segregation during mitosis [2202
           bp, 733 aa]
          Length = 733

 Score =  322 bits (824), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 233/764 (30%), Positives = 384/764 (50%), Gaps = 63/764 (8%)

Query: 1   MSIELDATIENLTNANSTTPNTQLKAELNELYTLSRKHGLTSTNLIKLITFICHSGLLSE 60
           MS+ LD  I +LTNAN  TP   LK  L+ LY  S+++GL+S  L  L+  +C + ++  
Sbjct: 1   MSLILDDIILSLTNANERTPPQALKTTLSLLYEKSKQYGLSSPQLQALVRLLCETSIIDT 60

Query: 61  ETKLIIIKKYLLPNGYINKSVIDLIVKNLGQPT--STKQKYPSKELQAALCNWLVHISIL 118
            TK+ I++   LP+GY+ K ++  I+ +LG PT  S  +      LQ+ALC WLVH+  L
Sbjct: 61  VTKVYIVENCFLPDGYLTKELLLEIINHLGTPTVFSRYRIQTPPVLQSALCKWLVHVYFL 120

Query: 119 IP-----KYTIDLSVWSHLWQFHYLQRSVXXXXXXXXXXXXXXKPWKLKILEQIALNPGY 173
            P     ++ I  S+W HLWQF +LQ+ +              KPWKL I+++ A++PGY
Sbjct: 121 FPVHSEREHNISSSIWLHLWQFSFLQKWITPLVIWQATTPVDVKPWKLSIIKRCAMHPGY 180

Query: 174 ENSEAYATLILRRYLTLLEKSNRIQALIKTIDCDIKFIKVLQSFQFEDEFRRNLKKVLIA 233
            ++   ATLIL+R+  L+  S++I   I TI+C+ K +K  ++ + +  F   LK++L  
Sbjct: 181 RDAPGSATLILQRFQCLVGASSQITESIITINCNRKTLKSHRNLKLDAHFLSILKRILSR 240

Query: 234 VNPIEFNKRSIEKSLRY---QIIQLQDDPERPLQLIYKERY-SDNEIIQLEEIACLGELQ 289
            +P  F   +++ ++     +I QL  D   PL+L     Y   +  + L ++  L +L 
Sbjct: 241 AHPANFPADTVQNTIDMYLSEIHQLGADSIYPLRLQSLPEYVPSDSTVSLWDVTSLEQLA 300

Query: 290 RRWGEIELPKSGEAIFTNENNLAIQFYPMVLTRS--RHDNNDVQL----EQFWSKMYEWI 343
           + W ++ +P   + +     N  +     V++R   +H  + + L        S  YEW 
Sbjct: 301 QNWPQLHIPNDVDYMMKPSLNSNVLLPRKVMSRDSLKHLYSSIILIKNSRDESSSPYEWC 360

Query: 344 STQLTRCFQDKKMKSLEKITVFDHIMKGCQLHTNLIRKVIDEFLILENLSANKDLFMSIC 403
             QL RCF  +     E I +   I+    +   L  ++I  F  L+ L  ++     +C
Sbjct: 361 IWQLKRCFAHQIETPQEVIPI---IISVSSMDNKLSSRIIQTFCNLKYLKLDELTLKKVC 417

Query: 404 TIVFPIIRRPGINDEMESTNFQKKILQIINICNLSNNTNSEIKIWST----SQNTILSIV 459
             + P+ +   I+   E   F  K +             + I +WST      N   S  
Sbjct: 418 GGILPLWKPELISGTRE---FFVKFM-------------ASIFMWSTRDGHDNNCTFSET 461

Query: 460 SNSIILMLKNWLLESDVDMALISYVLDILNDIRKVLLSNLV--HSVENRHXXXXXXXXXX 517
              ++ M+ NW+L    D  LI+  L +L+D++ +L  + +  ++  NR           
Sbjct: 462 CFYVLQMITNWVL----DDKLIALGLTLLHDMQSLLTLDKIFNNATSNRFSTMAFISSLD 517

Query: 518 XXXXXATNFHEQFNDPETPDEIVQQYLKQIILKNSTMNKLCTIDDPLLLNACCRYLVSVK 577
                +          +T  +   QYL   I+    MNK+ + DDPLLL+A CRYLV+ K
Sbjct: 518 ILTQLSK---------QTKSDYAIQYL---IVGPDIMNKVFSSDDPLLLSAACRYLVATK 565

Query: 578 ELLVYREPDDLYVQLQNQYILDLTNYLWRNRIYKSKKIFNIPSKFIKEVVKNLYLPDINS 637
             L+     + +V++QNQYI+DLTNYL+RN++  SK +F +   F K++++NLY+P  + 
Sbjct: 566 NKLMQYPSTNKFVRMQNQYIMDLTNYLYRNKVLSSKSLFGVSPDFFKQILENLYIPTADF 625

Query: 638 KTSAIFSIFGIPSTSYLSQQALDQLERNNSVTMNYCE-LITEEGFKRFTSELSD---KSL 693
           K +  F+I GIP+ SY+    L +LE   +  + +   +I EE F  F     D   +  
Sbjct: 626 KNAKFFTITGIPALSYICIIILRRLETAENTKIKFTSGIINEETFNNFFRVHHDEIGQHG 685

Query: 694 WISNISDFNQLKPELLKIIS-TMQCYNHIALFLFTYLKSLSKYN 736
           WI  +++ + L+ ++L  +S T   Y  IA FLFTYLKSLSKY+
Sbjct: 686 WIKGVNNIHDLRVKILMHLSNTANPYRDIAAFLFTYLKSLSKYS 729

>CAGL0H05027g 481654..483762 similar to tr|Q12748 Saccharomyces
           cerevisiae YLR381w, start by similarity
          Length = 702

 Score =  157 bits (398), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 76/187 (40%), Positives = 118/187 (63%)

Query: 547 IILKNSTMNKLCTIDDPLLLNACCRYLVSVKELLVYREPDDLYVQLQNQYILDLTNYLWR 606
           +I+K + +  L  + DPLLLN+CC+YL   K  L     D   ++  NQ +LD TNYLWR
Sbjct: 513 LIIKPNILKSLIMVFDPLLLNSCCKYLTQSKGALSVNIQDKDLIRCHNQLLLDTTNYLWR 572

Query: 607 NRIYKSKKIFNIPSKFIKEVVKNLYLPDINSKTSAIFSIFGIPSTSYLSQQALDQLERNN 666
           N+I  S+ +F+I +KFIK+VV NLYLPD + K   +F + G+P+T ++  QA+ +LE  +
Sbjct: 573 NKILSSRSLFDISTKFIKQVVDNLYLPDCDKKDKNVFGLPGVPTTGFVFLQAVRRLEGTH 632

Query: 667 SVTMNYCELITEEGFKRFTSELSDKSLWISNISDFNQLKPELLKIISTMQCYNHIALFLF 726
               +Y    T  GFK+F S   +K  W+ +I DF++ +  +LK  +++ C   IA+FL+
Sbjct: 633 GARSHYNTDYTSSGFKKFKSNQEEKGDWLHDIEDFDEFRRVVLKEFTSIDCVKEIAVFLY 692

Query: 727 TYLKSLS 733
           T+LKSL+
Sbjct: 693 TFLKSLT 699

 Score =  117 bits (293), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 80/252 (31%), Positives = 126/252 (50%), Gaps = 5/252 (1%)

Query: 5   LDATIENLTNANSTTPNTQLKAELNELYTLSRKHGLTSTNLIKLITFICHSGLLSEETKL 64
           +   I+NL +AN+T     +K +L  +Y  + K GLT+  L  +I FI  + L+++ETKL
Sbjct: 5   ISTAIDNLLSANATVTTDFIKVQLEIIYHQTIKFGLTNLELRNIIHFITTTQLITDETKL 64

Query: 65  IIIKKYLLPNGYINKSVIDLIVKNLGQPT--STKQKYPSKELQAALCNWLVHISILIPKY 122
            II   L P   I K V+  I+  LG  T  S  +    K +Q ALC WLV+   L+   
Sbjct: 65  YIIHNCLYPCEVIGKEVVMEILSKLGTTTIYSPYELTTPKTVQTALCEWLVNAFFLVDIE 124

Query: 123 TIDL--SVWSHLWQFHYLQRSVXXXXXXXXXXXXXXKPWKLKILEQIALNPGYENSEAYA 180
            I    S W HLW++ YLQ+ +              K WK++++  IA+N GY  S  YA
Sbjct: 125 QIREFDSFWIHLWKYSYLQKWLTYIIVWTANPHNV-KQWKIRMIHNIAINLGYSESSGYA 183

Query: 181 TLILRRYLTLLEKSNRIQALIKTIDCDIKFIKVLQSFQFEDEFRRNLKKVLIAVNPIEFN 240
            +IL++Y  +   S  I  ++ T+    + I  +Q+ +  + F +N   +LI   P  FN
Sbjct: 184 VIILKKYQQICGYSAEINDILPTLRFPYRRIIKVQNIKLRNRFFKNTSDILITSTPDTFN 243

Query: 241 KRSIEKSLRYQI 252
              +E  ++  I
Sbjct: 244 MEKLENRMQMLI 255

>AER042W [2547] [Homologous to ScYLR381W - SH]
           complement(709326..711356) [2031 bp, 676 aa]
          Length = 676

 Score =  123 bits (308), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 124/237 (52%), Gaps = 9/237 (3%)

Query: 9   IENLTNANSTTPNTQLKAELNELYTLSRKHGLTSTNLIKLITFICHSGLLSEETKLIIIK 68
           ++ L +    T  +QL++ L++LY  + +HG++   +++LI F+C +  ++  T++ I++
Sbjct: 9   VQRLLDCTKETGPSQLRSVLSDLYERAPRHGISPAKILELIGFLCSAEFIAVSTRVYIVE 68

Query: 69  KYLLPNGYINKSVIDLIVKNLGQPTSTKQKYP---SKELQAALCNWLVHISILIPKYTID 125
             L+PNGY++ S +  ++K+LG P++ +  +        Q AL  WL H+ ++IP Y   
Sbjct: 69  NCLIPNGYLSSSTVFEVLKHLG-PSTPQNAFKLIVEPAFQVALVKWLCHVLVIIPDYQKV 127

Query: 126 L----SVWSHLWQFHYLQRSVXXXXXXXXXXXXXXKPWKLKILEQIALNPGYENSEAYAT 181
           L     +W  LW   YLQ                   +++++LE+I  NPGY N +  A+
Sbjct: 128 LQRTYPIWFQLWMVDYLQDWTTYLLIWGTESKIQVTEYRVRVLERIGSNPGYRNGKPLAS 187

Query: 182 LILRRYLTLLEKSNRIQALIKTIDCDIKFIKVLQSFQFEDEFRRNLKKVLIAVNPIE 238
            +L ++L  L+ S  +Q  I  + C+ K +  +Q  Q E +F   L+ VL A    E
Sbjct: 188 FLLHKFLQ-LKPSKIVQHAIAELRCNAKRLMTVQKVQLESKFMDGLQHVLSAGGVFE 243

 Score =  106 bits (264), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 110/205 (53%), Gaps = 3/205 (1%)

Query: 531 NDPETPDEIVQQYLKQIILKNSTMNKLCTIDDPLLLNACCRYLVSVKELLVYREPDDLYV 590
           N P +   I +  L  + +    +N L  ++DPL++   C YLVS K+ +     D+ YV
Sbjct: 469 NAPSS--AIPRDELTSVFVLPDIINSLVALNDPLVIALICEYLVSAKDRVKGFTVDNSYV 526

Query: 591 QLQNQYILDLTNYLWRNRIYKSKKIFNIPSKFIKEVVKNLYLPDINSKTSAIFSIFGIPS 650
           +  N+ ILD+ NYLWRN+++     + +P  F  ++  NLYLP+   +   ++S+     
Sbjct: 527 RKLNRCILDMANYLWRNKLFTEPYTWGLPKTFWAKISSNLYLPEPEIRQKHLYSLPNFYP 586

Query: 651 TSYLSQQALDQLERNNSVTMNYCELITEEGFKRFTSELS-DKSLWISNISDFNQLKPELL 709
             ++S++ L +LE   +  + Y + +TE G++ +  EL  +   W+S +++++  +  LL
Sbjct: 587 FRFISEEVLRRLEGQENTEVIYSKPLTEAGYRCWRKELELNGKTWLSKVNNYDSFRKRLL 646

Query: 710 KIISTMQCYNHIALFLFTYLKSLSK 734
             I     Y  + LF+ TYLKS ++
Sbjct: 647 MGIQEDSTYAGVPLFMQTYLKSFTE 671

>KLLA0E05291g complement(479196..481070) weakly similar to
           sgd|S0004373 Saccharomyces cerevisiae YLR381w
           hypothetical protein, start by similarity
          Length = 624

 Score =  105 bits (262), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 96/364 (26%), Positives = 157/364 (43%), Gaps = 34/364 (9%)

Query: 9   IENLTNANSTTPNTQLKAELNELYTLSRKHGLTSTNLIKLITFICHSGLLSEETKLIIIK 68
           I  L    +     Q+K  +  LY  +   GL   ++ KLI  +C + ++  ETK  II 
Sbjct: 8   IRFLEGPENEVSEQQIKNCIEFLYESATTIGLGCEDIRKLIDCLCITDIIGAETKEFIIT 67

Query: 69  KYLLPNGYINKSVIDLIVKNLGQPT--STKQKYPSKELQAALCNWLVHISILIPKYTI-- 124
           + L+PN Y++   I LI+  LG PT     +  P + LQ AL  W+ HI   +   +I  
Sbjct: 68  RCLVPNEYVDAKCITLIISKLGTPTFLHPYKTVPGRRLQVALVRWVCHIYPWVKDKSIFK 127

Query: 125 -DLSVWSHLWQFHYLQRSVXXXXXXXXXXXXXXKPWKLKILEQIALNPGYENSEAYATLI 183
              S+W   W+  YLQ  +              K W+ K+L  I  NPGY+NS AY+  I
Sbjct: 128 DTFSIWFEYWRLDYLQHWITYILLWTFDDRHISK-WRCKVLFNIGNNPGYKNSRAYSVYI 186

Query: 184 LRRYLTL-LEKSNRIQALIKTIDCDIKFIKVLQSFQFEDEFRRNLKKVLIAVNPIEFNKR 242
           L  +L L  +  + I   I+ ++ + K ++ + SF ++ +F  N ++ L A N       
Sbjct: 187 LDAFLALETDLKDIISDFIQMLNSNEKSLQKIASFDYDRQFVLNTRQALSAKN------- 239

Query: 243 SIEKSLRYQIIQLQDDPERPLQLIYKERYSDNEIIQLEEIACLGELQRRWGEIELPKSGE 302
                       L DD    +   Y +R +  +  Q   I  L +L R W   + P    
Sbjct: 240 -----------LLDDDQFEEILKNYGDRKAYMKPEQ-TNILSLEKLARNWNNFDGPYDFT 287

Query: 303 AIFTNENNLAIQFYPMVLTRSRHDNNDVQLEQFWSKMYEWISTQLTRCFQDKKMKSLEKI 362
            +   ++++      M L  + H + D ++ QF S + E   ++    F+D     L   
Sbjct: 288 RLLKFKSDV------MWLKIAGHASTDPRIIQFRSYLRERHDSRTL--FRDVPFPLLHTA 339

Query: 363 TVFD 366
           T FD
Sbjct: 340 TDFD 343

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 93/187 (49%), Gaps = 8/187 (4%)

Query: 549 LKNSTMNKLCTIDDPLLLNACCRYLVSVKELLVYREPDDLYVQLQNQYILDLTNYLWRNR 608
           L + ++ ++  ++DPLL++  C +LV     +  +   ++ +   ++ I  L   LW + 
Sbjct: 439 LADHSIEQVVAVNDPLLISELCWFLVRASAAIHPKHSPEILISDIDKSIHYLVEVLWNHN 498

Query: 609 IYKSKKIFNIPSKFIKEVVKNLYLPDINSKTSAIFSIFGIPSTSYLSQQALDQLERNNSV 668
           +  S     +P+ + + + ++ YL   +  +  ++S+       ++ Q+ L + ER    
Sbjct: 499 VTSSGSTL-LPNSYWESLRQSQYLSHTSFPSKLLYSVPNFGFMCFICQKLLFEKER---- 553

Query: 669 TMNYCELI---TEEGFKRFTSELSDKSLWISNISDFNQLKPELLKIISTMQCYNHIALFL 725
           T+ Y   +   +E   K++ ++L     W   I+ F+ L+   L+++ +   Y+ I+ FL
Sbjct: 554 TLGYEHFLGDFSERTLKQWVTKLGSNPQWFQEINQFSDLRKHFLRMVRSDYRYSGISEFL 613

Query: 726 FTYLKSL 732
           FTY+K+L
Sbjct: 614 FTYVKNL 620

>Kwal_23.3485
          Length = 688

 Score = 94.4 bits (233), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 100/182 (54%), Gaps = 5/182 (2%)

Query: 554 MNKLCTIDDPLLLNACCRYLVSVKELLVYREPDDLYVQLQNQYILDLTNYLWRNRIYKSK 613
           +N L    DP+ L++   +L+  +++++    D   V+L N  +LDL+NYLWRN++  + 
Sbjct: 505 LNILMASSDPIALSSLADFLIVSQKIVMATGKDKRLVRLHNHCVLDLSNYLWRNKMNSTG 564

Query: 614 KIFNIPSKFIKEVVKNLYLPDINSKTSAIFSIFGIPSTSYLSQQALDQLERNNSVTMNYC 673
            +F +P+ F + V+  L   +   K+ +  ++  IP+ S+ S +A+   E  +S  +++ 
Sbjct: 565 TLFGVPTLFFRNVINGLNQFNSEFKSKSWLTLLSIPAFSFYSMKAVKSFEEASSSKVSFK 624

Query: 674 ELITEEGFK--RFTSELSDKSLWISNISDFNQLKPELLKIISTMQCYNHIALFLFTYLKS 731
             +TE  F   R T++ SD   W+  I+ F +LK  +L  +     Y  I  FLF+Y++S
Sbjct: 625 GPLTEINFDTLRRTTKTSD---WLDTIATFQELKNAILAHMKYHGAYKEIPEFLFSYVRS 681

Query: 732 LS 733
           L+
Sbjct: 682 LT 683

 Score = 90.9 bits (224), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 107/199 (53%), Gaps = 7/199 (3%)

Query: 38  HGLTSTNLIKLITFICHSGLLSEETKLIIIKKYLLPNGYINKSVIDLIVKNLGQPTSTK- 96
            G++ T + ++I ++C +  +S  TK+++I++ LLPNG +  S +  ++K LG  T +  
Sbjct: 36  EGVSVTLIDEVIGYLCETTAISTSTKILLIREALLPNGPVPSSTVYTVLKQLGVKTLSMP 95

Query: 97  -QKYPSKELQAALCNWLVHISILIPKYTI---DLSVWSHLWQFHYLQRSVXXXXXXXXXX 152
            ++  ++++Q  LC WLVH+ I +   +I     S+W  LWQ+ +LQ  +          
Sbjct: 96  LKREVARDIQVELCKWLVHVYIFMEDISIYEKTYSMWFQLWQYDFLQTWI-TYLLFWSTN 154

Query: 153 XXXXKPWKLKILEQIALNPGYENSEAYATLILRRYLTLLEKSNRIQALIKTIDCDIKFIK 212
               K W++  + +++   GY N +A ATL+L+++  L+ ++ + +  IK I C+   +K
Sbjct: 155 RRLAKDWRVSYILRVSSKNGYTNCKALATLLLQKF-KLVMQNEKAEEAIKKIQCNNGRLK 213

Query: 213 VLQSFQFEDEFRRNLKKVL 231
            L+   +   F  N   VL
Sbjct: 214 TLKHDFWAPRFLENWSSVL 232

>Kwal_27.11410
          Length = 331

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 11/87 (12%)

Query: 379 IRKVIDEFLILENLSANKDLFMSICTIVFPIIRRPGINDE--MESTNFQKKILQIINICN 436
           IRK+ DE L L+NL  N DL  S         R P  +D+  +   +      +I+   N
Sbjct: 219 IRKLNDEILSLKNLLKNSDLMKS---------RTPSESDKSPLPGADAVPSASEILARMN 269

Query: 437 LSNNTNSEIKIWSTSQNTILSIVSNSI 463
           +  N +++I  W  S++  +     SI
Sbjct: 270 IPKNKDADIPAWKKSRDATVGFTDGSI 296

>KLLA0E16126g complement(1432567..1438476) similar to sp|P50077
           Saccharomyces cerevisiae YGR217w CCH1 calcium channel
           protein singleton, start by similarity
          Length = 1969

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 67/130 (51%), Gaps = 14/130 (10%)

Query: 377 NLIRKVIDEFLILENLSANKDLFMSICTIVFPIIRRPGIN-DEMESTNFQ-----KKILQ 430
           NL +KV+   +++ NLSA   LF+ + +++  +     ++ D+ME T F         L 
Sbjct: 808 NLWKKVLKNAIVIWNLSAFYFLFVFLASLIVLLYFDGTLDADDMEDTPFGFYSLPNAFLT 867

Query: 431 IINICNLSNNTNSEIKIWSTSQNTILSIVSNSIILMLKNWLLES-----DVDMALISYVL 485
           +I I +  N T+S   +   S  T+ S +  S++L+L  W + S     +V +A+I+   
Sbjct: 868 LIKIASTENWTDSLYALQRDSP-TLFSALFGSVLLIL--WFILSNFVVLNVFVAVIAASF 924

Query: 486 DILNDIRKVL 495
           DI  + +++L
Sbjct: 925 DIEEEDKRLL 934

>AFR420W [3612] [Homologous to ScYKL203C (TOR2) - SH; ScYJR066W
           (TOR1) - SH] complement(1188911..1196299) [7389 bp, 2462
           aa]
          Length = 2462

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 49/103 (47%), Gaps = 2/103 (1%)

Query: 619 PSKFIKEVV-KNLYLPDINSKTSAIFSIFGIPSTSYLSQQALDQLERNNSVTMNYCELIT 677
           P  F+K      +   D  +  S   +IF    +S+  ++     E  NS+ ++    ++
Sbjct: 48  PGAFVKAAATPGVVDSDSETSFSGFTAIFNRLKSSHNQERKAASFELKNSL-ISLAREVS 106

Query: 678 EEGFKRFTSELSDKSLWISNISDFNQLKPELLKIISTMQCYNH 720
            E F+RF++EL++K   + + SD N+    +L + + +  Y H
Sbjct: 107 TEHFQRFSNELNNKIFELIHGSDSNEKLGGVLAVNTLIDFYAH 149

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,051,490
Number of extensions: 1061342
Number of successful extensions: 3485
Number of sequences better than 10.0: 29
Number of HSP's gapped: 3599
Number of HSP's successfully gapped: 33
Length of query: 739
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 630
Effective length of database: 12,822,747
Effective search space: 8078330610
Effective search space used: 8078330610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)