Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_718.776476439210.0
YBR102C (EXO84)75380518850.0
CAGL0K12166g76481714810.0
ADL321W69777014320.0
Kwal_27.1258369576912801e-166
KLLA0E11319g72072011411e-145
Scas_347.3552130790.26
KLLA0B05082g354145760.50
CAGL0E03982g165968721.9
CAGL0E01111g119533685.5
YAR019C (CDC15)974101669.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_718.7
         (764 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_718.7                                                           1514   0.0  
YBR102C (EXO84) [291] chr2 complement(445019..447280) Subunit of...   730   0.0  
CAGL0K12166g complement(1188432..1190726) similar to sp|P38261 S...   575   0.0  
ADL321W [1420] [Homologous to ScYBR102C (EXO84) - SH] complement...   556   0.0  
Kwal_27.12583                                                         497   e-166
KLLA0E11319g 996736..998898 similar to sp|P38261 Saccharomyces c...   444   e-145
Scas_347.3                                                             35   0.26 
KLLA0B05082g complement(460262..461326) some similarities with s...    34   0.50 
CAGL0E03982g 378205..383184 similar to sp|P32386 Saccharomyces c...    32   1.9  
CAGL0E01111g complement(99522..103109) similar to sp|P46674 Sacc...    31   5.5  
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    30   9.6  

>Scas_718.7
          Length = 764

 Score = 1514 bits (3921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 745/764 (97%), Positives = 745/764 (97%)

Query: 1   MVDFSLRKARNNWKSSKLTSPIKQXXXXXXXXXXXXXXXXXXXNDKPKKRTAKTNKGANP 60
           MVDFSLRKARNNWKSSKLTSPIKQ                   NDKPKKRTAKTNKGANP
Sbjct: 1   MVDFSLRKARNNWKSSKLTSPIKQKTPSSPSKTHHTPSPTPSSNDKPKKRTAKTNKGANP 60

Query: 61  YSTMQMTSDYSSLPTMDSKSKNKVATSMQRRLSIHNSNYVPPKLDYSMPLPSMSQIPESP 120
           YSTMQMTSDYSSLPTMDSKSKNKVATSMQRRLSIHNSNYVPPKLDYSMPLPSMSQIPESP
Sbjct: 61  YSTMQMTSDYSSLPTMDSKSKNKVATSMQRRLSIHNSNYVPPKLDYSMPLPSMSQIPESP 120

Query: 121 NKLDTTSHMQKPLNTGRPKEARSSLAKISQPKTLRSILSNPSFNAKNFVHENLSEANAID 180
           NKLDTTSHMQKPLNTGRPKEARSSLAKISQPKTLRSILSNPSFNAKNFVHENLSEANAID
Sbjct: 121 NKLDTTSHMQKPLNTGRPKEARSSLAKISQPKTLRSILSNPSFNAKNFVHENLSEANAID 180

Query: 181 IDQFTSNLTNLAEYVSEEIKRNINDSYHEIMNVNKDLNVAMNELKQLRINIVQLSGVMEQ 240
           IDQFTSNLTNLAEYVSEEIKRNINDSYHEIMNVNKDLNVAMNELKQLRINIVQLSGVMEQ
Sbjct: 181 IDQFTSNLTNLAEYVSEEIKRNINDSYHEIMNVNKDLNVAMNELKQLRINIVQLSGVMEQ 240

Query: 241 FETLAQRRLDLEYSSMQEHENEDEDLNATQSQRRGNSTLLPPMKSTTDGKGKYRDRSSVM 300
           FETLAQRRLDLEYSSMQEHENEDEDLNATQSQRRGNSTLLPPMKSTTDGKGKYRDRSSVM
Sbjct: 241 FETLAQRRLDLEYSSMQEHENEDEDLNATQSQRRGNSTLLPPMKSTTDGKGKYRDRSSVM 300

Query: 301 ILEKVWDEELTNLFKNIEGIQKFINNDEFKNNSKLKKNARHLLLESNDWMELNVNTLKPF 360
           ILEKVWDEELTNLFKNIEGIQKFINNDEFKNNSKLKKNARHLLLESNDWMELNVNTLKPF
Sbjct: 301 ILEKVWDEELTNLFKNIEGIQKFINNDEFKNNSKLKKNARHLLLESNDWMELNVNTLKPF 360

Query: 361 QNVKIFILNDLILVVAGKHGRDLIKQNEFVVSQCVPLGNVVGVTKDKMIRNRLYFDFGNG 420
           QNVKIFILNDLILVVAGKHGRDLIKQNEFVVSQCVPLGNVVGVTKDKMIRNRLYFDFGNG
Sbjct: 361 QNVKIFILNDLILVVAGKHGRDLIKQNEFVVSQCVPLGNVVGVTKDKMIRNRLYFDFGNG 420

Query: 421 NHCLYENRTEEECDKVMDRVRKAKDDLCDIFQTEQENSRKIRESFKYLQSQNQQTPSGNK 480
           NHCLYENRTEEECDKVMDRVRKAKDDLCDIFQTEQENSRKIRESFKYLQSQNQQTPSGNK
Sbjct: 421 NHCLYENRTEEECDKVMDRVRKAKDDLCDIFQTEQENSRKIRESFKYLQSQNQQTPSGNK 480

Query: 481 DMNKSPMKSQRRSLGMTPHRMNSLATNSNNVTSTEQFFLQTLSFSMHSRTRSHDMNSISR 540
           DMNKSPMKSQRRSLGMTPHRMNSLATNSNNVTSTEQFFLQTLSFSMHSRTRSHDMNSISR
Sbjct: 481 DMNKSPMKSQRRSLGMTPHRMNSLATNSNNVTSTEQFFLQTLSFSMHSRTRSHDMNSISR 540

Query: 541 KLKKLDDSIEEVDIELTRLKFDIAVDTLLDIESQLTEIFDKINDEDLMLHKLISLKVDQR 600
           KLKKLDDSIEEVDIELTRLKFDIAVDTLLDIESQLTEIFDKINDEDLMLHKLISLKVDQR
Sbjct: 541 KLKKLDDSIEEVDIELTRLKFDIAVDTLLDIESQLTEIFDKINDEDLMLHKLISLKVDQR 600

Query: 601 RELIISKLSQNILFSNNEISQLMTNLKTMIKLGLPEQSLDLFLTNRSNLIQDLILQIGSF 660
           RELIISKLSQNILFSNNEISQLMTNLKTMIKLGLPEQSLDLFLTNRSNLIQDLILQIGSF
Sbjct: 601 RELIISKLSQNILFSNNEISQLMTNLKTMIKLGLPEQSLDLFLTNRSNLIQDLILQIGSF 660

Query: 661 DNSTNYLTQLAVIRFQTMKQTVLNFEQIFQKLCSSKISSILVSWCNEEVDKYFRLVDQQL 720
           DNSTNYLTQLAVIRFQTMKQTVLNFEQIFQKLCSSKISSILVSWCNEEVDKYFRLVDQQL
Sbjct: 661 DNSTNYLTQLAVIRFQTMKQTVLNFEQIFQKLCSSKISSILVSWCNEEVDKYFRLVDQQL 720

Query: 721 LNDENLSIESIKASRKQLDDLKSVGLDFVYKLDEFIKSNSSRIG 764
           LNDENLSIESIKASRKQLDDLKSVGLDFVYKLDEFIKSNSSRIG
Sbjct: 721 LNDENLSIESIKASRKQLDDLKSVGLDFVYKLDEFIKSNSSRIG 764

>YBR102C (EXO84) [291] chr2 complement(445019..447280) Subunit of
           the exocyst complex, required for pre-spliceosome
           formation and intron-dependent mRNA splicing [2262 bp,
           753 aa]
          Length = 753

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/805 (51%), Positives = 539/805 (66%), Gaps = 95/805 (11%)

Query: 1   MVDFSLRKARNNWKSSK--LTSPIKQXXXXXXXXXXXXXXXXXXXNDKPKKRTAKTNKGA 58
           MV+FSL+KARNNWK  K   +SP KQ                     KPK++T K     
Sbjct: 1   MVEFSLKKARNNWKHVKKSASSPAKQKTPPSPA--------------KPKQKTKK----- 41

Query: 59  NPYSTMQMTSDYSSLPTMDSKSKNKVATSMQRRLSIHNSNYVPPKLDYSMPLPSMSQIPE 118
           NPYS ++  +   +LPT++++ +++VATSMQRRLSIHN+NY PP LDYSMPLP M  +  
Sbjct: 42  NPYSDLKDPATSYTLPTINARERSRVATSMQRRLSIHNTNYAPPTLDYSMPLPDMPNMI- 100

Query: 119 SPNKLDTTSHMQKPLNTGRPK---------------------------EARSSLAKISQP 151
            PN    +SH      T                                ARS++     P
Sbjct: 101 VPNDNVDSSHNNSSFTTENESVSSKGPSNSLNLSTADLSLNDSSYNKVPARSAMRNTVNP 160

Query: 152 K----------TLRSILSNPSFNAKNFVHENLSEANAIDIDQFTSNLTNLAEYVSEEIKR 201
                      +LR +L+NP FNAK+FVH+ L  A+AI ID+FTSNLT+L+  V EE+K 
Sbjct: 161 SGSNDPFNNSTSLRKMLANPHFNAKDFVHDKLGNASAITIDKFTSNLTDLSIQVQEEVKL 220

Query: 202 NINDSYHEIMNVNKDLNVAMNELKQLRINIVQLSGVMEQFETLAQRRLDLEYSSMQEHEN 261
           NIN SY+EIM VN DLNVAM ELK++R NI  L+ V++Q   +A++RL L+    QE + 
Sbjct: 221 NINKSYNEIMTVNNDLNVAMLELKRVRANINDLNEVLDQCTKIAEKRLQLQDQIDQERQG 280

Query: 262 EDEDLNATQSQRRGNSTLLPPMKSTTDGKGKYRDRSSVMILEKVWDEELTNLFKNIEGIQ 321
              + N  +S    +  LLPP+K+  +G    RDRSSV+ILEK WD EL  LFKN+EG Q
Sbjct: 281 ---NFNNVESH-SNSPALLPPLKAGQNGNLMRRDRSSVLILEKFWDTELDQLFKNVEGAQ 336

Query: 322 KFINNDEFKNNSKLKKNARHLLLESNDWMELNVNTLKPFQNVKIFILNDLILVVAGKHGR 381
           KFIN+ +           RH+L+ S +WMELN  T KP Q V+IFILNDL+L+      R
Sbjct: 337 KFINSTK----------GRHILMNSANWMELNTTTGKPLQMVQIFILNDLVLI--ADKSR 384

Query: 382 DLIKQNEFVVSQCVPLGNVVGVTKDKMIRNRLYFDFGNGNHCLYENRTEEECDKVMDRVR 441
           D  KQN+F+VSQC PL +V  VT+++    RL F F N N  LYE R  +EC +++D +R
Sbjct: 385 D--KQNDFIVSQCYPLKDVT-VTQEEFSTKRLLFKFSNSNSSLYECRDADECSRLLDVIR 441

Query: 442 KAKDDLCDIFQTEQENSRKIRESFKYLQSQNQQTPSGNKDMNKSPMKSQRRSLG--MTPH 499
           KAKDDLCDIF  E+ENS++IRESF+YLQS  QQTP   ++ N+SP K++RRS+G  +TP 
Sbjct: 442 KAKDDLCDIFHVEEENSKRIRESFRYLQS-TQQTPG--RENNRSPNKNKRRSMGGSITPG 498

Query: 500 RMNSLATNSNNVTST-EQFFLQTLSFSMHSRTRSHDMNSISRKLKKLDDSIEEVDIELTR 558
           R         NVT   +Q+ LQ L+ SMHSR RS DM+S +++LK LD+ +EE+DIEL R
Sbjct: 499 R---------NVTGAMDQYLLQNLTLSMHSRPRSRDMSSTAQRLKFLDEGVEEIDIELAR 549

Query: 559 LKFDIAVDTLLDIESQLTEIFDKINDEDLMLHKLISLKVDQRRELIISKLSQNILFSNNE 618
           L+F+ AV+TLLDIESQL ++ ++I+DE+LML  LISLK++QRRE I SKLSQ+IL S+NE
Sbjct: 550 LRFESAVETLLDIESQLEDLSERISDEELMLLNLISLKIEQRREAISSKLSQSIL-SSNE 608

Query: 619 ISQLMTNLKTMIKLGLPEQSLDLFLTNRSNLIQDLILQIGSFDNSTNYLTQLAVIRFQTM 678
           I  L +  + MIKLGLPEQ+LDLFL NRSN IQDLILQIGS DN TNYLTQLAVIRFQT+
Sbjct: 609 IVHLKSGTENMIKLGLPEQALDLFLQNRSNFIQDLILQIGSVDNPTNYLTQLAVIRFQTI 668

Query: 679 KQTVLNFEQIFQKLCSSKISSILVSWCNEEVDKYFRLVDQQLLNDENLSIESIKASRKQL 738
           K+TV +F+ IF++L  +KISSILV WC++EVD +F+L+D+QLLNDE LS  SIK+SRKQ+
Sbjct: 669 KKTVEDFQDIFKEL-GAKISSILVDWCSDEVDNHFKLIDKQLLNDEMLSPGSIKSSRKQI 727

Query: 739 DDLKSVGLDFVYKLDEFIKSNSSRI 763
           D LK+VGLDFVYKLDEFIK NS +I
Sbjct: 728 DGLKAVGLDFVYKLDEFIKKNSDKI 752

>CAGL0K12166g complement(1188432..1190726) similar to sp|P38261
           Saccharomyces cerevisiae YBR102c EXO84 exocyst protein
           essential for secretion, start by similarity
          Length = 764

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/817 (42%), Positives = 488/817 (59%), Gaps = 106/817 (12%)

Query: 1   MVDFSLRKARNNWKSSKLTSPIKQXXXXXXXXXXXXXXXXXXXNDKPKKRTAKTNKGANP 60
           MVDFSLRK RN WK S  +S  KQ                        K   K     NP
Sbjct: 1   MVDFSLRKTRNYWKGSNSSS--KQNSEVSL------------------KNAEKKKPVTNP 40

Query: 61  YSTMQMTSDYSSLPTMDSK----------------SKNKVATSMQRRLSIHNSNYVPPKL 104
           Y+ + +  + ++LPT+D+K                + N  A ++   + + +SN +   +
Sbjct: 41  YANLTV-PNAANLPTLDAKERNKAASSMQRRLSIHTANYTAPNLDYSMPLPSSNLIDQAM 99

Query: 105 DYSMPLPSMSQI----------PESPNKLDTTSHMQKPLNTGRPKE-------------- 140
               P   +  I            S +   T +   +   T RP E              
Sbjct: 100 GDEQPTGKVPAINVDDEYGQRNGHSRSATPTDNETSRRPETLRPPELNRKRLGGSGSSAP 159

Query: 141 -------------ARSSLAKISQPKTLRSILSNPSFNAKNFVHENLSEANAIDIDQFTSN 187
                          S  A +  P +LR ILS+P F+AK F+HE LSEA+A+DID FTSN
Sbjct: 160 SGSSRMTMVAPLNPLSPYANLFHPASLRKILSDPQFSAKKFIHERLSEASAVDIDLFTSN 219

Query: 188 LTNLAEYVSEEIKRNINDSYHEIMNVNKDLNVAMNELKQLRINIVQLSGVMEQFETLAQR 247
           LT L+  V EE+KRNI  SY+EI+ VN DL+ A  ELKQLR +I +L+ V +QF T+A+ 
Sbjct: 220 LTELSTDVQEEVKRNIYKSYNEIITVNNDLHEASAELKQLRSSISELTKVTDQFVTVAKS 279

Query: 248 RLDLEYSSMQEHENEDEDLNATQSQRRGNSTLLPPMKSTTDGKGKYRDRSSVMILEKVWD 307
           R+ ++      H         TQS             S  +G    RDR+SVMILEK+WD
Sbjct: 280 RIQMDEQQKMLHTQRPSSPQKTQSSSLLPPV-----SSDINGTNPKRDRTSVMILEKMWD 334

Query: 308 EELTNLFKNIEGIQKFINNDEFKNNSKLKKNARHLLLESNDWMELNVNTLKPFQNVKIFI 367
            +L  L+KN+EG QK +             + RHLL+ES+DW ELN++T KP Q V+++I
Sbjct: 335 TQLATLYKNVEGAQKHLG----------PASNRHLLIESSDWTELNISTQKPLQTVQLYI 384

Query: 368 LNDLILVVAGKHGRDLIKQNEFVVSQCVPLGNVVGVTKDKMIRNRLYFDFGNGNHCLYEN 427
           LND +LV     G+   KQ+E +VSQC P+ +V  ++ D+  R +L F+FGN N CLYE 
Sbjct: 385 LNDAVLVA----GKTKNKQHELIVSQCCPIRDVT-ISTDREYRTKLMFNFGNSNTCLYET 439

Query: 428 RTEEECDKVMDRVRKAKDDLCDIFQTEQENSRKIRESFKYLQSQNQQTPSGNKDMNKSPM 487
           R   EC +V+D  RKAKDDL DI + E+ENS++I+ES  YLQ+  QQTP   ++ +KSP 
Sbjct: 440 RDINECMRVLDAFRKAKDDLRDITENEKENSKRIKESLVYLQN-TQQTPG--REGSKSPA 496

Query: 488 KSQRRSLGMTPHRMNSLATNSNNVTSTEQFFLQTLSFSMHSRTRSHDMNSISRKLKKLDD 547
           K  RRS+G++P   +   +      S +QF LQ LS S+HSR++SHD +S+S K K +D+
Sbjct: 497 K--RRSMGLSPSSASRPLS-----ASMDQFILQNLSISVHSRSKSHDWSSLSHKFKLVDN 549

Query: 548 SIEEVDIELTRLKFDIAVDTLLDIESQLTEIFDKINDEDLMLHKLISLKVDQRRELIISK 607
            IEEVDI+L RLKFD AV+TLL+ ESQL  + D   +ED ++  +++LK+DQRR+ I++K
Sbjct: 550 LIEEVDIDLARLKFDSAVNTLLEAESQLATMKDPTKEEDAIILNVLTLKLDQRRDDILTK 609

Query: 608 LSQNILFSNNEISQLMTNLKTMIKLGLPEQSLDLFLTNRSNLIQDLILQIGSFDNSTNYL 667
           ++Q  LF  NEI+ L   +KT+I+LGLPE  LDL L N+SNLIQ+L+LQ+GS ++ + YL
Sbjct: 610 VTQRNLFI-NEIAHLREGVKTLIRLGLPEAGLDLLLQNKSNLIQELLLQVGSSEHPSLYL 668

Query: 668 TQLAVIRFQTMKQTVLNFEQIFQKLCSSKISSILVSWCNEEVDKYFRLVDQQLLNDENLS 727
           T+LA++RFQ +K+TV+ F ++F +    K+SSILVSWC+ EV+K+F LV +QLLN + LS
Sbjct: 669 TELAIVRFQIIKRTVIVFRELFHR-DHDKLSSILVSWCSHEVEKHFNLVSKQLLNGDKLS 727

Query: 728 IESIKASRKQLDDLKSVGLDFVYKLDEFIKSNSSRIG 764
            ++I+ SRKQ+DDLK+VGLDFVYKLDEFIK+N +++G
Sbjct: 728 PDAIRYSRKQIDDLKTVGLDFVYKLDEFIKNNINKLG 764

>ADL321W [1420] [Homologous to ScYBR102C (EXO84) - SH]
           complement(130700..132793) [2094 bp, 697 aa]
          Length = 697

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/770 (42%), Positives = 473/770 (61%), Gaps = 81/770 (10%)

Query: 1   MVDFSLRKARNNWKSSKLTSPIKQXXXXXXXXXXXXXXXXXXXNDKPKKRTAKTNKGANP 60
           MVDFSLRKARNNW  SKL+SP                        K +++ + T   +N 
Sbjct: 1   MVDFSLRKARNNW--SKLSSP-----------------------GKTRQQGSPTKLKSNA 35

Query: 61  YSTMQMTSDYSSLPTMDSKSKNKVATSMQRRLSIHNSNYVPPKLDY-SMP-LPSMSQIPE 118
           Y       D   LP +  K + KV TSMQRRLS+HN+ Y+PP +DY S P LP+  ++P 
Sbjct: 36  YEDFVSPRDTLQLPEIGMKDRRKVGTSMQRRLSVHNAKYIPPPIDYASAPALPTAVELPV 95

Query: 119 SPNKLDTTSHMQKPLNTGRPKEARSSLAKISQPKTLRSILSNPSFNAKNFVHENLSEANA 178
             N L  +S + KP N  RP         I   ++LR ILSNP F AK FVHE L +A A
Sbjct: 96  RDNSL-LSSELMKP-NHRRPP------VDIYGGRSLREILSNPQFQAKRFVHEKLGDATA 147

Query: 179 IDIDQFTSNLTNLAEYVSEEIKRNINDSYHEIMNVNKDLNVAMNELKQLRINIVQLSGVM 238
           ++ID F SNL +L++ + +EIK NIN SY+E+M VNK+L VA  ELK LR  + QL  VM
Sbjct: 148 LEIDHFASNLNHLSQEIEQEIKSNINKSYNELMQVNKELAVASTELKDLRSKVQQLQVVM 207

Query: 239 EQFETLAQRRLDLEYSSMQEHENEDEDLNATQSQRRGNSTLLPPMKSTTDGKGKYRDRSS 298
            QF  +A++RL LE    +EH  +      T       S LLPP+KS   G  K +DRS+
Sbjct: 208 GQFTAMAEKRLLLE----KEHFRQSNTSVMTTKSGSTGSGLLPPVKS---GAAK-KDRST 259

Query: 299 VMILEKVWDEELTNLFKNIEGIQKFINNDEFKNNSKLKKNARHLLLESNDWMELNVNTLK 358
           V+ LEK+W  EL++LF+++EG QK+I               R +LLESNDWME+N+ TLK
Sbjct: 260 VITLEKIWTNELSSLFRSVEGAQKYI----------APAPGRRILLESNDWMEINIATLK 309

Query: 359 PFQNVKIFILNDLILVVAGKHGRDLIKQNEFVVSQCVPLGNVVGVTKDKMIRNRLYFDFG 418
           P    +IF+LND+ILV   +      K+ E V +QC  L  +    +       L F FG
Sbjct: 310 PLHATRIFLLNDMILVAVCRSD----KKGELVANQCCSLRELTVAEESNYT---LSFHFG 362

Query: 419 NGNHCLYENRTEEECDKVMDRVRKAKDDLCDIFQTEQENSRKIRESFKYLQSQNQQTPSG 478
           N +H LY +RT      +++ ++ AKD+L DI+Q E++N+RK+R+ F YLQS  QQ+PS 
Sbjct: 363 NKHHSLYRSRTPTGYTALLNEIKSAKDELRDIYQAEEDNARKLRDFFTYLQS-TQQSPS- 420

Query: 479 NKDMNKSPMK--SQRRSLGM---TPHRMNSLATNSNNVTSTEQFFLQTLSFSMHSRTRSH 533
            +D++ SP +  S++RSLG    TP R ++   N           LQ +S SMH+R+RS 
Sbjct: 421 -RDIS-SPARGHSRQRSLGTLQNTPSRASTYQEN----------LLQNISMSMHTRSRSG 468

Query: 534 DMNSISRKLKKLDDSIEEVDIELTRLKFDIAVDTLLDIESQLTEIFDKINDEDLMLHKLI 593
            +N  + KL  + + +EE+ + +TR+ F +A+  L  IE+ L  I  +   E +ML  L+
Sbjct: 469 GVNQTAVKLNLVYEELEELSVPVTRMNFGLAIKKLHSIENILKGITAEAEGE-VMLLNLL 527

Query: 594 SLKVDQRRELIISKLSQNILFSNNEISQLMTNLKTMIKLGLPEQSLDLFLTNRSNLIQDL 653
            +K +Q R LI  KL+  I    ++ ++L ++ K++I LG+P ++L LFL NRSN IQDL
Sbjct: 528 RMKCNQTRTLITQKLTHVINTEYSDANKLESSTKSLILLGMPAEALQLFLHNRSNFIQDL 587

Query: 654 ILQIGSFDNSTNYLTQLAVIRFQTMKQTVLNFEQIFQKLCSSKISSILVSWCNEEVDKYF 713
           +LQ+G  DNS +Y+TQ+AVIR QT+K+  + F+++F+   ++K SS+LVSWCN+EVDK+F
Sbjct: 588 VLQVGVHDNSNSYITQVAVIRCQTIKKVAIQFQKLFEG-TTAKYSSVLVSWCNDEVDKHF 646

Query: 714 RLVDQQLLNDENLSIESIKASRKQLDDLKSVGLDFVYKLDEFIKSNSSRI 763
            L+ +QL+ND+ L+ ++IK SRKQ+D+LKSVG+DFVYKLD+F+K +S++I
Sbjct: 647 FLMKKQLINDDQLTPQAIKISRKQIDELKSVGMDFVYKLDDFLKIHSNKI 696

>Kwal_27.12583
          Length = 695

 Score =  497 bits (1280), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 297/769 (38%), Positives = 445/769 (57%), Gaps = 79/769 (10%)

Query: 1   MVDFSLRKARNNWKSSKLTSPIKQXXXXXXXXXXXXXXXXXXXNDKPKKRTAK-TNKGAN 59
           MVD SLRKARNNWK  +++SP K                      K + R+ +  N  +N
Sbjct: 1   MVDLSLRKARNNWK--QMSSPPKA---------------------KGRSRSPEDKNFKSN 37

Query: 60  PYSTMQMTSDYSSLPTMDSKSKNKVATSMQRRLSIHNSNYVPPKLDY-SMPLPSMSQIPE 118
           PY  +++ S+YS LPT+ +K +NKV TSMQRRLS HN  YVPP  D+ ++PLP +     
Sbjct: 38  PYQNLKVPSNYSQLPTIGTKERNKVGTSMQRRLSFHNPKYVPPTSDHMAVPLPQLG---- 93

Query: 119 SPNKLDTTSHMQKPLNTGRPKEARSSLAKISQPKTLRSILSNPSFNAKNFVHENLSEANA 178
           S   L+  S      +      A+     +   ++LR IL +P F  K+F+ + L  A+A
Sbjct: 94  SSELLNVNSGDFATRHRSNSNFAKGPELDLYGNQSLRQILGDPKFKPKHFITQTLGNASA 153

Query: 179 IDIDQFTSNLTNLAEYVSEEIKRNINDSYHEIMNVNKDLNVAMNELKQLRINIVQLSGVM 238
           ++ID+FTS+L +L+  VS+EIK NI+ SY ++  VNKD++ A +ELK LR +I +L  V+
Sbjct: 154 LEIDRFTSDLNDLSLEVSDEIKDNISRSYAQVSQVNKDIDRASSELKLLRSSITELKEVI 213

Query: 239 EQFETLAQRRLDLEYSSMQEHENEDEDLNATQSQRRGNSTLLPPMKSTTDGKGKYRDRSS 298
            +FET+A++RL LE                +   R    +LLPP K++     + RDR+S
Sbjct: 214 SEFETMAEKRLQLER-------------RPSTRARSEQPSLLPPAKAS-----RARDRTS 255

Query: 299 VMILEKVWDEELTNLFKNIEGIQKFINNDEFKNNSKLKKNARHLLLESNDWMELNVNTLK 358
           VM+LEK+WD EL +LFK +EG QKFI               RH+L+E+ DW E+N  TLK
Sbjct: 256 VMMLEKMWDSELASLFKAVEGAQKFI----------APLPGRHILMETGDWYEVNAATLK 305

Query: 359 PFQNVKIFILNDLILVVAGKHGRDLIKQNEFVVSQCVPLGNVVGVTKDKMIRNRLYFDFG 418
           P +++ IF+LND++L+ A    R   +Q+E+V   C  L +    + +    NR+   FG
Sbjct: 306 PLRSIHIFVLNDMLLIAARNQDR---RQHEYVACHCHALRDT---SINPQRENRIELCFG 359

Query: 419 NGNHCLYENRTEEECDKVMDRVRKAKDDLCDIFQTEQENSRKIRESFKYLQSQNQQTPSG 478
           N + CL + +     D+++  VR A+DDL  I Q E+EN+R++R+SF Y+Q+  QQTP  
Sbjct: 360 NRSQCLVQAKNARNYDRLVSTVRGAQDDLNVISQAEEENARRLRDSFSYMQA-TQQTPG- 417

Query: 479 NKDMNKSPMKSQRR--SLGM-TPHRMNSLATNSNNVTSTEQFFLQTLSFSMHSRTRSHDM 535
            +++  SP K   R  SLG  TPH  +            E + LQT++ SM S+ +    
Sbjct: 418 -RELAISPTKGHGRNSSLGNNTPHPRDD---------PKESYLLQTITASMQSQPQFAGS 467

Query: 536 NSISRKLKKLDDSIEEVDIELTRLKFDIAVDTLLDIESQLTEIFDKINDEDLMLHKLISL 595
           N       + DD +EE DIE  R  +  A+  L  ++  +  +      E+LM+  L+ L
Sbjct: 468 NVGLGDFGRFDDEVEEFDIEFARHNYKEAIKKLESLKKAVQVLEQHTPHENLMILNLLGL 527

Query: 596 KVDQRRELIISKLSQNILFSNNEISQLMTNLKTMIKLGLPEQSLDLFLTNRSNLIQDLIL 655
           +V  R +++++KL+        + S+L   ++ +I L     +L LFL NRS  I +LIL
Sbjct: 528 RVSHRSQILVAKLTHLTATEIFDFSKLADYVQNLISLNYAHDALVLFLQNRSKYINELIL 587

Query: 656 QIGSFDNSTNYLTQLAVIRFQTMKQTVLNFEQIFQKLCSSKISSILVSWCNEEVDKYFRL 715
           +IG+F +  +YL+Q+AVIRFQT+K+ VL  ++ FQ       SS LVSWC+EE DK+F L
Sbjct: 588 KIGTFHDPVHYLSQIAVIRFQTLKKVVLRVQEQFQN-TGDNFSSTLVSWCDEEADKHFAL 646

Query: 716 VDQQLLNDENLSIESIKASRKQLDDLKSVGLDFVYKLDEFIKSNSSRIG 764
           +++Q LN E +   SIK+SR+Q+D+LKSVGLDFVYKLD+FI+ NS +IG
Sbjct: 647 INKQFLNLEMIPPSSIKSSRRQIDELKSVGLDFVYKLDDFIRKNSEKIG 695

>KLLA0E11319g 996736..998898 similar to sp|P38261 Saccharomyces
           cerevisiae YBR102c EXO84 exocyst protein essential for
           secretion singleton, start by similarity
          Length = 720

 Score =  444 bits (1141), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 279/720 (38%), Positives = 436/720 (60%), Gaps = 77/720 (10%)

Query: 73  LPTMDSKSKNKVATSMQRRLSIHNSN-YVPPKLDY-SMP-LPSMS--------------- 114
           LP + +K ++K  T M+RRLS+H SN +   K+D+ +MP LPS +               
Sbjct: 48  LPKVSAKERSKAGTMMKRRLSVHQSNNFGAVKMDFDNMPALPSSAADYSFASNVGNATQT 107

Query: 115 ------QIPESPNKLDTTSHMQKPLNTGRPKEARSSLAKISQPKTLRSILSNPSFNAKNF 168
                 Q+P+    L + +      NT RP +      ++   K+LR ILSNP F AK F
Sbjct: 108 SLITEDQLPDRNTSLASLN-----TNTRRPDQ------ELYSSKSLRQILSNPDFKAKKF 156

Query: 169 VHENLSEANAIDIDQFTSNLTNLAEYVSEEIKRNINDSYHEIMNVNKDLNVAMNELKQLR 228
           + E L +A A+DIDQFTSNL +L+  + +EIK NI+ S+ EI+ VNK L  A  ELK LR
Sbjct: 157 ITEKLGDATAVDIDQFTSNLNDLSLEIQDEIKFNIDKSFKEILIVNKGLETATTELKVLR 216

Query: 229 INIVQLSGVMEQFETLAQRRLDLEYSSMQEHENEDEDLNATQSQRRGNSTLL-PPMKSTT 287
             + ++  +M QF T+A+++L  E ++     NE  DLN T S    ++  L PP+K T 
Sbjct: 217 TKVQEMKDIMNQFVTIAEKKLQAEQAA-----NETADLNRTSSSASLSNHSLLPPLKPTP 271

Query: 288 DGKGKYRDRSSVMILEKVWDEELTNLFKNIEGIQKFINNDEFKNNSKLKKNARHLLLESN 347
               K  DR+SV ILE++W+EEL  LFKN++G  K+I +             RH+LLES+
Sbjct: 272 SATRK--DRTSVYILERMWNEELMTLFKNVDGAHKYITSTP----------GRHILLESD 319

Query: 348 DWMELNVNTLKPFQNVKIFILNDLILVVAGKHGRDLIKQNEFVVSQCVPLGNVVGVTKDK 407
           +W+E+N  TLKP Q V++FILND++L+ A K      KQ E  VS+  PL +V   T + 
Sbjct: 320 NWIEINPATLKPLQKVRLFILNDVVLIAAPKPS----KQTELTVSRFSPLRDV---TVEV 372

Query: 408 MIRNRLYFDFGNGNHCLYENRTEEECDKVMDRVRKAKDDLCDIFQTEQENSRKIRESFKY 467
              + L F+F N  H LY +R  +   KV+D +R+AKD L +I Q E++ +RKIR S+  
Sbjct: 373 QSEHELSFNFSNKQHTLYRHRDPQVFSKVIDIIRQAKDALREISQAEEDTTRKIRNSYTL 432

Query: 468 LQSQNQQTPSGNKDMNKSPMK--SQRRSLGMT--PHRMNSLATNSNNVTSTEQFFLQTLS 523
           LQ   ++TP  N+D   SP+K   ++RS G T  P R  S A N           L  ++
Sbjct: 433 LQ--QERTP--NRDATTSPVKVHGRQRSYGGTGTPSRHRSDAQNDA--------LLTNIT 480

Query: 524 FSMHSRTRSHDMNSISRKLKKLDDSIEEVDIELTRLKFDIAVDTLLDIESQLTEIFDKIN 583
            S+H R  S +   ++++LK+LDD++E++D+E+ R  FD+A+  L  I+S L  ++    
Sbjct: 481 RSIHVRMGSEETTEVTKRLKRLDDALEDLDLEIGRQNFDLAITKLNHIQSSLKSLYSSAT 540

Query: 584 DEDLMLHKLISLKVDQRRELIISKLSQNILFSNNEISQLMTNLKTMIKLGLPEQSLDLFL 643
            ++ ++ +L+SLK  QR+ ++ +KL+  +    +++++L + +  ++ L  P  +L++FL
Sbjct: 541 FDESVMVELLSLKCSQRKTILYTKLTNLLACETSDMTKLKSYMLNLVALNEPVDALEVFL 600

Query: 644 TNRSNLIQDLILQIGSFDNSTNYLTQLAVIRFQTMKQTVLNFEQIFQKLCSSKISSILVS 703
            NRSN I DL LQIG  DN T+++TQ+A+IRFQT+K+    + ++ + L     +S+LV 
Sbjct: 601 QNRSNFINDLTLQIGIIDNVTSFITQVAIIRFQTLKKVTQQYLEVSKNL-KRDYTSLLVC 659

Query: 704 WCNEEVDKYFRLVDQQLLNDENLSIESIKASRKQLDDLKSVGLDFVYKLDEFIKSNSSRI 763
           WC+EEVDK+F+L++++L N   LS+++IK +RKQ+D+LK VG+D+VYKLD+FI+ N++RI
Sbjct: 660 WCSEEVDKHFQLMERELSNSSTLSVQAIKITRKQIDELKPVGMDYVYKLDDFIRRNNNRI 719

>Scas_347.3
          Length = 552

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 61/130 (46%), Gaps = 7/130 (5%)

Query: 127 SHMQKPLNTGRPKEARSSLAKISQPKTLRSILSNPSFNAKNFV---HENLSEANAIDIDQ 183
           + +  P   G P E  +S+ ++S  K    +  +P FN +  +    E + E   +   +
Sbjct: 263 TEVHTPKLLGAPSEGGASVFEVSYFKGKAYLAQSPQFNKQQLIVADFEKVFEIGPVFRAE 322

Query: 184 FTSNLTNLAEYVSEEIKRNINDSYHEIMNVNKDLNVAM-NELKQL---RINIVQLSGVME 239
            ++   ++ E+   +++    + YHE+++V  DL V +  ELK+     I IV+    +E
Sbjct: 323 NSNTHRHMTEFTGLDMEMAFEEHYHEVLDVLSDLFVFIFTELKKRFSKEIEIVRKQYPVE 382

Query: 240 QFETLAQRRL 249
            F+  A  ++
Sbjct: 383 DFKLPADGKM 392

>KLLA0B05082g complement(460262..461326) some similarities with
           sp|P33441 Saccharomyces cerevisiae YML062c MFT1
           mitochondrial fusion target protein singleton,
           hypothetical start
          Length = 354

 Score = 33.9 bits (76), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 64/145 (44%), Gaps = 26/145 (17%)

Query: 87  SMQRRLSIHNSNYVPPKLDYSMPLPSMSQIPESPNKLDTTSHMQKPLNTGRPKEARSSLA 146
           +++RRLS+++ N V P       L  + QI          S + + LN    +  + S+ 
Sbjct: 7   AIERRLSLYSFNKVFPNY-----LSHLQQI---------QSLVHRLLNQKLTENDKLSVE 52

Query: 147 KISQPKTLRSILSNPSFNAKNFVHENLSEANAIDIDQFTSNLTNLAEYVSEEIKRNINDS 206
           +I   + LR +L +    AKNFV    S  NA+DI           E   + IK  ++  
Sbjct: 53  EI---RKLREVLDDKYLEAKNFVETERSSYNALDIS---------LERTVDNIKNGLDGQ 100

Query: 207 YHEIMNVNKDLNVAMNELKQLRINI 231
              + N+  +LN   + L Q+ ++I
Sbjct: 101 LSVVRNLRDELNERNDRLNQMHLDI 125

>CAGL0E03982g 378205..383184 similar to sp|P32386 Saccharomyces
            cerevisiae YLL048c YBT1 yeast bile transporter, start by
            similarity
          Length = 1659

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 3/68 (4%)

Query: 493  SLGMTPHRMNSLATNSNNVT---STEQFFLQTLSFSMHSRTRSHDMNSISRKLKKLDDSI 549
            ++G+T        T  N V    ++ + F + LS  +HSR R  D   I R + +    I
Sbjct: 1115 AIGITQALFAGTKTVINFVAGINASRRIFKKLLSKVLHSRLRFIDSTPIGRIMNRFSKDI 1174

Query: 550  EEVDIELT 557
            E VD ELT
Sbjct: 1175 EAVDQELT 1182

>CAGL0E01111g complement(99522..103109) similar to sp|P46674
           Saccharomyces cerevisiae YDR159w leucine permease
           transcriptional regulator, hypothetical start
          Length = 1195

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%)

Query: 46  KPKKRTAKTNKGANPYSTMQMTSDYSSLPTMDS 78
           KP   T K  K  NP  +  M+SD S+LPT  S
Sbjct: 523 KPTSATLKIEKKGNPLVSQTMSSDVSTLPTTSS 555

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 49/101 (48%), Gaps = 10/101 (9%)

Query: 535 MNSISRKLKKLDDSI-------EEVDIELTRLKFDIAVDTLLDIESQLTEIFDKINDEDL 587
           +N +   L+ ++D +       E   + L ++  D A++  +D   QL ++F  +ND+D+
Sbjct: 734 LNCLHFTLRNVNDDVAPTVGSSESHSVFLIKVNNDAAIELPID---QLVDLFYALNDDDV 790

Query: 588 MLHKLISLKVDQRRELIISKLSQNILFSNNEISQLMTNLKT 628
            L KLIS+            L+ NI+F  N   ++++   T
Sbjct: 791 NLSKLISIFTKICSLPGFENLTINIIFHPNFYEKIVSFFDT 831

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.129    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,837,065
Number of extensions: 1150305
Number of successful extensions: 5396
Number of sequences better than 10.0: 243
Number of HSP's gapped: 5551
Number of HSP's successfully gapped: 261
Length of query: 764
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 655
Effective length of database: 12,822,747
Effective search space: 8398899285
Effective search space used: 8398899285
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)