Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_718.6*54654627970.0
YBR103W (SIF2)53556214150.0
Sklu_1926.550954912991e-175
CAGL0K12188g53556112961e-174
ADL322C50155111001e-145
KLLA0E11297g51254910891e-143
Kwal_27.1258650952810151e-132
KLLA0C08976g9112211783e-13
CAGL0K09284g9112171764e-13
YCR057C (PWP2)9231941731e-12
AAR057W9221981721e-12
AGL196C9352251702e-12
Scas_720.83d9151941684e-12
KLLA0D16390g9363611658e-12
Scas_631.174742751612e-11
AEL246C8152991595e-11
YDL145C (COP1)12011521595e-11
ADR077C12041371595e-11
Kwal_23.62409132401587e-11
KLLA0F04884g12121371533e-10
Kwal_56.239209372111523e-10
KLLA0E23529g8262621505e-10
Scas_713.509832061505e-10
YLR129W (DIP2)9432041497e-10
Scas_624.1112051521481e-09
CAGL0I03718g12011371481e-09
Kwal_56.2452612101371471e-09
KLLA0C08547g5153131424e-09
Scas_720.955152231424e-09
YBR198C (TAF5)7982471391e-08
CAGL0G09845g5002771372e-08
YNL317W (PFS2)4653001372e-08
CAGL0M04279g9402061382e-08
CAGL0L02761g4192271362e-08
Scas_679.288151631362e-08
Scas_630.66212151353e-08
YCR072C5152101344e-08
Scas_585.84603001334e-08
CAGL0J03476g5172121334e-08
Sklu_2173.2515861336e-08
Sklu_2431.127492941336e-08
Scas_695.153272271308e-08
Scas_692.294561581318e-08
Kwal_23.6324514831318e-08
YLR222C (UTP13)8171631311e-07
AER263C5132481272e-07
Kwal_27.120537553021282e-07
CAGL0C03608g6432681282e-07
AEL269C4551661263e-07
ACR091W3282691236e-07
KLLA0E21263g4292131236e-07
YOR212W (STE4)4232291236e-07
ADL082C5691811247e-07
Kwal_23.50357441441247e-07
KLLA0E18986g990931247e-07
Kwal_55.220674512471237e-07
Scas_603.55891671238e-07
ACR097W4672241229e-07
YPL183C10131071231e-06
Sklu_2291.4997971221e-06
AFL056C976951221e-06
Scas_707.227301591221e-06
KLLA0E24508g3272701191e-06
YNL006W (LST8)3032221191e-06
Scas_721.328222041211e-06
CAGL0H03729g3032191192e-06
Sklu_2416.54592681192e-06
Scas_721.73251441173e-06
KLLA0F22000g7931591184e-06
Scas_465.41002991184e-06
CAGL0C01441g10051451175e-06
CAGL0C00737g8161631166e-06
KLLA0F10263g6822111167e-06
Sklu_2442.23032221138e-06
YCR084C (TUP1)7132701158e-06
CAGL0M04081g4553151149e-06
Kwal_23.53514742251149e-06
AAL009C3032241121e-05
CAGL0M05335g8062141141e-05
Sklu_2406.114262241121e-05
AFR199C3341311112e-05
AGR168W8252061122e-05
YKL021C (MAK11)4681421112e-05
CAGL0L02629g7951471112e-05
YJL112W (MDV1)7142541112e-05
AGL234W6292941112e-05
Scas_397.24101771103e-05
YBR175W (SWD3)3151621093e-05
YDR364C (CDC40)4551651093e-05
KLLA0D04840g3032571084e-05
ADL184W4492631094e-05
Scas_704.406081661094e-05
Scas_605.184242261075e-05
Scas_711.116951481085e-05
CAGL0E00561g8362561086e-05
Kwal_23.64297502771086e-05
YDR267C3302641066e-05
Sklu_2382.212613521087e-05
Kwal_23.41189392261078e-05
AGR180W8061661078e-05
KLLA0B12804g8523211061e-04
Kwal_26.87764332981051e-04
KLLA0D07546g6471321051e-04
ABL024W7341281051e-04
Kwal_23.57696271681051e-04
KLLA0E07073g4522511041e-04
YGL004C (RPN14)4171361032e-04
Scas_702.168161161042e-04
Scas_615.113491001032e-04
AGL024W7561331042e-04
Scas_629.126713221042e-04
Kwal_33.154757831291042e-04
YKR036C (CAF4)6591001032e-04
YAR003W (SWD1)4261591022e-04
Kwal_0.2123031971012e-04
AFL009C4131311023e-04
AEL314W7151671033e-04
KLLA0D00814g4081771013e-04
KLLA0E07942g3901251013e-04
Kwal_47.17572434631013e-04
Kwal_14.8843951351013e-04
Sklu_1963.23141721004e-04
KLLA0B01958g8902071014e-04
CAGL0L03201g5791661014e-04
YIL046W (MET30)640991014e-04
YBR195C (MSI1)422299996e-04
KLLA0B02827g9422331006e-04
Kwal_55.21559351261987e-04
Sklu_2172.6263173977e-04
AER081C1023123997e-04
CAGL0E02805g840132997e-04
KLLA0E21879g333123978e-04
YFL009W (CDC4)779123988e-04
KLLA0E12287g326156978e-04
Kwal_27.11585823163989e-04
AFL118W832243980.001
Kwal_27.11126996115980.001
CAGL0M06193g31697960.001
Scas_658.1442120970.001
KLLA0F21406g705149970.001
CAGL0J04818g654102970.001
CAGL0L00781g67399970.001
KLLA0F27511g62399970.001
Kwal_27.12667721153960.001
Scas_685.11384165950.002
ACR166W388112950.002
KLLA0C07513g43977950.002
CAGL0G04345g711157960.002
CAGL0J01287g610233950.002
KLLA0F13244g81482950.002
YDL195W (SEC31)1273120950.002
KLLA0A04928g861248950.002
Scas_721.128851352950.002
KLLA0D02530g70799950.002
YGL137W (SEC27)889193940.003
CAGL0F06853g388123930.003
Sklu_2318.1711136940.003
Scas_719.30940148940.003
KLLA0B07667g1999117940.003
YGR200C (ELP2)788161940.003
YBL008W (HIR1)840162930.003
YMR116C (ASC1)319174920.004
Kwal_33.1351539872920.004
YPR178W (PRP4)465164920.004
AEL250C417113920.004
ACR017W423161920.004
Kwal_47.17465800115920.004
Kwal_26.757021890890.004
CAGL0J08998g1281131920.005
Kwal_56.244781296133920.005
Scas_701.451276321920.005
Scas_700.27*433144910.005
YLR409C (UTP21)939163920.006
CAGL0M08646g337281900.006
CAGL0D02090g27797900.006
YLR429W (CRN1)65190910.006
Kwal_47.17555417102900.006
AGR207C320112900.006
CAGL0K00275g71578910.007
YER107C (GLE2)36570900.007
CAGL0M09845g936122910.007
Sklu_2423.1944122910.007
Sklu_1710.1240142880.007
CAGL0B03575g419120900.007
Kwal_26.8628422228890.008
Scas_680.11347168890.008
KLLA0A08866g423186890.009
KLLA0D06787g436224890.009
KLLA0E04741g459164890.009
CAGL0A00561g412137890.010
Scas_692.2548874890.011
CAGL0L10890g45795880.011
CAGL0H08932g902267890.012
KLLA0F05159g1231107880.015
YKL121W852272880.015
Sklu_2430.996676880.017
Sklu_2364.543162870.018
KLLA0B14410g70679870.018
CAGL0C02937g467109860.020
AER255C467250860.022
AFL007C551165860.023
KLLA0A01650g401291850.026
KLLA0C07425g444252850.026
KLLA0F07403g347175850.027
Kwal_47.17567590288850.028
Scas_717.6890899860.029
CAGL0G03399g36970840.037
CAGL0G00704g44062840.037
Scas_442.2*795164840.039
Scas_510.536276830.039
KLLA0F11231g434319830.047
YOR272W (YTM1)460145830.051
AFL006C43362830.053
Sklu_1645.258792830.056
AER337W44588820.059
Kwal_27.12239316107820.059
Scas_660.7*603343830.061
Sklu_2435.13575137820.065
Scas_721.115*318174810.065
Scas_592.4*318174810.065
YBL106C (SRO77)101091820.073
AGR367C77129820.074
Scas_571.4601106820.078
YGL003C (CDH1)566119820.078
AER448W714130810.089
Scas_720.4575557810.089
YGL116W (CDC20)61071810.097
Kwal_26.765574376810.099
Scas_719.5262897810.10
AER114W63391800.11
Scas_693.221145178810.11
CAGL0K00957g79381810.11
Kwal_33.1559171442800.11
AFL014C557213800.11
Kwal_56.2416372957800.13
Kwal_55.21450503265790.13
ABL043W606159800.14
KLLA0A08822g582118790.14
CAGL0A02772g441168790.14
YDR128W1148173800.15
ADR176W461110790.15
YDR324C (UTP4)77629790.16
Kwal_56.24596294139780.16
AAL157C47970790.17
Scas_705.2571134790.17
YCL039W (GID7)745119790.18
YOR269W (PAC1)49477780.19
AGL301C36187780.19
KLLA0A08800g43970780.19
Kwal_55.20233747133780.20
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_718.6*
         (546 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_718.6*                                                          1082   0.0  
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...   549   0.0  
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement        504   e-175
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...   503   e-174
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...   428   e-145
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...   424   e-143
Kwal_27.12586                                                         395   e-132
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    73   3e-13
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    72   4e-13
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    71   1e-12
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    71   1e-12
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    70   2e-12
Scas_720.83d                                                           69   4e-12
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    68   8e-12
Scas_631.17                                                            67   2e-11
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    66   5e-11
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    66   5e-11
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    66   5e-11
Kwal_23.6240                                                           65   7e-11
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    64   3e-10
Kwal_56.23920                                                          63   3e-10
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    62   5e-10
Scas_713.50                                                            62   5e-10
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    62   7e-10
Scas_624.11                                                            62   1e-09
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    62   1e-09
Kwal_56.24526                                                          61   1e-09
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    59   4e-09
Scas_720.95                                                            59   4e-09
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    58   1e-08
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    57   2e-08
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    57   2e-08
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    58   2e-08
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    57   2e-08
Scas_679.28                                                            57   2e-08
Scas_630.6                                                             57   3e-08
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    56   4e-08
Scas_585.8                                                             56   4e-08
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    56   4e-08
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            56   6e-08
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      56   6e-08
Scas_695.15                                                            55   8e-08
Scas_692.29                                                            55   8e-08
Kwal_23.6324                                                           55   8e-08
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    55   1e-07
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    54   2e-07
Kwal_27.12053                                                          54   2e-07
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    54   2e-07
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    53   3e-07
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....    52   6e-07
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    52   6e-07
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    52   6e-07
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    52   7e-07
Kwal_23.5035                                                           52   7e-07
KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomy...    52   7e-07
Kwal_55.22067                                                          52   7e-07
Scas_603.5                                                             52   8e-07
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    52   9e-07
YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protei...    52   1e-06
Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement         52   1e-06
AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146) [...    52   1e-06
Scas_707.22                                                            52   1e-06
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    50   1e-06
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    50   1e-06
Scas_721.32                                                            51   1e-06
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    50   2e-06
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           50   2e-06
Scas_721.7                                                             50   3e-06
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    50   4e-06
Scas_465.4                                                             50   4e-06
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    50   5e-06
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    49   6e-06
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    49   7e-06
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            48   8e-06
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    49   8e-06
CAGL0M04081g complement(450572..451939) highly similar to sp|P42...    49   9e-06
Kwal_23.5351                                                           49   9e-06
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    48   1e-05
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    49   1e-05
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      48   1e-05
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    47   2e-05
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    48   2e-05
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...    47   2e-05
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...    47   2e-05
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    47   2e-05
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    47   2e-05
Scas_397.2                                                             47   3e-05
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    47   3e-05
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    47   3e-05
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    46   4e-05
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    47   4e-05
Scas_704.40                                                            47   4e-05
Scas_605.18                                                            46   5e-05
Scas_711.11                                                            46   5e-05
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    46   6e-05
Kwal_23.6429                                                           46   6e-05
YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...    45   6e-05
Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement         46   7e-05
Kwal_23.4118                                                           46   8e-05
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    46   8e-05
KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177 Saccha...    45   1e-04
Kwal_26.8776                                                           45   1e-04
KLLA0D07546g complement(647984..649927) some similarities with s...    45   1e-04
ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH] com...    45   1e-04
Kwal_23.5769                                                           45   1e-04
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    45   1e-04
YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein c...    44   2e-04
Scas_702.16                                                            45   2e-04
Scas_615.11                                                            44   2e-04
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...    45   2e-04
Scas_629.12                                                            45   2e-04
Kwal_33.15475                                                          45   2e-04
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    44   2e-04
YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and ...    44   2e-04
Kwal_0.212                                                             44   2e-04
AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248) [...    44   3e-04
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    44   3e-04
KLLA0D00814g complement(76687..77913) similar to sp|P39984 Sacch...    44   3e-04
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    44   3e-04
Kwal_47.17572                                                          44   3e-04
Kwal_14.884                                                            44   3e-04
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         43   4e-04
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    44   4e-04
CAGL0L03201g complement(366795..368534) some similarities with s...    44   4e-04
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    44   4e-04
YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin a...    43   6e-04
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    43   6e-04
Kwal_55.21559                                                          42   7e-04
Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement       42   7e-04
AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372) [...    43   7e-04
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    43   7e-04
KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...    42   8e-04
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...    42   8e-04
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    42   8e-04
Kwal_27.11585                                                          42   9e-04
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    42   0.001
Kwal_27.11126                                                          42   0.001
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    42   0.001
Scas_658.1                                                             42   0.001
KLLA0F21406g complement(1996260..1998377) similar to sp|P47025 S...    42   0.001
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    42   0.001
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    42   0.001
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    42   0.001
Kwal_27.12667                                                          42   0.001
Scas_685.11                                                            41   0.002
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    41   0.002
KLLA0C07513g complement(656060..657379) similar to sp|P39946 Sac...    41   0.002
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    42   0.002
CAGL0J01287g 120215..122047 similar to sp|P46680 Saccharomyces c...    41   0.002
KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomy...    41   0.002
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    41   0.002
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    41   0.002
Scas_721.128                                                           41   0.002
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    41   0.002
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    41   0.003
CAGL0F06853g 671942..673108 highly similar to sp|P20484 Saccharo...    40   0.003
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          41   0.003
Scas_719.30                                                            41   0.003
KLLA0B07667g 667863..673862 weakly similar to sp|P25356 Saccharo...    41   0.003
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    41   0.003
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    40   0.003
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    40   0.004
Kwal_33.13515                                                          40   0.004
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    40   0.004
AEL250C [2256] [Homologous to ScYBR195C (MSI1) - SH] (168010..16...    40   0.004
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    40   0.004
Kwal_47.17465                                                          40   0.004
Kwal_26.7570                                                           39   0.004
CAGL0J08998g 882655..886500 highly similar to sp|P38968 Saccharo...    40   0.005
Kwal_56.24478                                                          40   0.005
Scas_701.45                                                            40   0.005
Scas_700.27*                                                           40   0.005
YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member o...    40   0.006
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...    39   0.006
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    39   0.006
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    40   0.006
Kwal_47.17555                                                          39   0.006
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    39   0.006
CAGL0K00275g complement(25300..27447) similar to sp|P36037 Sacch...    40   0.007
YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear po...    39   0.007
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    40   0.007
Sklu_2423.1 YLR409C, Contig c2423 869-3703                             40   0.007
Sklu_1710.1 YDR267C, Contig c1710 17-739                               39   0.007
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    39   0.007
Kwal_26.8628                                                           39   0.008
Scas_680.11                                                            39   0.008
KLLA0A08866g 776960..778231 weakly similar to sp|P53196 Saccharo...    39   0.009
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    39   0.009
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    39   0.009
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    39   0.010
Scas_692.25                                                            39   0.011
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    39   0.011
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    39   0.012
KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces c...    39   0.015
YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containi...    39   0.015
Sklu_2430.9 YMR102C, Contig c2430 15497-18397                          39   0.017
Sklu_2364.5 YAR003W, Contig c2364 9220-10515 reverse complement        38   0.018
KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces...    38   0.018
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    38   0.020
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    38   0.022
AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH] (424004..42...    38   0.023
KLLA0A01650g complement(146030..147235) similar to sp|Q02793 Sac...    37   0.026
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    37   0.026
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    37   0.027
Kwal_47.17567                                                          37   0.028
Scas_717.68                                                            38   0.029
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    37   0.037
CAGL0G00704g 65805..67127 similar to sp|P39706 Saccharomyces cer...    37   0.037
Scas_442.2*                                                            37   0.039
Scas_510.5                                                             37   0.039
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    37   0.047
YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associa...    37   0.051
AFL006C [3187] [Homologous to ScYAR003W (SWD1) - SH] (425925..42...    37   0.053
Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement          37   0.056
AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH] complement(...    36   0.059
Kwal_27.12239                                                          36   0.059
Scas_660.7*                                                            37   0.061
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         36   0.065
Scas_721.115*                                                          36   0.065
Scas_592.4*                                                            36   0.065
YBL106C (SRO77) [97] chr2 complement(10847..13879) Protein that ...    36   0.073
AGR367C [4678] [Homologous to ScYDR324C - SH] (1408366..1410681)...    36   0.074
Scas_571.4                                                             36   0.078
YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of...    36   0.078
AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH] complement(...    36   0.089
Scas_720.45                                                            36   0.089
YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anapha...    36   0.097
Kwal_26.7655                                                           36   0.099
Scas_719.52                                                            36   0.10 
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    35   0.11 
Scas_693.22                                                            36   0.11 
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    36   0.11 
Kwal_33.15591                                                          35   0.11 
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    35   0.11 
Kwal_56.24163                                                          35   0.13 
Kwal_55.21450                                                          35   0.13 
ABL043W [549] [Homologous to ScYMR092C (AIP1) - SH] complement(3...    35   0.14 
KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces c...    35   0.14 
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    35   0.14 
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    35   0.15 
ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH] complement(...    35   0.15 
YDR324C (UTP4) [1154] chr4 complement(1114426..1116756) Protein ...    35   0.16 
Kwal_56.24596                                                          35   0.16 
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    35   0.17 
Scas_705.2                                                             35   0.17 
YCL039W (GID7) [504] chr3 (52645..54882) Protein of unknown func...    35   0.18 
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    35   0.19 
AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH] (137221..13...    35   0.19 
KLLA0A08800g 770989..772308 similar to sp|P39706 Saccharomyces c...    35   0.19 
Kwal_55.20233                                                          35   0.20 
Kwal_56.22345                                                          35   0.20 
Sklu_1870.2 YLR055C, Contig c1870 1126-2835 reverse complement         34   0.25 
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    34   0.27 
Scas_677.32                                                            34   0.28 
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    34   0.28 
Kwal_56.23895                                                          34   0.28 
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            34   0.29 
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    34   0.29 
Scas_652.16                                                            34   0.31 
Scas_670.21                                                            34   0.32 
Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement         34   0.36 
KLLA0E18139g 1608371..1609351 highly similar to sp|P36104 Saccha...    33   0.37 
YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translat...    33   0.37 
KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomy...    34   0.40 
CAGL0K11836g complement(1142213..1143781) similar to tr|Q12021 S...    33   0.41 
ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH] complement...    34   0.45 
KLLA0D04664g 397818..399320 similar to sp|P43601 Saccharomyces c...    33   0.46 
Scas_711.46                                                            33   0.47 
Kwal_34.15818                                                          33   0.50 
Kwal_14.1710                                                           33   0.51 
CAGL0K11638g complement(1123343..1125121) weakly similar to sp|Q...    33   0.53 
Kwal_26.8975                                                           33   0.56 
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    33   0.58 
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...    33   0.61 
Scas_576.6                                                             33   0.63 
CAGL0K04345g 408238..410181 highly similar to sp|P53235 Saccharo...    33   0.64 
KLLA0F16038g complement(1487475..1490063) weakly similar to ca|C...    33   0.66 
Kwal_55.21144                                                          33   0.67 
YKL018W (SWD2) [3238] chr11 (403745..404734) Component of SET1 a...    33   0.68 
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    33   0.71 
KLLA0E21043g 1872227..1876192 similar to sgd|S0005498 Saccharomy...    33   0.72 
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    33   0.73 
Scas_693.36                                                            33   0.74 
KLLA0F02013g 183770..185470 similar to sp|P40362 Saccharomyces c...    33   0.75 
Scas_721.29                                                            33   0.75 
YFR021W (ATG18) [1701] chr6 (194800..196302) Protein that plays ...    33   0.76 
Sklu_2416.2 YOL138C, Contig c2416 613-4674 reverse complement          33   0.79 
YER066W (YER066W) [1497] chr5 (290240..290797) Protein containin...    32   0.79 
CAGL0L09757g complement(1046898..1047878) highly similar to sp|P...    32   0.81 
Scas_670.22                                                            33   0.84 
Sklu_2384.3 YKL018W, Contig c2384 6547-7533                            32   0.86 
Scas_512.3                                                             33   0.87 
Kwal_0.49                                                              33   0.89 
Scas_657.13                                                            32   0.95 
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         33   0.98 
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            32   1.1  
YMR092C (AIP1) [4050] chr13 complement(451631..453478) Actin int...    32   1.1  
Sklu_1731.4 YJL069C, Contig c1731 3709-5439 reverse complement         32   1.2  
ADL186C [1555] [Homologous to ScYOL138C - SH] (369322..373407) [...    32   1.2  
YPL100W (ATG21) [5343] chr16 (361867..363357) Protein required f...    32   1.2  
Scas_646.14                                                            32   1.3  
CAGL0K10692g 1039413..1040930 similar to sp|P43601 Saccharomyces...    32   1.3  
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    32   1.3  
KLLA0D13222g complement(1132067..1134277) similar to sgd|S000273...    32   1.4  
AFR634W [3826] [Homologous to ScYNL253W - SH] complement(1593772...    32   1.4  
AAL119W [68] [Homologous to ScYFR021W (AUT10) - SH] complement(1...    32   1.4  
Scas_589.13                                                            32   1.4  
Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement          32   1.5  
KLLA0F10791g complement(991642..993279) similar to sp|P26309 Sac...    32   1.5  
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    32   1.5  
KLLA0E19613g complement(1733708..1735426) similar to sp|P21304 S...    32   1.5  
KLLA0E20779g complement(1841092..1842207) similar to sp|P40066 S...    32   1.6  
Scas_656.15                                                            32   1.6  
Kwal_14.906                                                            32   1.6  
Kwal_26.6824                                                           32   1.8  
CAGL0M01430g 164428..166683 highly similar to tr|Q06679 Saccharo...    32   1.9  
AGR067W [4377] [Homologous to ScYDR128W - SH] complement(842182....    32   1.9  
Scas_689.6                                                             32   2.1  
CAGL0L06952g complement(780793..781836) highly similar to sp|P40...    31   2.1  
Scas_715.35                                                            32   2.2  
Kwal_27.10785                                                          31   2.2  
KLLA0E23617g 2095246..2096499 similar to sp|P13712 Saccharomyces...    31   2.2  
Sklu_2139.2 YFR021W, Contig c2139 1540-3165 reverse complement         31   2.3  
YCR032W (BPH1) [566] chr3 (179515..186018) Probable acetic acid ...    32   2.4  
Scas_670.15                                                            31   2.4  
YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component o...    31   2.5  
Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement       31   2.6  
YNL253W (TEX1) [4354] chr14 (170017..171285) Component of the TR...    31   2.7  
Kwal_27.10573                                                          31   2.7  
Scas_542.5                                                             31   2.8  
YEL056W (HAT2) [1372] chr5 (47168..48373) Histone acetyltransfer...    31   2.9  
Sklu_2371.4 YDR030C, Contig c2371 8070-9506 reverse complement         31   2.9  
YJL069C (UTP18) [2843] chr10 complement(310838..312622) Protein ...    31   3.1  
YMR168C (CEP3) [4123] chr13 complement(597331..599157) Component...    31   3.1  
CAGL0D04884g 475678..477369 highly similar to tr|Q06506 Saccharo...    31   3.2  
Sklu_2317.3 YDR142C, Contig c2317 5804-6910                            31   3.3  
KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces c...    30   3.7  
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    30   4.0  
KLLA0E06391g complement(574273..577239) similar to sp|P38163 Sac...    30   4.1  
Scas_700.4                                                             30   4.3  
Sklu_2071.4 YPL100W, Contig c2071 4876-6096                            30   4.3  
Scas_600.2                                                             30   4.3  
Kwal_47.17310                                                          30   4.5  
Kwal_27.12070                                                          30   4.7  
YER124C (DSE1) [1554] chr5 complement(407338..409059) Protein in...    30   4.8  
Kwal_14.1235                                                           30   5.0  
Scas_617.6                                                             30   5.2  
Sklu_2359.2 YER124C, Contig c2359 3062-4807                            30   5.2  
ACL099W [950] [Homologous to ScYKL018W (SWD2) - SH] complement(1...    30   5.7  
Scas_558.3                                                             30   5.9  
Scas_709.65*                                                           30   6.0  
YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible...    30   6.3  
Kwal_33.15136                                                          30   6.6  
Kwal_33.13148                                                          30   6.7  
CAGL0A00605g complement(67281..69203) similar to sp|P53197 Sacch...    30   6.7  
Scas_659.9                                                             30   7.1  
KLLA0D11946g complement(1017503..1020235) some similarities with...    30   7.2  
Scas_719.44                                                            30   7.2  
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    30   7.7  
Kwal_55.22076                                                          30   8.5  
Scas_581.3                                                             30   8.6  
CAGL0B00748g 65727..68165 similar to sp|P25569 Saccharomyces cer...    30   8.6  
CAGL0K03377g complement(306529..309465) similar to sp|Q03177 Sac...    30   9.0  
AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH] complement(...    29   9.0  
Sklu_675.1 YMR146C, Contig c675 761-1687                               29   9.1  
CAGL0J11286g 1095788..1097374 similar to sp|P53877 Saccharomyces...    29   9.3  
CAGL0G02937g complement(268985..270679) highly similar to sp|P06...    29   9.4  
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    29   9.5  
CAGL0B01529g 137174..138283 highly similar to sp|P39108 Saccharo...    29   9.6  

>Scas_718.6*
          Length = 546

 Score = 1082 bits (2797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/546 (97%), Positives = 535/546 (97%)

Query: 1   MSLSSEELNYLIWRYLQESGHELTTLALQEESRVLEFDSQYKLHVPVGSLVNLIQKGILY 60
           MSLSSEELNYLIWRYLQESGHELTTLALQEESRVLEFDSQYKLHVPVGSLVNLIQKGILY
Sbjct: 1   MSLSSEELNYLIWRYLQESGHELTTLALQEESRVLEFDSQYKLHVPVGSLVNLIQKGILY 60

Query: 61  TESELLVKSNGDITKXXXXXXXXXXXLVNALQIDLEKYPEIAKKGRFALANDSESQYEER 120
           TESELLVKSNGDITK           LVNALQIDLEKYPEIAKKGRFALANDSESQYEER
Sbjct: 61  TESELLVKSNGDITKEEMENFNENFNLVNALQIDLEKYPEIAKKGRFALANDSESQYEER 120

Query: 121 LAKGKKESEINTPIIPTSGIEEETNTKIKADIEDISIHNDTEDSAESSFFAKTLNEVQTL 180
           LAKGKKESEINTPIIPTSGIEEETNTKIKADIEDISIHNDTEDSAESSFFAKTLNEVQTL
Sbjct: 121 LAKGKKESEINTPIIPTSGIEEETNTKIKADIEDISIHNDTEDSAESSFFAKTLNEVQTL 180

Query: 181 DNKVVTSSWNLQNERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQ 240
           DNKVVTSSWNLQNERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQ
Sbjct: 181 DNKVVTSSWNLQNERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQ 240

Query: 241 ITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLD 300
           ITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLD
Sbjct: 241 ITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLD 300

Query: 301 NITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNK 360
           NITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNK
Sbjct: 301 NITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNK 360

Query: 361 PIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW 420
           PIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW
Sbjct: 361 PIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW 420

Query: 421 INDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVY 480
           INDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVY
Sbjct: 421 INDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVY 480

Query: 481 DIKRFVSRLLKRDKKQELVVPITIPLYGSYQNEKIDDCIFDISWNKSNDLITVANSIGEG 540
           DIKRFVSRLLKRDKKQELVVPITIPLYGSYQNEKIDDCIFDISWNKSNDLITVANSIGEG
Sbjct: 481 DIKRFVSRLLKRDKKQELVVPITIPLYGSYQNEKIDDCIFDISWNKSNDLITVANSIGEG 540

Query: 541 SIIAIN 546
           SIIAIN
Sbjct: 541 SIIAIN 546

>YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in
           telomere silencing, interacts with Sir4p and targets
           Sir4p from telomeres to other sites, component of Set3p
           complex, has WD (WD-40) repeats [1608 bp, 535 aa]
          Length = 535

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/562 (50%), Positives = 387/562 (68%), Gaps = 44/562 (7%)

Query: 1   MSLSSEELNYLIWRYLQESGHELTTLALQEESRVLEFDSQYKLHVPVGSLVNLIQKGILY 60
           MS++SEELNYLIWRY QE GHE++ LALQ+E+RVLEFD +YK H+P+G+LVNL+Q+GILY
Sbjct: 1   MSITSEELNYLIWRYCQEMGHEVSALALQDETRVLEFDEKYKEHIPLGTLVNLVQRGILY 60

Query: 61  TESELLVKSNGDITKXXXXXXXXXXXLVNALQIDLEKYPEIAKKGRFALANDSESQYEER 120
           TESEL+V S GDI+            LV ALQID EK+PEI+ +GRF L  +SES     
Sbjct: 61  TESELMVDSKGDISALNEHHLSEDFNLVQALQIDKEKFPEISSEGRFTLETNSESN---- 116

Query: 121 LAKGKKESEINTPIIPTSGIEEETNTKIKADIEDISIHNDTEDSAESSFFAKTLNEVQTL 180
                K  E     +     E++TN+             D+ D  +   F K L E+  L
Sbjct: 117 -----KAGEDGASTVERETQEDDTNSI------------DSSDDLDG--FVKILKEIVKL 157

Query: 181 DNKVVTSSWNLQNERLLAYGQEDS---MAKMIEYNKEDKK-----IISSLELRHPFALSS 232
           DN +V+S+WN  +E +LAYG+++S   +A+++E ++E KK     II+  ELRHPFALS+
Sbjct: 158 DN-IVSSTWNPLDESILAYGEKNSVARLARIVETDQEGKKYWKLTIIA--ELRHPFALSA 214

Query: 233 ITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSK 292
            +G+ TNQ+T L+WS DG  I+T VENGELRLWNK G L NV NFHR+PIVS+KWN+D  
Sbjct: 215 SSGKTTNQVTCLAWSHDGNSIVTGVENGELRLWNKTGALLNVLNFHRAPIVSVKWNKDGT 274

Query: 293 HFISLDLDNITILWNAINGIILQHFEPEQ------KLENNT--ESLGVDIEWVDKDKLVV 344
           H IS+D++N+TILWN I+G ++QHFE ++        EN++   SLGVD+EWVD DK V+
Sbjct: 275 HIISMDVENVTILWNVISGTVMQHFELKETGGSSINAENHSGDGSLGVDVEWVDDDKFVI 334

Query: 345 PGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENC 404
           PG  G+I VY I +  P GKL+GH G IS +EFN  ++LLL++SD D ++RIWHG   N 
Sbjct: 335 PGPKGAIFVYQITEKTPTGKLIGHHGPISVLEFNDTNKLLLSASD-DGTLRIWHGGNGNS 393

Query: 405 CNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHD 464
            NCFYGHSQSI+S SW+ DD VIS SMDGSVR+WS+ +N L+ +++VDG  I  G+IS D
Sbjct: 394 QNCFYGHSQSIVSASWVGDDKVISCSMDGSVRLWSLKQNTLLALSIVDGVPIFAGRISQD 453

Query: 465 KNKFAIGSMNGQINVYDIKRFVSRLLK-RDKKQELVVPITIPLYGSYQNEKIDDCIFDIS 523
             K+A+  M+GQ+NVYD+K+  S+       +  ++ P+ IPLY SYQ+ + +D IFD+S
Sbjct: 454 GQKYAVAFMDGQVNVYDLKKLNSKSRSLYGNRDGILNPLPIPLYASYQSSQDNDYIFDLS 513

Query: 524 WNKSNDLITVANSIGEGSIIAI 545
           WN + + I+VA S+ EGS++AI
Sbjct: 514 WNCAGNKISVAYSLQEGSVVAI 535

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score =  504 bits (1299), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 255/549 (46%), Positives = 362/549 (65%), Gaps = 45/549 (8%)

Query: 1   MSLSSEELNYLIWRYLQESGHELTTLALQEESRVLEFDSQYKLHVPVGSLVNLIQKGILY 60
           MSL+SEEL+YLIWRYLQE+GHE+T LALQEESRVLEFD +++ H+P+G LVN +Q+GILY
Sbjct: 1   MSLTSEELSYLIWRYLQETGHEVTALALQEESRVLEFDEKFREHIPLGCLVNFVQRGILY 60

Query: 61  TESELLVKSNGDITKXXXXXXXXXXXLVNALQIDLEKYPEIAKKGRFALANDSESQYEER 120
           TES+LLV+ +G++T            LV AL++D  KYP++  KGRFAL ND        
Sbjct: 61  TESDLLVRYDGEVTPIDPSHYSENFNLVQALEVDKNKYPDLVAKGRFALEND-------- 112

Query: 121 LAKGKKESEINTPIIPTSGIEEETNTKIKADIEDISIHNDTEDSAESSFFAKTLNEVQTL 180
             +  +E   + P       EE  N ++  D                  F KTL  V   
Sbjct: 113 --QSWEEQHTDEPF------EENLNGEVSPD------------------FIKTLQAVHLF 146

Query: 181 DNKVVTSSWNLQNERLLAYGQEDSMAKMIEY--NKEDKKIISSLELRHPFALS--SITGR 236
            +  + S WN +     A+G  DS AK++++  N     ++ ++ L+HPFALS  S   +
Sbjct: 147 PSSTI-SQWNPKLFDFFAWGGRDSTAKVVKFECNSGKLAVLDTITLQHPFALSIASENSK 205

Query: 237 KTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFIS 296
            TN++T LSWSP GE +IT VENGELR+W+  G LQNVFNFHRSP+VSI+WN DS H ++
Sbjct: 206 TTNEVTCLSWSPSGESLITGVENGELRMWSFRGILQNVFNFHRSPVVSIEWNADSTHVLT 265

Query: 297 LDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSI 356
            D+DNITI+WNA+ G  LQHF+ +    N  ESLG+D+EW++ DK V+PG+ GSILV+SI
Sbjct: 266 SDVDNITIVWNALTGTALQHFDLKDTTGN--ESLGIDVEWIETDKFVIPGLQGSILVFSI 323

Query: 357 DDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSII 416
            ++KPIGKL+GH  T++ + +N +++LLL++SD D ++R W G   N  NCFYGH+QSI 
Sbjct: 324 GESKPIGKLVGHTKTLTVLCYNSDNKLLLSASD-DKTLRTWRGGNANSSNCFYGHTQSIT 382

Query: 417 SLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQ 476
              W++DD +IS SMDGSVR+WSV +N LVG+++VDG  I CG +S DK KFA G+++G+
Sbjct: 383 YADWLDDDRLISTSMDGSVRVWSVKQNALVGLSVVDGVPIFCGTLSSDKQKFATGTLDGE 442

Query: 477 INVYDIKRFVSRLLKRDKKQELVVPITIPLYGSYQNEKIDDCIFDISWNKSNDLITVANS 536
           ++VY++K+ +  L   D  ++ + P+ IP  G YQ+ K    + D+SW+K    I V+ S
Sbjct: 443 VSVYNVKKLLEVL---DADEKPIGPVRIPTIGDYQSTKEGSYVSDLSWDKDGTNIAVSYS 499

Query: 537 IGEGSIIAI 545
           + E SI+++
Sbjct: 500 LEESSILSL 508

>CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces
           cerevisiae YBR103w SIF2 SIR4P interacting protein, start
           by similarity
          Length = 535

 Score =  503 bits (1296), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 267/561 (47%), Positives = 370/561 (65%), Gaps = 45/561 (8%)

Query: 1   MSLSSEELNYLIWRYLQESGHELTTLALQEESRVLEFDSQYKLHVPVGSLVNLIQKGILY 60
           MS++SEELNYLIWRYLQE+G+EL+ LALQEE+RVLEF+  YK ++PVG+LVNL+Q+GILY
Sbjct: 1   MSITSEELNYLIWRYLQETGNELSALALQEETRVLEFEKNYKENIPVGTLVNLVQRGILY 60

Query: 61  TESELLVKSNGDITKXXXXXXXXXXXLVNALQIDLEKYPEIAKKGRFALANDSESQYEER 120
           TESELLV  NG +             LV ALQID EKYP +  KGRF L         E+
Sbjct: 61  TESELLVHPNGKVKPIDENHFSENFNLVQALQIDKEKYPALVSKGRFEL---------EK 111

Query: 121 LAKGKKESEINTPIIPTSGIEEETNTKIKADIEDISIHNDTEDSAESSFFAKTLNEVQTL 180
           L  G+++S         + +E   +  + AD  +  +  D +D  E   FAKTLNE+  L
Sbjct: 112 L--GREDS---------NELESTESAGVSADHTENDVRMD-QDHDEEEVFAKTLNEIFKL 159

Query: 181 DNKVVTSSWNLQNERLLAYGQEDSMAKMIEY---NKEDK-KIISSL--ELRHPFALSSIT 234
             K V   WN  +  +LA G+ DS AK+IE      +D+ K+I     ELRHPFA S+ T
Sbjct: 160 -GKAVCLQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATT 218

Query: 235 GRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHF 294
           G+ TNQ+T LSW+ DG+ I T VENGELRLWNK+G+LQNVFNFH+SPI++I WN  + HF
Sbjct: 219 GKITNQLTCLSWAHDGDSIATGVENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHF 278

Query: 295 ISLDLDNITILWNAINGIILQHFEPEQ------KLENNTESLGVDIEWVDKDKLVVPGVN 348
           IS D DNITILW+  +G++LQHFE +          N+ +  GVD  WVD DK V+PG  
Sbjct: 279 ISTDADNITILWDVNSGVVLQHFESKANQINGNNNNNSNQMFGVDTVWVDTDKFVIPGPG 338

Query: 349 GSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCF 408
           G++LVY++ D++PIGKL+GH+GTIS +EFN  ++LL +++D D +IR+WHG   N  +CF
Sbjct: 339 GNLLVYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAAD-DNTIRVWHGGNGNSIHCF 397

Query: 409 YGHSQSIISLSWINDDLVISASMDGSVRIWSV------VENCLVGMAMVDGNAIICGKIS 462
           YGH+Q+I+SL W+N+D++ISASMDGSV++W        +   L+   +VDG  I  G IS
Sbjct: 398 YGHTQTIVSLKWVNNDMLISASMDGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAIS 457

Query: 463 HDKNKFAIGSMNGQINVYDIKRFVSRLLKRDKKQELVVPITIPLYGSYQNEKIDDCIFDI 522
            D+ ++A G M+GQ+ V+++   + R  K  K +  V  ++IP+ G +Q+   DD +FD+
Sbjct: 458 DDRERYAAGFMDGQVTVFNLAALLKRYSKGKKHKNHV--MSIPICGDFQSAHSDDSVFDL 515

Query: 523 SWNKSNDLITVANSIGEGSII 543
           SW +  D + +A SI EG+I+
Sbjct: 516 SWKE--DRLAIAYSINEGAIV 534

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score =  428 bits (1100), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 223/551 (40%), Positives = 340/551 (61%), Gaps = 55/551 (9%)

Query: 1   MSLSSEELNYLIWRYLQESGHELTTLALQEESRVLEFDSQYKLHVPVGSLVNLIQKGILY 60
           MS++SEELNYLIWRYLQE+GHE++ LA+QEE+RVLEFD +YK H+P+G+LV L+QKGILY
Sbjct: 1   MSITSEELNYLIWRYLQEAGHEVSALAMQEETRVLEFDEKYKEHIPLGTLVKLVQKGILY 60

Query: 61  TESELLVKSNGDITKXXXXXXXXXXXLVNALQIDLEKYPEIAKKGRFALANDSESQYEER 120
           TESE LV+ N                LV AL++D +++PE+  +GRFALA++ E    E 
Sbjct: 61  TESEFLVQYNAQSEGADAEHYGKDFNLVQALEVDKQRFPELVAQGRFALAHEREEPEAEP 120

Query: 121 LAKGKKESEINTPIIPTSGIEEETNTKIKADIEDISIHNDTEDSAESSFFAKTLNEVQTL 180
                                    T++++D           DS     F KTL  VQT 
Sbjct: 121 EV-----------------------TRLESD-----------DS-----FIKTLQCVQTF 141

Query: 181 DNKVVTSSWNLQNERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQ 240
               V S WN ++E + AYG+ DS A ++ Y+  D        +     L+     + N+
Sbjct: 142 PPGYV-SQWNPKHEGVFAYGERDSRAAVVTYSVAD----GLWNISETVVLADANTGQQNE 196

Query: 241 ITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLD 300
           +T L W+P G+ ++T VE+GELRLW+ +G+LQN+ ++HR+PIV IKWN D  H ++ D D
Sbjct: 197 VTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDAD 256

Query: 301 NITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNK 360
           N+TI+WN ++G  +QHF  ++      ESLGVD  W+D+DK  +PG+ GSILV++I  +K
Sbjct: 257 NMTIVWNVLSGTAVQHFSFKEA--GTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISK 314

Query: 361 PIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW 420
           PIGKL GH  T++ I +N +++LLL++SD D ++R+W G   N  + FYGHSQSI S  W
Sbjct: 315 PIGKLRGHSKTLTTIAYNEHNKLLLSASD-DNTLRVWRGGNLNPSHVFYGHSQSITSAHW 373

Query: 421 INDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVY 480
           ++DD +IS SMDGS+R+WS+  N  V  A VDG     G +S D+ KFA G+++G++ VY
Sbjct: 374 VDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVY 433

Query: 481 DIKRFVSRL-----LKRDKKQELVVPITIPLYGSYQNEKIDDCIFDISWNKSNDLITVAN 535
           DI++ + +L         +  E+     IP+ G +++ +  + +  ISW++ +  ++V+ 
Sbjct: 434 DIQKLLQQLNHNGYHGTARSAEVA---RIPVVGDHRSAREGNYVTQISWSQESTQLSVSY 490

Query: 536 SIGEGSIIAIN 546
           S+G+ +I++++
Sbjct: 491 SLGDINILSVD 501

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score =  424 bits (1089), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 225/549 (40%), Positives = 338/549 (61%), Gaps = 41/549 (7%)

Query: 1   MSLSSEELNYLIWRYLQESGHELTTLALQEESRVLEFDSQYKLHVPVGSLVNLIQKGILY 60
           MS++SEELNYLIWRYLQE+GHE++ LALQEE+RVLEF+ ++K H+P+G LV L+QKGILY
Sbjct: 1   MSIASEELNYLIWRYLQEAGHEVSALALQEETRVLEFEERFKEHIPLGCLVQLVQKGILY 60

Query: 61  TESELLVKSNGDITKXXXXXXXXXXXLVNALQIDLEKYPEIAKKGRFALANDSESQYEER 120
           TESE LV  NG++             LV AL++D +K+PEIA +GRFAL ND E+   E 
Sbjct: 61  TESEFLVPPNGEMVPVDQELYKRNFTLVQALEVDKQKFPEIAARGRFALENDVEA---EM 117

Query: 121 LAKGKKESEINTPIIPTSGIEEETNTKIKADIEDISIHNDTEDSAESSFFAKTLNEVQTL 180
           L K ++E          SG +                       + SS F KTL++  TL
Sbjct: 118 LEKKEQEQAAAMAADSPSGTQ-----------------------SASSRFIKTLSDHLTL 154

Query: 181 DNKVVTSSWNLQNERLLAYGQEDSMAKM----IEYNKEDKKIISSLELRHPFALSSITGR 236
            ++  TS WN +   LL +G   S A++    I  +KE   I   ++L +P         
Sbjct: 155 -SQSFTSQWNPKYGILLVWGGAQSQARIGSIDIVTDKESWSIKDPIDLVYP------KRS 207

Query: 237 KTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFIS 296
           +   I ++SWSPDGEL++T   +GELRLWNK G+L+N+ + HRSPIV++KWN+D  H ++
Sbjct: 208 EEEPIISVSWSPDGELVLTGTTSGELRLWNKQGKLKNILDSHRSPIVAMKWNQDCTHLLT 267

Query: 297 LDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSI 356
            D+ N+ ILW+ + G  LQHF  ++    N +SLG+D+EWV+ DK V+PG  GS+LVY+I
Sbjct: 268 TDVSNVVILWSTLTGTQLQHFSFKEGDIENEDSLGIDLEWVETDKFVIPGPGGSLLVYTI 327

Query: 357 DDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSII 416
            +NKP+G+LLGH  TI+ +EFN +++ LL++SD D +I++W G   +  N F  H+++I 
Sbjct: 328 GNNKPLGRLLGHTSTITTLEFNKSNKSLLSASD-DNTIKVWRGGNSSAANDFTDHTKTIS 386

Query: 417 SLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQ 476
           S  WINDDL+IS + DG+V++WS+ +N +V  A +D   I    +S D+N   +G++ G 
Sbjct: 387 SAHWINDDLIISTAYDGTVKVWSISKNSIVAEASLDSEPIFEASLSPDRNWLTVGTLQGS 446

Query: 477 INVYDIKRFVSRLLKRDKKQELVVPITIPLYGSYQNEKIDDCIFDISWNKSNDLITVANS 536
             V+D+K F+     ++  Q+  VPI+   YG YQ ++    + +I+WN  +    V+  
Sbjct: 447 AIVFDVKTFLES-YDQNSVQQQSVPIST--YGEYQIDQDGLQVTNIAWNNESTAFAVSYI 503

Query: 537 IGEGSIIAI 545
            G   ++++
Sbjct: 504 NGNTRLLSL 512

>Kwal_27.12586
          Length = 509

 Score =  395 bits (1015), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 216/528 (40%), Positives = 309/528 (58%), Gaps = 43/528 (8%)

Query: 1   MSLSSEELNYLIWRYLQESGHELTTLALQEESRVLEFDSQYKLHVPVGSLVNLIQKGILY 60
           MS+SSEELNYLIWRYLQESG E+  LALQEESRVLEF+S++  H+P+G+LVN +QKGILY
Sbjct: 1   MSISSEELNYLIWRYLQESGKEVAALALQEESRVLEFESKFGEHIPIGTLVNFMQKGILY 60

Query: 61  TESELLVKSNGDITKXXXXXXXXXXXLVNALQIDLEKYPEIAKKGRFALANDSESQYEER 120
            ESELLV+ + + T            LV AL+ID EK PE+    RF+L ++S     E 
Sbjct: 61  AESELLVRYDRESTPVDPKRNAQDFNLVQALEIDKEKVPELEGVQRFSLDDNSVKSSTEY 120

Query: 121 LAKGKKESEINTPIIPTSGIEEETNTKIKADIEDISIHNDTEDSAESSFFAKTLNEVQTL 180
           L      S                                     +S  F KTL     L
Sbjct: 121 LNNDSSNSSS---------------------------------GDDSGKFIKTLCRSIQL 147

Query: 181 DNKVVTSSWNLQNERLLAYGQEDSMAKMIEYNKEDK--KIISSLELRHPFALSSITGRKT 238
               V   WN +++ +LA+G  +S + ++ +   D    I   +  +HP A++      +
Sbjct: 148 PQSFVCQ-WNPKDKNILAWGGPNSTSTVVTFQDVDGTFSIQHEVTCQHPTAINVADASSS 206

Query: 239 NQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLD 298
             +T L WSP G+  +T VE+GE+RLW  D +LQN F+FH+S IV+IKWN D+ HF++ D
Sbjct: 207 CDVTCLEWSPKGDSFLTGVESGEIRLWTHDAKLQNAFDFHKSSIVTIKWNSDATHFLTYD 266

Query: 299 LDNITILWNAINGIILQHFEPEQKLENNT-ESLGVDIEWVDKDKLVVPGVNGSILVYSID 357
           +DN+ I+WNA  G  LQ F      EN T +SLGVD  W+  DK V+PG  GSI +  + 
Sbjct: 267 VDNVAIVWNAQTGTALQQFSFR---ENGTVDSLGVDASWIGPDKFVIPGPQGSIYICGMG 323

Query: 358 DNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIIS 417
           +++P+GKL GH  TI+  +FN  + +LL+ SD D ++R+W     +  NCF G++  I S
Sbjct: 324 ESRPLGKLNGHSATITAFDFNSENNMLLSGSD-DKTLRVWRSGSLSSSNCFMGNTLGITS 382

Query: 418 LSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQI 477
             WI+DD VI+ S+DGSVR+WS + N L  ++MVDG  I CG +S DK KFAIG M+G++
Sbjct: 383 AFWIDDDKVIATSLDGSVRLWSHLTNTLQAISMVDGVPIFCGSLSPDKLKFAIGKMDGEV 442

Query: 478 NVYDIKRFVSRLLKRDKKQELVVPITIPLYGSYQNEKIDDCIFDISWN 525
            VY+I++ ++ L  +        PI+IP+YG YQ+    + + +I+W+
Sbjct: 443 TVYNIEKLLATL--KSIADVGNSPISIPIYGDYQSNIEGNYVNNIAWD 488

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 101/221 (45%), Gaps = 19/221 (8%)

Query: 239 NQITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISL 297
           + +  L +SPDG  I+T+   G++++W+   G     F+ H   + ++++ +  +   S 
Sbjct: 342 DTLNGLCYSPDGSKIVTASHEGKIKIWDVASGFCLATFDEHAGGVSAVEFAKKGQVLFSA 401

Query: 298 DLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGS--ILVYS 355
            LD     W+ I     + F   ++++ N  SL VD       ++V  G   S  I V+S
Sbjct: 402 SLDGTVKAWDLIRYRNFRTFTATERIQFN--SLAVD----PSGEVVCAGSEDSFDIFVWS 455

Query: 356 IDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSI 415
           +   + +  L GH+G ISC+ F+ N   +L S+  D +IR+W           +G SQ +
Sbjct: 456 VQTGQLVDTLSGHEGPISCLSFS-NENGVLASASWDKTIRVW---------SLFGRSQQV 505

Query: 416 ISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAI 456
                 +D L IS   DG     S +   ++   + +G  +
Sbjct: 506 EPFEVFSDVLSISMKPDGQQIAASTLAGQILFFDVAEGKQV 546

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/284 (19%), Positives = 110/284 (38%), Gaps = 28/284 (9%)

Query: 227 PFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNV----FNFHRSPI 282
           PF    I     + IT+L+WS D   II++ ++   R+W+ +   +N+    F  HR  +
Sbjct: 135 PFVRYRIHAGHFSDITSLTWSKDSRFIISTSKDLTARIWSVNSEEKNLASTTFAGHRDNV 194

Query: 283 VSIKWNEDSKHFISLDLDNITILWNAIN-------------GIILQHFE----PEQKLEN 325
           +   +++D +   ++  D     W                  + L  +      +     
Sbjct: 195 IGAYFSDDQEKIYTVSKDGALFQWEYTKKPGEGEDNDEDEEDVDLSKYSWRITKKNFFHA 254

Query: 326 NTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLL 385
           N   +         + L V   NG   +Y + +   I +L   Q  ++ +  N +   L 
Sbjct: 255 NRAKVKCSAFHAASNILTVGFSNGEFRLYELPEFIMIQQLSMGQNAVNTVAINSSGEWLA 314

Query: 386 TSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIND-DLVISASMDGSVRIWSVVEN- 443
             S     + ++  Q E+      GH  ++  L +  D   +++AS +G ++IW V    
Sbjct: 315 FGSSKLGQLIVYEWQSESYILKQQGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVASGF 374

Query: 444 CLVGMAMVDGNAIICGKISHDKNKFAI--GSMNGQINVYDIKRF 485
           CL   A  D +A     +   K    +   S++G +  +D+ R+
Sbjct: 375 CL---ATFDEHAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRY 415

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 97/231 (41%), Gaps = 29/231 (12%)

Query: 224 LRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNF---HRS 280
           ++  F  S++ G    Q   L +S DG  +++ V N   R+   D      F F   HR 
Sbjct: 1   MKSDFKFSNLLGTVYRQGNVL-FSQDGSKLLSPVGN---RVSVFDLINNTAFTFEYEHRK 56

Query: 281 PIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKD 340
            +  +  N+     +S+D+D   IL N     +L HF  ++K+         D+++    
Sbjct: 57  NVAVVDINKQGTLLLSIDVDGRGILANFKTRNVLHHFNFKEKV--------YDLKFSPDG 108

Query: 341 KLVVPGVNGSILVYSIDDN------KPIGKL---LGHQGTISCIEFNVNSRLLLTSSDSD 391
           KL        + ++   +        P  +     GH   I+ + ++ +SR ++++S  D
Sbjct: 109 KLFALACGRFLQIWRTPETTEDRQFAPFVRYRIHAGHFSDITSLTWSKDSRFIISTS-KD 167

Query: 392 YSIRIWHGQKEN---CCNCFYGHSQSIISLSWIND-DLVISASMDGSVRIW 438
            + RIW    E        F GH  ++I   + +D + + + S DG++  W
Sbjct: 168 LTARIWSVNSEEKNLASTTFAGHRDNVIGAYFSDDQEKIYTVSKDGALFQW 218

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 103/217 (47%), Gaps = 19/217 (8%)

Query: 243 ALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDN 301
           +L++SPDG  ++T+ E+G++++W+   G     F  H S + ++++ +  +   S  LD 
Sbjct: 346 SLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFEEHTSAVTAVQFAKKGQVLFSASLDG 405

Query: 302 ITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGS--ILVYSIDDN 359
               W+ I     + F   ++++     L V+       ++V  G   S  + V+S+   
Sbjct: 406 TVRAWDLIRYRNFRVFTATERVQFTC--LAVE----PSGEVVSAGSTDSFDVFVWSVQTG 459

Query: 360 KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLS 419
           + +  L GH+G +SC+ F++ + +L ++S  D +IRIW           +G SQ +  L 
Sbjct: 460 QLLDTLSGHEGPVSCLAFSMENAVLASAS-WDKTIRIW---------SIFGRSQQVEPLE 509

Query: 420 WINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAI 456
              D L I+ + DG     S ++  L    +  G  I
Sbjct: 510 VFADILAITITPDGKHVAVSTLKGQLTIFDIASGKQI 546

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/281 (16%), Positives = 104/281 (37%), Gaps = 22/281 (7%)

Query: 227 PFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGR----LQNVFNFHRSPI 282
           PF    +       IT+ +WS D   ++T+ ++   R+W+ +      +      HR  +
Sbjct: 135 PFVRYRVHAGHFQDITSFTWSHDSRFLLTTSKDLTSRVWSINSEDKELVATTLAGHRDYV 194

Query: 283 VSIKWNEDSKHFISLDLDNITILWNAINGI-----------------ILQHFEPEQKLEN 325
           +   +N   +   ++  D     W  I+                   +      +     
Sbjct: 195 LGAYFNSTQEKIYTISKDGAVFTWEYISKAQKEGLDEEDLEDEDLSKLSWRITKKNFFYA 254

Query: 326 NTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLL 385
           N   +      ++ + L+V   NG   +Y + +   + +L   Q  ++ +  N +   L 
Sbjct: 255 NQAKVKCCTFHINSNLLIVGFSNGEFRLYEMPEFVMVQQLSMGQNPVNTVSVNNSGEWLA 314

Query: 386 TSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIND-DLVISASMDGSVRIWSVVENC 444
             S     + ++  Q E+      GH  +  SL++  D   V++A+ DG +++W V    
Sbjct: 315 FGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGF 374

Query: 445 LVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIKRF 485
            +       +A+   + +         S++G +  +D+ R+
Sbjct: 375 CLATFEEHTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRY 415

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 59/303 (19%), Positives = 111/303 (36%), Gaps = 54/303 (17%)

Query: 224 LRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNF---HRS 280
           ++  F  S++ G    Q   + +S DG ++++ V N   R+   D      F F   HR 
Sbjct: 1   MKSDFKFSNLLGTVYRQ-GNVQFSHDGNMLLSPVGN---RISVFDLVNNKSFTFAYEHRK 56

Query: 281 PIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKD 340
            I +   N+     +S+D D   IL N     +L HF  + K  +        +++    
Sbjct: 57  NIATFDVNKQGTLLLSVDTDGRAILVNFKTRNVLHHFNFKDKCYS--------VKFSPDG 108

Query: 341 KLVVPGVNGSILVYSIDD---NKPIGKLL------GHQGTISCIEFNVNSRLLLTSSDSD 391
           +     V   + ++   D   ++     +      GH   I+   ++ +SR LLT+S  D
Sbjct: 109 RYFALAVGRFLQIWKTPDVSQDRQFAPFVRYRVHAGHFQDITSFTWSHDSRFLLTTS-KD 167

Query: 392 YSIRIW---HGQKENCCNCFYGHSQSIISLSWIN--DDLVISASMDGSVRIWSVVENCL- 445
            + R+W      KE       GH   ++  ++ N   + + + S DG+V  W  +     
Sbjct: 168 LTSRVWSINSEDKELVATTLAGHRDYVLG-AYFNSTQEKIYTISKDGAVFTWEYISKAQK 226

Query: 446 ----------------------VGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIK 483
                                       +   + C     + N   +G  NG+  +Y++ 
Sbjct: 227 EGLDEEDLEDEDLSKLSWRITKKNFFYANQAKVKCCTFHINSNLLIVGFSNGEFRLYEMP 286

Query: 484 RFV 486
            FV
Sbjct: 287 EFV 289

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 51/279 (18%), Positives = 114/279 (40%), Gaps = 33/279 (11%)

Query: 184 VVTSSWNLQNERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQITA 243
           + + +W+  + R L    +D  +++   N EDK++++          +++ G + + +  
Sbjct: 149 ITSFTWS-HDSRFLLTTSKDLTSRVWSINSEDKELVA----------TTLAGHR-DYVLG 196

Query: 244 LSWSPDGELIITSVENGELRLWNKDGRLQN----VFNFHRSPIVSIKWNEDSKHFISLDL 299
             ++   E I T  ++G +  W    + Q       +     +  + W    K+F   + 
Sbjct: 197 AYFNSTQEKIYTISKDGAVFTWEYISKAQKEGLDEEDLEDEDLSKLSWRITKKNFFYANQ 256

Query: 300 DNITILWNAING--IILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVN--------- 348
             +      IN   +I+     E +L    E + V    + ++ +    VN         
Sbjct: 257 AKVKCCTFHINSNLLIVGFSNGEFRLYEMPEFVMVQQLSMGQNPVNTVSVNNSGEWLAFG 316

Query: 349 ----GSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENC 404
               G +LVY       I K  GH    + + ++ +   ++T+++ D  I++W      C
Sbjct: 317 SSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAE-DGKIKVWDVASGFC 375

Query: 405 CNCFYGHSQSIISLSWINDDLVI-SASMDGSVRIWSVVE 442
              F  H+ ++ ++ +     V+ SAS+DG+VR W ++ 
Sbjct: 376 LATFEEHTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIR 414

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 96/194 (49%), Gaps = 19/194 (9%)

Query: 243 ALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDN 301
           +L++SPDG  ++T+ E+G++++W+   G     F  H S + ++++ +  +   S  LD 
Sbjct: 350 SLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDG 409

Query: 302 ITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGV--NGSILVYSIDDN 359
               W+ I     + F   ++++ N   L VD       ++V  G   N  I V+S+   
Sbjct: 410 TVRAWDLIRYRNFRTFTGTERIQFNC--LAVD----PSGEVVCAGSLDNFDIHVWSVQTG 463

Query: 360 KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLS 419
           + +  L GH+G +SC+ F+  + +L ++S  D +IRIW           +G SQ +  + 
Sbjct: 464 QLLDALSGHEGPVSCLSFSQENSVLASAS-WDKTIRIW---------SIFGRSQQVEPIE 513

Query: 420 WINDDLVISASMDG 433
             +D L +S   DG
Sbjct: 514 VYSDVLALSMRPDG 527

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 98/237 (41%), Gaps = 41/237 (17%)

Query: 224 LRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNF---HRS 280
           ++  F  S++ G    Q   +++S DG+ +++ V N   R+   D      F F   HR 
Sbjct: 1   MKSDFKFSNLLGTVYRQ-GNITFSDDGKQLLSPVGN---RVSVFDLINNKSFTFEYEHRK 56

Query: 281 PIVSIKWNEDSKHFISLDLDNITILWNAINGIILQH-----------FEPEQKLENNTES 329
            I +I  N+     IS+D D   IL N     +L H           F P+ +L      
Sbjct: 57  NIAAIDLNKQGTLLISIDEDGRAILVNFKARNVLHHFNFKEKCSAVKFSPDGRLFALASG 116

Query: 330 LGVDIEW----VDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLL 385
             + I W    V+KD+   P V   +               GH   I+ + ++ +SR +L
Sbjct: 117 RFLQI-WKTPDVNKDRQFAPFVRHRVHA-------------GHFQDITSLTWSQDSRFIL 162

Query: 386 TSSDSDYSIRIWHGQKEN---CCNCFYGHSQSIISLSWIND-DLVISASMDGSVRIW 438
           T+S  D S +IW    E        F GH   ++   + +D + + + S DG+V +W
Sbjct: 163 TTS-KDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFFSHDQEKIYTVSKDGAVFVW 218

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 49/95 (51%), Gaps = 2/95 (2%)

Query: 349 GSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCF 408
           G +LVY       I K  GH  + + + ++ +   ++T+S+ D  I++W      C   F
Sbjct: 325 GQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTASE-DGKIKVWDITSGFCLATF 383

Query: 409 YGHSQSIISLSWI-NDDLVISASMDGSVRIWSVVE 442
             H+ S+ ++ +     ++ S+S+DG+VR W ++ 
Sbjct: 384 EEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIR 418

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 98/198 (49%), Gaps = 19/198 (9%)

Query: 239 NQITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISL 297
           + + AL++SPDG  I+T+ E+G++++W+   G     F  H S + S+++ ++ +   S 
Sbjct: 357 DALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATFEEHTSSVTSVQFAKNGQIMFSS 416

Query: 298 DLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGV--NGSILVYS 355
            LD     W+ +     + F   ++++ +   L  D       ++V  G   N  I V+S
Sbjct: 417 SLDGTVKAWDLMRFRNFRTFTATERIQFSC--LAAD----PTGEVVCAGSLDNYDIQVWS 470

Query: 356 IDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSI 415
           +   + +  L GH+G +SC+ F+  + +L ++S  D +IR+W           +G SQ +
Sbjct: 471 VQTGQLLDTLSGHEGPVSCLSFSRENSILASAS-WDKTIRVW---------SIFGRSQQV 520

Query: 416 ISLSWINDDLVISASMDG 433
             +   +D L IS   DG
Sbjct: 521 EPIEAYSDVLDISMRPDG 538

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/280 (17%), Positives = 109/280 (38%), Gaps = 21/280 (7%)

Query: 227 PFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNV----FNFHRSPI 282
           PF    +       IT+L+WS D   II++ ++   R+++ +   +++    F  HR  +
Sbjct: 151 PFVRYRVHAGHFADITSLTWSRDSRFIISTAKDMTARIYSVNAEEKDLASMTFAGHRDYV 210

Query: 283 VSIKWNEDSKHFISLDLDNITILWNAINGIILQ----------------HFEPEQKLENN 326
           +   ++ D +   ++  D     W       L                     +      
Sbjct: 211 MGAFFSADQEKIYTVSKDGALFQWEYTKNPALAEEDDEDEELDLSKYSWRITKKNYFYAK 270

Query: 327 TESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLT 386
              +       D + L+V   NG   +Y + D   I +L   Q  ++ +  N +   L  
Sbjct: 271 NAKVKCAAFHADSNMLIVGFSNGEFRMYELPDFTFIQQLSMGQNAVNTVAVNRSGEWLAF 330

Query: 387 SSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDL-VISASMDGSVRIWSVVENCL 445
            S +   + ++  Q E+      GH  ++ +L++  D   +++A+ DG ++IW +V    
Sbjct: 331 GSSTLGQLLVYEWQSESYILKQQGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGFC 390

Query: 446 VGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIKRF 485
           +       +++   + + +       S++G +  +D+ RF
Sbjct: 391 LATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMRF 430

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 57/299 (19%), Positives = 116/299 (38%), Gaps = 47/299 (15%)

Query: 224 LRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNF-HRSPI 282
           ++  F  S++ G    Q   + +S DG L+ + V N  + +++  G     F + HR  I
Sbjct: 17  MKSDFKFSNLLGTVYRQGNVV-FSEDGTLLFSPVGN-RVSVFDLIGNKSFTFEYEHRRNI 74

Query: 283 VSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKL 342
             I  N      +S+D+D   IL N     ++ HF  + K+         D+++    KL
Sbjct: 75  ARIDVNAQGTLLLSVDVDGRAILVNIKTRNVIHHFNFKDKVN--------DVKFSTDGKL 126

Query: 343 VVPGVNGSILVY---SIDDNKPIGKLL------GHQGTISCIEFNVNSRLLLTSSDSDYS 393
                   + ++    +   +     +      GH   I+ + ++ +SR +++++  D +
Sbjct: 127 FALACGRFLQIWRTPGVSAERQFAPFVRYRVHAGHFADITSLTWSRDSRFIISTA-KDMT 185

Query: 394 IRIWH---GQKENCCNCFYGHSQSIISLSWIND-DLVISASMDGSVRIWSVVENCLVGMA 449
            RI+     +K+     F GH   ++   +  D + + + S DG++  W   +N  +   
Sbjct: 186 ARIYSVNAEEKDLASMTFAGHRDYVMGAFFSADQEKIYTVSKDGALFQWEYTKNPALAEE 245

Query: 450 ---------------------MVDGNA-IICGKISHDKNKFAIGSMNGQINVYDIKRFV 486
                                    NA + C     D N   +G  NG+  +Y++  F 
Sbjct: 246 DDEDEELDLSKYSWRITKKNYFYAKNAKVKCAAFHADSNMLIVGFSNGEFRMYELPDFT 304

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 105/225 (46%), Gaps = 29/225 (12%)

Query: 248 PDGELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITIL 305
           P G L+I     G+L+L++      L+N+   H + I S+    D K  ++   D     
Sbjct: 434 PGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKF 493

Query: 306 WN-----AINGIILQHFEPEQKL-ENNTESLGVDIEWVDK----DK-LVVPGVNGSILVY 354
           W+      +    L  F P+ KL  + T  LG D+ W  K    D+ L V  ++ ++ V+
Sbjct: 494 WDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDL-WCVKISPEDRFLAVSLLDNTVKVF 552

Query: 355 SIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQS 414
            +D  K    L GH+  +  ++ + +S+L++TSS +D +I+IW     +C    + H  S
Sbjct: 553 FLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSS-ADKNIKIWGLDFGDCHKSLFAHQDS 611

Query: 415 IISLSWINDDL-VISASMDGSVRIWSVVENCLVGMAMVDGNAIIC 458
           I+++ ++ +     S S DG+V+ W             DGN+  C
Sbjct: 612 IMNVKFLPESHNFFSCSKDGTVKYW-------------DGNSFDC 643

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 47/105 (44%), Gaps = 2/105 (1%)

Query: 342 LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK 401
           L V   +G+I ++ +     +     H   I+ + F+     L++ S  D +I +W    
Sbjct: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGS-RDATIILWDLVA 148

Query: 402 ENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV-VENCL 445
           E        H  +I  +   NDD +IS S DG +++W + V  C+
Sbjct: 149 ETGLCKLRSHKDAITGIWCENDDWLISVSKDGLIKLWDMKVHQCV 193

 Score = 32.7 bits (73), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 32/166 (19%), Positives = 77/166 (46%), Gaps = 15/166 (9%)

Query: 235 GRKTNQITALSWSPDGELIITSVENGELRLWNKDGR-LQNVFNFHRSPIVSIKWNEDSKH 293
             K  + T L +  +  ++     +G +++W+   + +  VF+ H S I  +++++    
Sbjct: 72  AEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTR 131

Query: 294 FISLDLDNITILWNAINGIILQHFEPEQKLENNTESL-GVDIEWVDKDK-LVVPGVNGSI 351
            IS   D   ILW+ +    L       KL ++ +++ G+   W + D  L+    +G I
Sbjct: 132 LISGSRDATIILWDLVAETGL------CKLRSHKDAITGI---WCENDDWLISVSKDGLI 182

Query: 352 LVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
            ++ +  ++ +   + H G   C    V   +++T ++++  I++W
Sbjct: 183 KLWDMKVHQCVETHMAHTG--ECWSLAVKDNMVIT-ANAESEIKLW 225

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 2/78 (2%)

Query: 232 SITGRKTNQITALSWSPDGELIITSVENGELRLWNKD-GRLQNVFNFHRSPIVSIKWNED 290
           S+ G K   + ++  S D +LIITS  +  +++W  D G        H+  I+++K+  +
Sbjct: 562 SLYGHKL-PVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 620

Query: 291 SKHFISLDLDNITILWNA 308
           S +F S   D     W+ 
Sbjct: 621 SHNFFSCSKDGTVKYWDG 638

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 48/103 (46%), Gaps = 4/103 (3%)

Query: 383 LLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDL-VISASMDGSVRIWSVV 441
            +L    +D +I+IW  Q +     F+ HS +I  L +      +IS S D ++ +W +V
Sbjct: 88  FILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLV 147

Query: 442 ENCLVGMAMVDGNAIICGKISHDKNKFAIG-SMNGQINVYDIK 483
                G+  +  +      I  + + + I  S +G I ++D+K
Sbjct: 148 AE--TGLCKLRSHKDAITGIWCENDDWLISVSKDGLIKLWDMK 188

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 14/74 (18%), Positives = 38/74 (51%), Gaps = 4/74 (5%)

Query: 410 GHSQSIISLSWINDDLVISASMDGSVRIWSV-VENCLVGMAMVDGNAIICGKISHDKNKF 468
           GH   + +    +DD +++ + +G++++W++  + C+  +   D    +C K        
Sbjct: 383 GHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTCIRNL---DCGYALCCKFLPGGALV 439

Query: 469 AIGSMNGQINVYDI 482
            +G+  GQ+ ++D+
Sbjct: 440 ILGTRAGQLQLFDL 453

>Scas_720.83d
          Length = 915

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 94/194 (48%), Gaps = 19/194 (9%)

Query: 243 ALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDN 301
           +L++SPDG  ++T+ E+G++++W+   G     F  H S +  +++ +  +   S  LD 
Sbjct: 348 SLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQEHTSSVTQVQFAKRGQVLFSSSLDG 407

Query: 302 ITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGV--NGSILVYSIDDN 359
               W+ I     + F   ++++ N   L VD       ++V  G   N  I V+S+   
Sbjct: 408 TVRAWDLIRYRNFRTFTAAERIQFNC--LAVD----PSGEVVCAGSLDNFDIHVWSVQTG 461

Query: 360 KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLS 419
           + +  L GH+G +SC+ F+  + +L ++S  D ++R+W           +G SQ +    
Sbjct: 462 QLLDTLSGHEGPVSCLAFSQENSVLASAS-WDKTVRVW---------SIFGRSQQVEPFD 511

Query: 420 WINDDLVISASMDG 433
             +D L ++   DG
Sbjct: 512 VYSDVLALTIRPDG 525

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/288 (17%), Positives = 108/288 (37%), Gaps = 34/288 (11%)

Query: 227 PFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNV----FNFHRSPI 282
           PF    +       I +L+WS D   II++ ++   R+W+ D   +++    F  HR  +
Sbjct: 135 PFVRYRVHAGHFQDILSLTWSLDSRFIISTSKDLTARIWSIDSEEKDLASMTFAGHRDYV 194

Query: 283 VSIKWNEDSKHFISLDLDNITILWNAING------------------------IILQHFE 318
           +   ++ D +   ++  D    +W                             I  +HF 
Sbjct: 195 MGAFFSADQEKIYTVSKDGALFVWEFTKKSTDDEDDDDEEEEEDIDISKYSWRITQKHFF 254

Query: 319 PEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFN 378
              + +    +          + LVV   NG   +Y +     + +L   Q  I+ +  N
Sbjct: 255 YANQCKVKCVTFHAP-----SNMLVVGFTNGEFRLYELPHFTLLQQLSMGQNPINTVAVN 309

Query: 379 VNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIND-DLVISASMDGSVRI 437
            +   L   S     + ++  Q E+      GH  +  SL++  D   V++A+ DG +++
Sbjct: 310 SSGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKV 369

Query: 438 WSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIKRF 485
           W VV    +       +++   + +         S++G +  +D+ R+
Sbjct: 370 WDVVSGFCLATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRY 417

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 97/231 (41%), Gaps = 29/231 (12%)

Query: 224 LRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNF---HRS 280
           ++  F  S++ G    Q   + +S DG  +++ V N   R+   D      F F   HR 
Sbjct: 1   MKSDFKFSNLLGTVYRQGNII-FSNDGTQLLSPVGN---RVSVFDLINNKSFTFEYEHRK 56

Query: 281 PIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKD 340
            I +I  N+     IS+D D   IL N     +L HF  ++K           +++    
Sbjct: 57  NIATIDLNKQGTLLISVDEDGRAILTNFKAKTVLHHFNFKEKC--------YQVKFSPDG 108

Query: 341 KLVVPGVNGSILVYSIDD---NKPIGKLL------GHQGTISCIEFNVNSRLLLTSSDSD 391
           KL        + ++   D   ++     +      GH   I  + ++++SR ++++S  D
Sbjct: 109 KLFALATGRFLQIWKTPDATEDRQFAPFVRYRVHAGHFQDILSLTWSLDSRFIISTS-KD 167

Query: 392 YSIRIW---HGQKENCCNCFYGHSQSIISLSWIND-DLVISASMDGSVRIW 438
            + RIW     +K+     F GH   ++   +  D + + + S DG++ +W
Sbjct: 168 LTARIWSIDSEEKDLASMTFAGHRDYVMGAFFSADQEKIYTVSKDGALFVW 218

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 85/361 (23%), Positives = 157/361 (43%), Gaps = 57/361 (15%)

Query: 116 QYEERLA-KGKKESEINTPIIPTSGIEEETNTKIKADIEDISIHNDTEDSAESSFFAKTL 174
           + E+RL  KG  E EI   + P                 DIS+   +  +  SS+  K+ 
Sbjct: 292 RREKRLRDKGASEEEIQEAVNPN----------------DISVLFHSFSTVRSSYKIKSS 335

Query: 175 NEVQTLDNK---VVTSSWNLQNERLLAYGQEDSMAKMIEYNKE---------------DK 216
           N +Q  ++K   V+T+S N      + Y + D+   +  YN E               D 
Sbjct: 336 NWIQASNSKLEVVLTTSNNTIESYQIPYSKRDAEPPVRRYNVELQGHRTDIRSMDISDDG 395

Query: 217 KIISSLELRHPFALSSITGRKTNQITALSWS------PDGELIITSVENGELRLWN-KDG 269
           K++S+        + ++T +K  +  +  ++      P G L++     GEL+L++    
Sbjct: 396 KLLSTAS-NGELKVWNLTTKKCIRTFSCGYALCSQMLPGGLLVVVGTRQGELQLFDLASS 454

Query: 270 RLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWN--AINGIIL---QHFEPEQKLE 324
            L +    H + I S+    + K  ++   D     W+   +  ++      + P+ KL 
Sbjct: 455 TLLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLV 514

Query: 325 NNT------ESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFN 378
           ++T      + L V I   D+  L V  ++ ++ V+  D  K    L GH+  +  I+F+
Sbjct: 515 HDTTLELTDDILAVKISSEDR-YLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFS 573

Query: 379 VNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDL-VISASMDGSVRI 437
           V+S++L+TSS +D +I+IW     +C    + H  SI+S+ +  D     S   DG+V+ 
Sbjct: 574 VDSKMLITSS-ADKNIKIWGVDFGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKR 632

Query: 438 W 438
           W
Sbjct: 633 W 633

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 82/168 (48%), Gaps = 21/168 (12%)

Query: 237 KTNQITALSWSPDGELIITSVENGELRLWN---KDGRLQNVFNFHRSPIVSIKWNEDSKH 293
           K + +TA+ +  + EL+    E+G +++W+   K   +Q  FN H+S +  ++ + +   
Sbjct: 72  KPSVVTAMCFHKETELLCVGYEDGVIKVWDLLSKSVLMQ--FNGHKSGVTVLRLDSEGTR 129

Query: 294 FISLDLDNITILWNAINGIILQHFEPEQKLENNTESL-GVDIEWVDK--DKLVVPGVNGS 350
            +S   D+  I+W+ +  + L       KL ++ +++ G+   W+D   D L+    +G 
Sbjct: 130 LVSGSKDSDLIIWDLVGEVGL------MKLRSHKDAITGI---WIDHNMDWLISVAKDGL 180

Query: 351 ILVYSID-DNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           I V+ +    + +   + H G   C    ++  +++T+S  D   +IW
Sbjct: 181 IKVWDLKAGGQCVETHMAHTG--QCWSMAIDEEVIITTS-MDSQAKIW 225

>Scas_631.17
          Length = 474

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 118/275 (42%), Gaps = 25/275 (9%)

Query: 171 AKTLNEVQTLDN----KVVTSSWNLQNERLLAYGQEDSMAKMIEYNKEDKKIISSLELRH 226
            KTL+ +  ++N    K+   +WN  N  L++ G +D + K+  ++  D KII  L    
Sbjct: 215 TKTLDVISGIENGHDGKIGGLAWNSTNTHLVS-GADDCLVKIHSFDP-DVKIIKELT--- 269

Query: 227 PFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFN-FHRSPIVSI 285
             AL   TGR  N    + + P G  + ++  +   RLW+ +   +  F   H   + S+
Sbjct: 270 --ALQGHTGRVVN----VDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSL 323

Query: 286 KWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEW-VDKDKLVV 344
            +  D     S  LDN  I+W+   G  + + +   K   +       ++W  D   +  
Sbjct: 324 SFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYS-------VDWSPDGYHIAT 376

Query: 345 PGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENC 404
            G +G I ++ I       +LL H   ++ + F  ++   L S   D  IRI+       
Sbjct: 377 GGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQ 436

Query: 405 CNCFYGHSQSIISLSWIND-DLVISASMDGSVRIW 438
                GH+  I+ +    D  L++S+  D S+++W
Sbjct: 437 VKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 81/176 (46%), Gaps = 9/176 (5%)

Query: 323 LENNTESLGVDIEWVDKDKLVVPGVNGSIL-VYSIDDN----KPIGKLLGHQGTISCIEF 377
           +EN  +     + W   +  +V G +  ++ ++S D +    K +  L GH G +  ++F
Sbjct: 224 IENGHDGKIGGLAWNSTNTHLVSGADDCLVKIHSFDPDVKIIKELTALQGHTGRVVNVDF 283

Query: 378 NVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDD-LVISASMDGSVR 436
           + + R + ++S  D + R+W  + E       GH + + SLS+ ND  L+ S  +D +  
Sbjct: 284 HPSGRFVASAS-FDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGALLCSGGLDNAAI 342

Query: 437 IWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIKRF--VSRLL 490
           +W V     +         I     S D    A G  +G IN++DI++    +RLL
Sbjct: 343 VWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETTRLL 398

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 63/299 (21%), Positives = 122/299 (40%), Gaps = 57/299 (19%)

Query: 193 NERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSIT--GRKTNQITALSWSPDG 250
           + RL+A G +DS  K+  ++ +   + S L  +   A +++T  G  +  + ++S+SPD 
Sbjct: 498 DSRLVAAGFQDSYIKL--WSLDGTPLESQLPSKAKDASNTVTLIGH-SGPVYSVSFSPDN 554

Query: 251 ELIITSVENGELRLWNKDGRLQNV-FNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAI 309
             ++++ E+  +RLW+ D     V +  H  P+  +K++    +F +   D    LW   
Sbjct: 555 RYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLW--- 611

Query: 310 NGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQ 369
                                                        S D   P+    GH 
Sbjct: 612 ---------------------------------------------SCDHIYPLRIFAGHL 626

Query: 370 GTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDL-VIS 428
             + C+ F+ N   +LT S SD + R+W  Q  +    F GH+ S++S++   D   + +
Sbjct: 627 NDVDCVTFHPNGTYVLTGS-SDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTT 685

Query: 429 ASMDGSVRIWSVVENCLVGMAMVDG-NAIICGKISHDKNKFAIGSMNGQINVYDIKRFV 486
            S DG + +W +     +      G +A+     + + N    G  +  + V+D+K+F 
Sbjct: 686 GSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLKKFT 744

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 80/152 (52%), Gaps = 9/152 (5%)

Query: 291 SKHFISLDLDNITI-LWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNG 349
           S+ ++ + L + TI LW+   G +L  FE     ++     G+D     +   V  G + 
Sbjct: 22  SRPWVLVALFSSTIQLWDYRMGTLLHRFE-----DHEGPVRGLDFH-PTQPIFVSAGDDY 75

Query: 350 SILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFY 409
           +I V+S+D NK +  L GH   +  + F+     ++++SD D +IRIW+ Q      C  
Sbjct: 76  TIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASD-DQTIRIWNWQNRKEIACLT 134

Query: 410 GHSQSIISLSW-INDDLVISASMDGSVRIWSV 440
           GH+  ++   +   DDL++SAS+D ++RIW +
Sbjct: 135 GHNHFVMCAQFHPTDDLIVSASLDETIRIWDI 166

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 71/137 (51%), Gaps = 8/137 (5%)

Query: 305 LWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGK 364
           LW+   G++L  FE     E+     GVD     +   V  G + SI V+S+  +K +  
Sbjct: 37  LWDYRMGVLLHRFE-----EHEGPVRGVDFH-PTQPLFVSAGDDYSIKVWSLSTHKCLFT 90

Query: 365 LLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW-IND 423
           L GH   +  + F+     ++++SD D +IRIW+ Q      C  GH+  ++   +   +
Sbjct: 91  LNGHLDYVRTVFFHTELPWIISASD-DQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTE 149

Query: 424 DLVISASMDGSVRIWSV 440
           DLV+SAS+D +VRIW +
Sbjct: 150 DLVVSASLDETVRIWDI 166

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 39/204 (19%), Positives = 86/204 (42%), Gaps = 31/204 (15%)

Query: 242 TALSWSPDGELIITSVENGELRLWNKDGRLQ-NVFNFHRSPIVSIKWNEDSKHFISLDLD 300
           T L W      II++ ++  +R+WN   R +      H   ++  +++      +S  LD
Sbjct: 105 TELPW------IISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTEDLVVSASLD 158

Query: 301 NITILWNAINGIILQHFEP-EQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDN 359
               +W+ I+G+  +H  P  Q  E          + + +  L   G    ++ + ++  
Sbjct: 159 ETVRIWD-ISGLRKRHSAPGSQSFEE---------QMITQQNLFDGGFGDCVVKFILE-- 206

Query: 360 KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENC--CNCFYGHSQSIIS 417
                  GH   ++   F+    L+++ SD D  +++W          +   GH+ ++ S
Sbjct: 207 -------GHTRGVNWASFHPTLPLIVSGSD-DRQVKLWRMSSTKAWEVDTCRGHTNNVDS 258

Query: 418 LSWIN-DDLVISASMDGSVRIWSV 440
           + +    +L+IS   D ++R+W +
Sbjct: 259 VIFHPFQNLIISVGEDSTIRVWDL 282

>Kwal_23.6240
          Length = 913

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 114/240 (47%), Gaps = 34/240 (14%)

Query: 243 ALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDN 301
           A+++SPDG  ++T+ E+G++++W+   G     F  H + + ++ + +  +   S  LD 
Sbjct: 346 AVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQEHTAAVSALAFAKRGQVLFSASLDG 405

Query: 302 ITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGV--NGSILVYSIDDN 359
               W+ +     + F   ++++ N   L  D       ++V  G   + ++ V+S+   
Sbjct: 406 TVRAWDLVRYRNFRTFTAAERIQFNC--LAAD----PSGEVVCAGSVDSFAVHVWSVQTG 459

Query: 360 KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLS 419
           + +  L GH+G +SC+ F+  + +L ++S  D +IRIW           +G SQ +  L 
Sbjct: 460 QLVETLDGHEGPVSCLSFSQENSVLASAS-WDKTIRIW---------SIFGRSQQVEPLE 509

Query: 420 WINDDL----------VISASMDGSVRIWSVVENCLVGMAMVDGNA-IICGKISHDKNKF 468
              D L          V +A++DG +  + V E   V    +DG   I+ G+  H +++F
Sbjct: 510 VYADVLSLSVRPDGNEVAAATLDGQILFFDVHEGKQVN--AIDGKKDILSGR--HLEDRF 565

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 56/282 (19%), Positives = 112/282 (39%), Gaps = 24/282 (8%)

Query: 227 PFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKD----GRLQNVFNFHRSPI 282
           PF    +     + I +L+WS D   +I++ ++   R+W+ D    G     F  HR  +
Sbjct: 135 PFVRHRVHAGHFSNIISLTWSRDSRFLISTSKDLTARIWSLDSQEKGLASVTFAGHRDYV 194

Query: 283 VSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLE-------------NNTES 329
           +   ++ D +   ++  D     W        +  E +++ E             N   +
Sbjct: 195 MGAFFSADQERIYTVSKDGAVFQWEYTPRPGFESPEQDEETEIDPSLYSWRITKKNYFYA 254

Query: 330 LGVDIEWV----DKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLL 385
               ++ V    + + LVV   NG   +Y + +   I +L   Q  ++ +  N +   L 
Sbjct: 255 SQARVKCVTFHANSNTLVVGFNNGEFRLYELPEFTLIQQLSMGQNAVNTVCVNDSGEWLA 314

Query: 386 TSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIND-DLVISASMDGSVRIWSVVEN- 443
             S     + ++  Q E+      GH  +  ++++  D   V++AS DG ++IW VV   
Sbjct: 315 FGSSKLGQLLVYEWQSESYILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGF 374

Query: 444 CLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIKRF 485
           CLV                  +  F+  S++G +  +D+ R+
Sbjct: 375 CLVTFQEHTAAVSALAFAKRGQVLFS-ASLDGTVRAWDLVRY 415

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 58/300 (19%), Positives = 113/300 (37%), Gaps = 48/300 (16%)

Query: 224 LRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNF-HRSPI 282
           ++  F  S++ G    Q   L +S DG  +I+ V N  + +++        F + HR  +
Sbjct: 1   MKSDFRFSNLLGTVYRQGNIL-FSEDGTQLISPVGN-RVSVFDLIHNKSYTFEYEHRKNV 58

Query: 283 VSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKL 342
             +  N      +S+D D   IL N     +L HF  ++ +         D+++    K+
Sbjct: 59  QCVALNPQGTLLLSVDEDGRAILVNFRAKTVLHHFNFKEPVS--------DLKFSPDGKV 110

Query: 343 VVPGVNGSILVYSIDD---NKPIGKLL------GHQGTISCIEFNVNSRLLLTSSDSDYS 393
                   + V+   D   ++     +      GH   I  + ++ +SR L+++S  D +
Sbjct: 111 FAIACGRFVQVWKTPDVAEDRQFAPFVRHRVHAGHFSNIISLTWSRDSRFLISTS-KDLT 169

Query: 394 IRIW---HGQKENCCNCFYGHSQSIISLSWIND-DLVISASMDGSVRIWSV--------- 440
            RIW     +K      F GH   ++   +  D + + + S DG+V  W           
Sbjct: 170 ARIWSLDSQEKGLASVTFAGHRDYVMGAFFSADQERIYTVSKDGAVFQWEYTPRPGFESP 229

Query: 441 -------VENCLVGMAMVDGN-------AIICGKISHDKNKFAIGSMNGQINVYDIKRFV 486
                  ++  L    +   N        + C     + N   +G  NG+  +Y++  F 
Sbjct: 230 EQDEETEIDPSLYSWRITKKNYFYASQARVKCVTFHANSNTLVVGFNNGEFRLYELPEFT 289

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 72/137 (52%), Gaps = 8/137 (5%)

Query: 305 LWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGK 364
           LW+   G++L  FE     ++     G+D     +   V  G + +I V+S++ NK +  
Sbjct: 37  LWDYRMGVLLHRFE-----DHEGPVRGIDFH-PTQPLFVSAGDDYTIKVWSLESNKCLFT 90

Query: 365 LLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIN-D 423
           L GH   +  + F+     +++SSD D +IRIW+ Q      C  GH+  ++   +   +
Sbjct: 91  LDGHLDYVRTVFFHHELPWIISSSD-DQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVE 149

Query: 424 DLVISASMDGSVRIWSV 440
           DLV+SAS+D +VR+W +
Sbjct: 150 DLVVSASLDETVRVWDI 166

 Score = 37.0 bits (84), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 86/192 (44%), Gaps = 23/192 (11%)

Query: 253 IITSVENGELRLWNKDGRLQ-NVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAING 311
           II+S ++  +R+WN   R +      H   ++  +++      +S  LD    +W+ I+G
Sbjct: 110 IISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVEDLVVSASLDETVRVWD-ISG 168

Query: 312 IILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGT 371
           +  +H  P       T+S     E + + + ++ G  G  +V  I        L GH   
Sbjct: 169 LRKRHSAP------GTQSFE---EQMRQQQNLLDGGFGDCVVKFI--------LEGHTRG 211

Query: 372 ISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENC--CNCFYGHSQSIISLSW-INDDLVIS 428
           ++   F+    L+++ SD D  +++W          +   GH+ ++ S+ +    +L+IS
Sbjct: 212 VNWASFHPTLPLIVSGSD-DRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPQQNLIIS 270

Query: 429 ASMDGSVRIWSV 440
              D +VR+W +
Sbjct: 271 VGEDKTVRVWDL 282

>Kwal_56.23920
          Length = 937

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 94/211 (44%), Gaps = 18/211 (8%)

Query: 243 ALSWSPDGELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLD 300
           A  + P G L++   + G+L L++      L  +   H   I S+    D K  ++   D
Sbjct: 429 ACKFLPGGALVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGKRLVTGSAD 488

Query: 301 NITILWN------AINGIILQHFEPEQK------LENNTESLGVDIEWVDKDKLVVPGVN 348
                W+       + G     F P+ K      LE N + L V I   D   L V  ++
Sbjct: 489 KTVCFWDFQVEQEPVPGTT-DKFNPKLKMFHDTTLELNDDVLAVKIS-PDNRLLAVSLLD 546

Query: 349 GSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCF 408
            ++ V+ +D  K    L GH+  +  I+ + +S+LL+TSS +D +I+IW     +C    
Sbjct: 547 NTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSS-ADKNIKIWGLDFGDCHRSL 605

Query: 409 YGHSQSIISLSWINDDL-VISASMDGSVRIW 438
           + H+ SI+ + ++ +     S S D  V+ W
Sbjct: 606 FAHNDSIMKVVFVPESHNFFSCSKDALVKYW 636

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 49/274 (17%), Positives = 105/274 (38%), Gaps = 66/274 (24%)

Query: 237 KTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNV-FNFHRSPIVSIKWNEDSKHFI 295
           K  + + L + P+  L+     +G +++W+   +   + FN H+S I  + +++     I
Sbjct: 74  KPAETSYLQYHPETRLLAVGYNDGAIKIWDLLSKSVLISFNGHKSAITILTFDQTGTRLI 133

Query: 296 SLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYS 355
           S   D+  I+W+ +                                       G + +Y 
Sbjct: 134 SGSRDSDIIVWDLV---------------------------------------GEVGLY- 153

Query: 356 IDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSI 415
                   KL  H+ +I+ +       L+ TS D    I++W  + + C      H    
Sbjct: 154 --------KLRSHKDSITGLWCEGEEWLISTSKDG--LIKVWDLKVQQCVETHVAHVGEC 203

Query: 416 ISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVD-----------GNAIICGKISHD 464
            S+  +++DLVI+A  D  +++W++      G  +++           G AI    +S +
Sbjct: 204 WSMG-VHEDLVITAGADNQIKLWNLNFEESAGSMLIEKGTHEKQSRQRGVAIQFTTVSDE 262

Query: 465 KNKFAIGSMNGQINVYDIKR---FVSRLLKRDKK 495
              F I + +  +  + +++       L KR+K+
Sbjct: 263 TTFFFIQNADRSVETFRLRKQDEIAKALKKREKR 296

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 55/262 (20%), Positives = 105/262 (40%), Gaps = 23/262 (8%)

Query: 241 ITALSWSPDGELIITSVENGELRLWNKDGR-LQNVFNF-------------HRSPIVSIK 286
           +T + +S D  L     ++  +++W  DG  LQ++                H  P+ S+ 
Sbjct: 501 MTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVA 560

Query: 287 WNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPG 346
           ++ D+++ +S   D    LW+      L  ++      +N     V    +     +   
Sbjct: 561 FSPDNRYLLSASEDKTVRLWSLDTFTCLVCYK-----GHNHPVWYVKFSPLGH-YFITAS 614

Query: 347 VNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCN 406
            + +  ++S D   P+    GH   + C  F+ N   + T S SD + R+W  Q  +   
Sbjct: 615 HDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGS-SDKTCRMWDIQTGDSVR 673

Query: 407 CFYGHSQSIISLSWINDDL-VISASMDGSVRIWSVVENCLVGMAMVDG-NAIICGKISHD 464
            F GH+  + +L    D   + + S DG++ +W +     +      G N I     + +
Sbjct: 674 LFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKE 733

Query: 465 KNKFAIGSMNGQINVYDIKRFV 486
            N    G  +  + V+DIKRF 
Sbjct: 734 GNCLVTGGADQSVRVWDIKRFT 755

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 55/114 (48%), Gaps = 6/114 (5%)

Query: 238 TNQITALSWSPDGELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSKHFI 295
           T+ +TAL  SPDG  + T  E+G + +W+     R++ +    ++PI SI +N++    +
Sbjct: 679 TSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLV 738

Query: 296 SLDLDNITILWNAINGIILQHFEPEQKLENNTE----SLGVDIEWVDKDKLVVP 345
           +   D    +W+          EPEQ+    +     S+  DI+   + + V+P
Sbjct: 739 TGGADQSVRVWDIKRFTNEPGMEPEQQFNTYSGDMELSVNNDIKEFGRRRAVIP 792

>Scas_713.50
          Length = 983

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 97/206 (47%), Gaps = 18/206 (8%)

Query: 248 PDGELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITIL 305
           P G L+I     GEL+L++     ++ N+   H + I S+    D K  I+   D     
Sbjct: 478 PGGMLVIIGTRAGELQLFDLASSTQIANIEEAHDAAIWSLDLTSDGKRLITGSADKSVKF 537

Query: 306 WN------AINGIILQHFEPEQKLENNT------ESLGVDIEWVDKDKLVVPGVNGSILV 353
           WN       + G     F P+  L ++T      + L V +   DK  L V  ++ ++ V
Sbjct: 538 WNFQLEQELVPGTS-DKFVPKLGLHHDTTLELSDDILSVRVSPEDK-FLAVSLLDNTVKV 595

Query: 354 YSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQ 413
           + +D  K    L GH+  +  I+ + +S++++TSS +D +I+IW     +C    + H  
Sbjct: 596 FFLDSMKFFLSLYGHKLPVLSIDISFDSKMIITSS-ADKNIKIWGLDFGDCHKSLFAHQD 654

Query: 414 SIISLSWINDDL-VISASMDGSVRIW 438
           SI+++ ++ +     S S DG ++ W
Sbjct: 655 SIMNVKFVPESHNFFSCSKDGIIKYW 680

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 51/108 (47%), Gaps = 9/108 (8%)

Query: 341 KLVVPGVNGSILVYSIDDNKPIGKLLGHQGTIS---CIEFNVNSRL-----LLTSSDSDY 392
           +L+    + +I+V+ +     + KL  H+  I+   C E   N++       L S+  D 
Sbjct: 162 RLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTNNNQEENELDWLISTSKDG 221

Query: 393 SIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV 440
            I+IW  + + C      H+    SL+ + +DLVI+ S D  V+ W +
Sbjct: 222 LIKIWDLKIQQCVETHIAHTGECWSLA-VRNDLVITTSSDSQVKFWQL 268

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 44/93 (47%), Gaps = 8/93 (8%)

Query: 232 SITGRKTNQITALSWSPDGELIITSVENGELRLWNKD-GRLQNVFNFHRSPIVSIKWNED 290
           S+ G K   + ++  S D ++IITS  +  +++W  D G        H+  I+++K+  +
Sbjct: 606 SLYGHKL-PVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPE 664

Query: 291 SKHFISLDLDNITILWNAINGIILQHFEPEQKL 323
           S +F S   D I   W+         FE  QKL
Sbjct: 665 SHNFFSCSKDGIIKYWDG------DKFECIQKL 691

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 94/204 (46%), Gaps = 14/204 (6%)

Query: 248 PDGELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITIL 305
           P G L+I    NGEL+L++      L  + + H + I S+    D K  ++   D     
Sbjct: 440 PGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499

Query: 306 W-----NAINGIILQHFEPEQKLENNTE-SLGVDIEWV----DKDKLVVPGVNGSILVYS 355
           W     N++       F P  KL ++T   L  DI  V    D   L +  ++ ++ V+ 
Sbjct: 500 WDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVSPDDRYLAISLLDNTVKVFF 559

Query: 356 IDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSI 415
           +D  K    L GH+  +  I+ + +S++++TSS +D +I+IW     +C    + H  SI
Sbjct: 560 LDSMKFYLSLYGHKLPVLSIDISFDSKMIITSS-ADKNIKIWGLDFGDCHKSLFAHQDSI 618

Query: 416 ISLSWINDDL-VISASMDGSVRIW 438
           +++ ++       S S D  V+ W
Sbjct: 619 MNVKFLPQSHNFFSCSKDAVVKYW 642

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 85/189 (44%), Gaps = 15/189 (7%)

Query: 218 IISSLELRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGR--LQNVF 275
           ++S L    P   S   G K  + T L    D +L+     +G +++W+   +  L N F
Sbjct: 59  LVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSKTVLLN-F 117

Query: 276 NFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIE 335
           N H++ I  ++++      IS   D+  I+W+ +  + L       KL ++ +S  +   
Sbjct: 118 NGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGL------YKLRSHKDS--ITGF 169

Query: 336 WVD-KDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSI 394
           W   +D L+    +G I ++ +  ++ I   + H G   C    V   LL+T+  +D  +
Sbjct: 170 WCQGEDWLISTSKDGMIKLWDLKTHQCIETHIAHTG--ECWGLAVKDDLLITTG-TDSQV 226

Query: 395 RIWHGQKEN 403
           +IW    EN
Sbjct: 227 KIWKLDIEN 235

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 48/104 (46%), Gaps = 3/104 (2%)

Query: 338 DKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFN-VNSRLLLTSSDSDYSIRI 396
           D D L V   +G I V+ +     +    GH+  I+ ++F+   +RL+  S DS+  I +
Sbjct: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSN--IIV 147

Query: 397 WHGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV 440
           W    E        H  SI       +D +IS S DG +++W +
Sbjct: 148 WDLVGEVGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDL 191

>Scas_624.11
          Length = 1205

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 79/152 (51%), Gaps = 9/152 (5%)

Query: 291 SKHFISLDLDNITI-LWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNG 349
           S+ ++ + L + TI LW+   G +L  FE     ++      VD     +   V  G + 
Sbjct: 22  SRPWVLVALFSSTIQLWDYRMGTLLHRFE-----DHEGPVRSVDFH-PTQPIFVSGGDDY 75

Query: 350 SILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFY 409
           +I V+S++ NK +  L GH   I  + F+     ++++SD D +IRIW+ Q      C  
Sbjct: 76  TIKVWSLETNKCLYTLNGHLDYIRTVFFHKELPWIISASD-DQTIRIWNWQNRKEIACLT 134

Query: 410 GHSQSIISLSW-INDDLVISASMDGSVRIWSV 440
           GH+  ++   +   DDLV+SAS+D ++R+W +
Sbjct: 135 GHNHFVMCAQFHPTDDLVVSASLDETIRVWDI 166

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 69/137 (50%), Gaps = 8/137 (5%)

Query: 305 LWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGK 364
           LW+   G +L  FE  +          VD     +   V  G + SI V+S++ N+ +  
Sbjct: 37  LWDYRMGTLLHRFEGHEG-----PVRAVDFH-PTQPIFVSAGDDASIKVWSLETNRCLYT 90

Query: 365 LLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW-IND 423
           L GH   +  + F+     ++++SD D ++RIW+ Q      C  GH+  ++   +   +
Sbjct: 91  LTGHLDYVRTVFFHSELPWVISASD-DQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTE 149

Query: 424 DLVISASMDGSVRIWSV 440
           DLV+SAS+D +VR+W +
Sbjct: 150 DLVVSASLDETVRVWDI 166

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 65/131 (49%), Gaps = 16/131 (12%)

Query: 362 IGKLL----GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIIS 417
           +G LL    GH+G +  ++F+    + +++ D D SI++W  +   C     GH   + +
Sbjct: 42  MGTLLHRFEGHEGPVRAVDFHPTQPIFVSAGD-DASIKVWSLETNRCLYTLTGHLDYVRT 100

Query: 418 LSWINDDL--VISASMDGSVRIWSVVEN----CLVGMAMVDGNAIICGKISHDKNKFAIG 471
           + + + +L  VISAS D +VRIW+        CL G      + ++C +    ++     
Sbjct: 101 V-FFHSELPWVISASDDQTVRIWNWQNRKELACLTG----HNHFVMCAQFHQTEDLVVSA 155

Query: 472 SMNGQINVYDI 482
           S++  + V+DI
Sbjct: 156 SLDETVRVWDI 166

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 238 TNQITALSWSPDGELIITSVENGELRLWNKDGR 270
           TN +  + + PD  LI++  E+  LR+W+ D R
Sbjct: 253 TNNVDCVVFHPDQNLILSVAEDKTLRIWDLDKR 285

>Kwal_56.24526
          Length = 1210

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 70/137 (51%), Gaps = 8/137 (5%)

Query: 305 LWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGK 364
           LW+   G +L  FE     ++     G+D     +   V  G + +I V+S+D  K +  
Sbjct: 37  LWDYRMGTLLHKFE-----DHEGPVRGIDFH-PTQPLFVSAGDDYTIKVWSLDTKKCLFT 90

Query: 365 LLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW-IND 423
           L GH   +  + F+     ++++SD D +IRIW+ Q      C  GH+  ++   +   +
Sbjct: 91  LNGHLDYVRTVFFHRELPWIISASD-DQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTE 149

Query: 424 DLVISASMDGSVRIWSV 440
           DLV+SAS+D +VR+W +
Sbjct: 150 DLVVSASLDETVRVWDI 166

 Score = 33.1 bits (74), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 39/191 (20%), Positives = 82/191 (42%), Gaps = 25/191 (13%)

Query: 253 IITSVENGELRLWNKDGRLQ-NVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAING 311
           II++ ++  +R+WN   R +      H   ++   ++      +S  LD    +W+ I+G
Sbjct: 110 IISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTEDLVVSASLDETVRVWD-ISG 168

Query: 312 IILQHFEPEQ-KLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQG 370
           +  +H  P    LE+           +   + ++ G  G  +V  I        L GH  
Sbjct: 169 LRKRHSAPSTYTLEDQ----------IAAQQNLLDGGFGDCVVKFI--------LEGHSR 210

Query: 371 TISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENC--CNCFYGHSQSIISLSW-INDDLVI 427
            ++   F+    L+++  D D  +++W          +   GH+ ++ S+ +  + +L+I
Sbjct: 211 GVNWASFHPTLPLIVSGGD-DRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNLII 269

Query: 428 SASMDGSVRIW 438
           S   D +VR+W
Sbjct: 270 SVGEDKTVRVW 280

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 70/313 (22%), Positives = 134/313 (42%), Gaps = 64/313 (20%)

Query: 174 LNEVQTLDNKVVTSSWNLQNERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSI 233
           +  +Q   N V+  SW+   E L+A G  D+  ++ E +K             P+   ++
Sbjct: 179 MCTLQGHHNWVLCCSWSPDGE-LIATGSMDNTIRLWESSKGK-----------PYG-DAL 225

Query: 234 TGRKTNQITALSWSP-------DGELIITSVENGELRLWNKDGRLQNV-FNFHRSPIVSI 285
            G  +  IT+LSW P       D   + T+ ++G +++W+   R+  +    H S +  +
Sbjct: 226 RGH-SKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLTLCGHTSSVSCV 284

Query: 286 KWNEDSKHFISLDLDNITILWNA-ING----IILQHF----------------------- 317
           KW   +  + S   D     W+  +NG    I+  H                        
Sbjct: 285 KWGGKNVLY-SGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYALRLGAFDHKG 343

Query: 318 -------EPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVY--SIDDNKPIGKLLGH 368
                  E +QK   N E +       D ++L+V   +   +     +   KPI ++ GH
Sbjct: 344 ETPASPEEAQQKALKNYEKVAKRKG--DFEELMVTASDDFTMYLWNPLKSTKPITRMTGH 401

Query: 369 QGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIND-DLVI 427
           Q  ++ + F+ + R ++++S  D SI++W G+     + F GH  S+  ++W +D  L++
Sbjct: 402 QKLVNHVAFSPDGRYIVSAS-FDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSSDCRLLV 460

Query: 428 SASMDGSVRIWSV 440
           S S D ++++W V
Sbjct: 461 SCSKDTTLKVWDV 473

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 62/144 (43%), Gaps = 15/144 (10%)

Query: 360 KPIGK----LLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSI 415
           KP+ +    + GH  TI C  F  N+   + +   D +  IW    +       GH   +
Sbjct: 130 KPVTRSSSAIAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDCDTQTRMCTLQGHHNWV 189

Query: 416 ISLSWIND-DLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKIS---------HDK 465
           +  SW  D +L+ + SMD ++R+W   +    G A+  G++     +S          DK
Sbjct: 190 LCCSWSPDGELIATGSMDNTIRLWESSKGKPYGDAL-RGHSKWITSLSWEPIHLVKPGDK 248

Query: 466 NKFAIGSMNGQINVYDIKRFVSRL 489
            + A  S +G I ++D  R V  L
Sbjct: 249 PRLATASKDGTIKIWDTTRRVCLL 272

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 68/150 (45%), Gaps = 11/150 (7%)

Query: 251 ELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNA 308
           EL++T+ ++  + LWN  K  +       H+  +  + ++ D ++ +S   DN   LW+ 
Sbjct: 372 ELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 309 INGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSIL-VYSIDDNKPIGKLLG 367
            +G  L  F        +  S+   + W    +L+V     + L V+ +   K    L G
Sbjct: 432 RDGKFLSTF------RGHVASV-YQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPG 484

Query: 368 HQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           HQ  +  ++++V+ + +  S   D  +RIW
Sbjct: 485 HQDEVYTVDWSVDGKRVC-SGGKDKMVRIW 513

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 64/143 (44%), Gaps = 10/143 (6%)

Query: 300 DNITI-LWNAINGI-ILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSID 357
           D+ T+ LWN +     +      QKL N+  +   D  ++     V    + SI ++   
Sbjct: 379 DDFTMYLWNPLKSTKPITRMTGHQKLVNHV-AFSPDGRYI-----VSASFDNSIKLWDGR 432

Query: 358 DNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIIS 417
           D K +    GH  ++  + ++ + RLL++ S  D ++++W  +         GH   + +
Sbjct: 433 DGKFLSTFRGHVASVYQVAWSSDCRLLVSCS-KDTTLKVWDVKTRKLSVDLPGHQDEVYT 491

Query: 418 LSW-INDDLVISASMDGSVRIWS 439
           + W ++   V S   D  VRIW+
Sbjct: 492 VDWSVDGKRVCSGGKDKMVRIWT 514

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/195 (19%), Positives = 75/195 (38%), Gaps = 27/195 (13%)

Query: 253 IITSVENGELRLWNKDGRLQ-NVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAING 311
           ++T   +    +W+ D + +      H + ++   W+ D +   +  +DN   LW +  G
Sbjct: 159 MVTGAGDNTACIWDCDTQTRMCTLQGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSKG 218

Query: 312 IILQHFEPEQKLENNTESLGVDIEW--------VDKDKLVVPGVNGSILVYSIDDNKPIG 363
                 +P              + W         DK +L     +G+I ++       + 
Sbjct: 219 ------KPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLL 272

Query: 364 KLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQ-KENCCNCFYGHSQSIISLSWIN 422
            L GH  ++SC+++    + +L S   D +IR W       C N    H+       W+N
Sbjct: 273 TLCGHTSSVSCVKW--GGKNVLYSGSHDKTIRCWDMNLNGKCINILKSHAH------WVN 324

Query: 423 DDLVISASMDGSVRI 437
               +S S D ++R+
Sbjct: 325 H---LSLSTDYALRL 336

 Score = 32.7 bits (73), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 230 LSSITGRKTNQITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWN 288
           LS+  G     +  ++WS D  L+++  ++  L++W+ K  +L      H+  + ++ W+
Sbjct: 437 LSTFRGH-VASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWS 495

Query: 289 EDSKHFISLDLDNITILWN 307
            D K   S   D +  +W 
Sbjct: 496 VDGKRVCSGGKDKMVRIWT 514

>Scas_720.95
          Length = 515

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 106/223 (47%), Gaps = 30/223 (13%)

Query: 229 ALSSITGRKTNQITALSWSPDGELIITSVENGELRLW--NKDGRLQNVFNFHRSPIVSIK 286
            L +++G  TN ++ + WS  G +I +   +  +R+W  N DG+  N+   H   +    
Sbjct: 270 CLYTMSGH-TNSVSCIKWSGQG-IIYSGSHDKTVRVWDMNADGKCINILKSHAHWV---- 323

Query: 287 WNEDSKHFISLDLDNITILWNAINGIILQH--FEPEQKLENNTESLGVDIEWVDKDK--- 341
                 + +SL  D       A+      H   +P    +   ++L    + V K+    
Sbjct: 324 ------NHLSLSTDY------ALRVGAFDHTGAQPASAKDARDKALANYEKVVKKNGKLE 371

Query: 342 --LVVPGVNGSILVY-SIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH 398
             +V    + ++ ++  +  NKPI ++ GHQ  ++ + F+ + R ++++S  D SI++W 
Sbjct: 372 ELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHVAFSPDGRYIVSAS-FDNSIKLWD 430

Query: 399 GQKENCCNCFYGHSQSIISLSWIND-DLVISASMDGSVRIWSV 440
           G+     + F GH  S+  ++W  D  L++S S D ++++W V
Sbjct: 431 GRDGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDV 473

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 71/152 (46%), Gaps = 13/152 (8%)

Query: 341 KLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQ 400
           ++V    + +  ++  D   P   L GH   + C+ +  N  ++ T S  D +IR+W  +
Sbjct: 158 RMVTGAGDNTARIWDCDTQTPKATLTGHFNWVLCVSYCPNGEVIATGS-MDNTIRLWDSK 216

Query: 401 K-ENCCNCFYGHSQSIISLSWINDDLV--------ISASMDGSVRIWSVVEN-CLVGMAM 450
             +   +   GH + I SL+W    LV         SAS DG++RIW +    CL  M+ 
Sbjct: 217 DGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDITRRVCLYTMSG 276

Query: 451 VDGNAIICGKISHDKNKFAIGSMNGQINVYDI 482
              N++ C K S     ++ GS +  + V+D+
Sbjct: 277 -HTNSVSCIKWSGQGIIYS-GSHDKTVRVWDM 306

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 60/140 (42%), Gaps = 13/140 (9%)

Query: 360 KPIGK----LLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSI 415
           KP+ +    + GH  TI C  F  N+   + +   D + RIW    +       GH   +
Sbjct: 130 KPVTRSSSAIAGHGSTILCSAFAPNTSSRMVTGAGDNTARIWDCDTQTPKATLTGHFNWV 189

Query: 416 ISLSWI-NDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKI--------SHDKN 466
           + +S+  N +++ + SMD ++R+W   +   +G A+      I              +  
Sbjct: 190 LCVSYCPNGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESP 249

Query: 467 KFAIGSMNGQINVYDIKRFV 486
           + A  S +G I ++DI R V
Sbjct: 250 RLASASKDGTIRIWDITRRV 269

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 78/176 (44%), Gaps = 14/176 (7%)

Query: 267 KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITI-LWNAI-NGIILQHFEPEQKLE 324
           KD R + + N+ +     +K N   +  +    D+ T+ LWN + +   +      QKL 
Sbjct: 350 KDARDKALANYEKV----VKKNGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLV 405

Query: 325 NNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLL 384
           N+  +   D  ++     V    + SI ++   D K I    GH  ++  + ++ + RLL
Sbjct: 406 NHV-AFSPDGRYI-----VSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSADCRLL 459

Query: 385 LTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW-INDDLVISASMDGSVRIWS 439
           ++ S  D ++++W  +         GH   + ++ W ++   V S   D  VRIW+
Sbjct: 460 VSCS-KDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRIWT 514

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/245 (20%), Positives = 100/245 (40%), Gaps = 58/245 (23%)

Query: 196 LLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQITALSWSPDGELIIT 255
           L +    ++ ++M+    ++   I   + + P A  ++TG   N +  +S+ P+GE+I T
Sbjct: 147 LCSAFAPNTSSRMVTGAGDNTARIWDCDTQTPKA--TLTGH-FNWVLCVSYCPNGEVIAT 203

Query: 256 SVENGELRLWN-KDGR-LQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGII 313
              +  +RLW+ KDG+ L +    H   I S+ W                          
Sbjct: 204 GSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAW-------------------------- 237

Query: 314 LQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTIS 373
               EP   ++             +  +L     +G+I ++ I     +  + GH  ++S
Sbjct: 238 ----EPIHLVKPG-----------ESPRLASASKDGTIRIWDITRRVCLYTMSGHTNSVS 282

Query: 374 CIEFNVNSRLLLTSSDSDYSIRIWHGQKEN-CCNCFYGHSQSIISLSWINDDLVISASMD 432
           CI++  + + ++ S   D ++R+W    +  C N    H+       W+N    +S S D
Sbjct: 283 CIKW--SGQGIIYSGSHDKTVRVWDMNADGKCINILKSHAH------WVNH---LSLSTD 331

Query: 433 GSVRI 437
            ++R+
Sbjct: 332 YALRV 336

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/247 (21%), Positives = 91/247 (36%), Gaps = 52/247 (21%)

Query: 241 ITALSWSPDGELIITSVENGELRLWNKDGRLQNV-FNFHRSPIVSIKWNEDSKHFISLDL 299
           + + S+SPD + +++  E+  +RLW+ D     V +  H  P+  + ++    +F +   
Sbjct: 528 VYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASH 587

Query: 300 DNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDN 359
           D    LW                                                S D  
Sbjct: 588 DQTARLW------------------------------------------------SCDHI 599

Query: 360 KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLS 419
            P+    GH   + C+ F+ N   + T S SD + R+W     +    F GH+  +IS++
Sbjct: 600 YPLRIFAGHLNDVDCVSFHPNGCYVFTGS-SDKTCRMWDVSTGDSVRLFLGHTAPVISIA 658

Query: 420 WINDDLVIS-ASMDGSVRIWSV-VENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQI 477
              D   +S  S DG + +W +     L  M     NAI     S + N    G  +  +
Sbjct: 659 VCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTV 718

Query: 478 NVYDIKR 484
            V+D+K+
Sbjct: 719 RVWDLKK 725

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/277 (23%), Positives = 125/277 (45%), Gaps = 26/277 (9%)

Query: 171 AKTLNEVQTL---DNKVVTSSWNLQNERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHP 227
           + TL   QTL   D KV   +W   N+ +L  G ED +  +   N+ D + I+S      
Sbjct: 241 SNTLEVTQTLQNHDGKVGGIAWT-SNDSVLITGGEDHLITV--SNRSDGEFITS------ 291

Query: 228 FALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFN-FHRSPIVSIK 286
              +SI G +  +IT L   P G+ I TS  +   RLW+ + + Q +    H   +  + 
Sbjct: 292 ---NSIGGHE-GRITDLQVHPSGKFIGTSSFDSTWRLWDIEKQKQLLLQEGHSKELYCLA 347

Query: 287 WNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEW-VDKDKLVVP 345
           +  D     +   D   I+W+  +G      +   +L+ + +++   ++W +D   L   
Sbjct: 348 FQADGALVSTAGTDKTAIIWDLRSG------KAVSQLQGHAKTIYC-MDWSIDGHTLATG 400

Query: 346 GVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCC 405
           G +G I ++ +  +  + K+  H+  ++ ++F+  +   L SS  D SI ++        
Sbjct: 401 GGDGVITIWDLRKSDKLTKITEHKSIVTSLKFDKANDHNLISSGYDRSIFVYSKDNYLKV 460

Query: 406 NCFYGHSQSIISLSW-INDDLVISASMDGSVRIWSVV 441
           +   GH+  +++     N+  +IS   D SV+ WS V
Sbjct: 461 SSLIGHADKVLTFDIDKNNKNLISGGWDRSVKHWSTV 497

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 86/187 (45%), Gaps = 13/187 (6%)

Query: 306 WNAINGIILQH-FEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGK 364
           WN    II  +  E  Q L+N+   +G  I W   D +++ G    ++  S   N+  G+
Sbjct: 232 WNGEVSIIDSNTLEVTQTLQNHDGKVG-GIAWTSNDSVLITGGEDHLITVS---NRSDGE 287

Query: 365 LL------GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISL 418
            +      GH+G I+ ++ + + + + TSS  D + R+W  +K+       GHS+ +  L
Sbjct: 288 FITSNSIGGHEGRITDLQVHPSGKFIGTSS-FDSTWRLWDIEKQKQLLLQEGHSKELYCL 346

Query: 419 SWINDD-LVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQI 477
           ++  D  LV +A  D +  IW +     V         I C   S D +  A G  +G I
Sbjct: 347 AFQADGALVSTAGTDKTAIIWDLRSGKAVSQLQGHAKTIYCMDWSIDGHTLATGGGDGVI 406

Query: 478 NVYDIKR 484
            ++D+++
Sbjct: 407 TIWDLRK 413

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/300 (21%), Positives = 133/300 (44%), Gaps = 33/300 (11%)

Query: 241 ITALSWSPDGELIITSVENGELRLWNKDG-RLQNVFNFHRSPIVSIKWNEDSKHFISLDL 299
           I A+ W+P+G  ++ +  +GE  LWN      + +   H S + ++K++ DS   IS D 
Sbjct: 96  IPAIQWTPEGRRLVVATYSGEFSLWNASSFTFETLMQAHDSAVTTMKYSHDSDWMISGDA 155

Query: 300 DNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSIL-VYSIDD 358
           D +  +W   N  +++  +       +TES+  D+ +   D   V   + +IL +++  +
Sbjct: 156 DGMIKIWQP-NFSMVKEID-----AAHTESIR-DMAFSSNDSKFVTCSDDNILKIWNFSN 208

Query: 359 NKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISL 418
            K    L GH   +   +++    L+ ++S  D  +++W  +  NC +       +++  
Sbjct: 209 GKQERVLSGHHWDVKSCDWHPEMGLIASAS-KDNLVKLWDPRSGNCISSILKFKHTVLKT 267

Query: 419 SW--INDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISH-DKNKFAIGSMNG 475
            +     +L+++ S D S R++ +  +    M + D    +  +    +++ F +   +G
Sbjct: 268 RFQPTKGNLLMAISKDKSCRVFDIRYSMKELMCVRDETDYMTLEWHPINESMFTLACYDG 327

Query: 476 QINVYDIKRFVSRLLKRDKKQELVVPI-TIPLYGSYQNEKIDDCIFDISWNKSNDLITVA 534
            +  +D+             Q L  PI TIP    Y ++K   CI  +S+N    +   A
Sbjct: 328 SLKHFDL------------LQNLNEPILTIP----YAHDK---CITSLSYNPVGHIFATA 368

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 96/206 (46%), Gaps = 18/206 (8%)

Query: 248 PDGELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITIL 305
           P G L++    NGEL+L++      L N    H + I S+    D +  ++   D     
Sbjct: 437 PGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRF 496

Query: 306 WN-AINGI-----------ILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILV 353
           W   ++ +           +LQ F  +  LE + + L V I   DK  + V  ++ ++ V
Sbjct: 497 WTFEVSEVPVSDESNKTMPMLQLFH-DTTLELDDDILSVVISPDDK-FIAVSLLDNTVKV 554

Query: 354 YSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQ 413
           + +D  K    L GH+  +  ++ + +S+L++T S +D +I+IW     +C    + H  
Sbjct: 555 FFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCS-ADKNIKIWGLDFGDCHKSLFAHQD 613

Query: 414 SIISLSWINDDL-VISASMDGSVRIW 438
           SI+++ ++ +     S S D +V+ W
Sbjct: 614 SIMNVKFLPESYNFFSCSKDATVKYW 639

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 55/284 (19%), Positives = 107/284 (37%), Gaps = 65/284 (22%)

Query: 227 PFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNV-FNFHRSPIVSI 285
           P   S     K  + T L + P+  L+     +G +++W+   +   + FN H+S I  +
Sbjct: 68  PPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVL 127

Query: 286 KWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVP 345
            ++      IS   D+  I+W+ +                                    
Sbjct: 128 AFDTTGTRLISASKDSDIIVWDLV------------------------------------ 151

Query: 346 GVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCC 405
           G +G            + KL  H+  I+ +     + L+ TS D    ++IW  + + C 
Sbjct: 152 GESG------------LYKLRSHKDAITGLWCEDENWLISTSKDG--LVKIWDLKSQQCV 197

Query: 406 NCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAI--------- 456
                H+    SL  I +D+ ++ S D  V++W +      G  + +   I         
Sbjct: 198 ETHLAHTGECWSLGII-EDMAVTCSADSQVKLWKLDLQAENGSKLTEKGIIEKQSKQRGV 256

Query: 457 -ICGKISHDKNK-FAIGSMNGQINVYDIKR--FVSRLLKRDKKQ 496
            I   ++ D  K F I + +  I +Y +++   +SR LK+ +K+
Sbjct: 257 EIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR 300

 Score = 32.7 bits (73), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 40/76 (52%), Gaps = 4/76 (5%)

Query: 408 FYGHSQSIISLSWINDDLVISASMDGSVRIWSV-VENCLVGMAMVDGNAIICGKISHDKN 466
            +G    I S S  +D+ +++ + +GS++IW++  + C+       G A+ C K      
Sbjct: 384 LHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTKRCIRSFEC--GYALTC-KFLPGGA 440

Query: 467 KFAIGSMNGQINVYDI 482
              +G+ NG++ ++DI
Sbjct: 441 LVVVGTRNGELQLFDI 456

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 8/93 (8%)

Query: 232 SITGRKTNQITALSWSPDGELIITSVENGELRLWNKD-GRLQNVFNFHRSPIVSIKWNED 290
           S+ G K   + ++  S D +LI+T   +  +++W  D G        H+  I+++K+  +
Sbjct: 565 SLYGHKL-PVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 623

Query: 291 SKHFISLDLDNITILWNAINGIILQHFEPEQKL 323
           S +F S   D     W+       Q FE  QKL
Sbjct: 624 SYNFFSCSKDATVKYWDG------QKFECIQKL 650

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/227 (21%), Positives = 92/227 (40%), Gaps = 32/227 (14%)

Query: 274 VFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVD 333
           +   H + I   +W+ DSK  +S   D   I+W+++ G+                ++ +D
Sbjct: 80  ILKGHTNKIADFRWSRDSKLILSASQDGFMIVWDSLTGL-------------KRSAIPLD 126

Query: 334 IEWVDKDKL-------VVPGVNGSILVYSIDDNKPIGK-----LLGHQGTISCIEFNVNS 381
            +WV    L          G+N +  +Y +     + +       GH G IS +EF   S
Sbjct: 127 SQWVLTCALSPSGALAASAGLNNNCTIYRMPRGSAVQQNVTSIFKGHTGYISGVEFVSES 186

Query: 382 RLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLS-----WINDDLVISASMDGSVR 436
           R++  +S  D +  +W   K      +  H   ++++S        +++  S   DG   
Sbjct: 187 RVV--TSSGDMTCALWDIPKAKRVREYSDHLGDVLAISIPVTNLSKNNMFASCGSDGYTF 244

Query: 437 IWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIK 483
           IW V     V    +      C K   D N  A+G+ +G I+++D++
Sbjct: 245 IWDVRSPSAVQQFSIGSCDSNCLKFFPDGNSVAVGNDDGTISLFDLR 291

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 31/76 (40%), Gaps = 1/76 (1%)

Query: 410 GHSQSIISLSWINDD-LVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKF 468
           GH+  I    W  D  L++SAS DG + +W  +         +D   ++   +S      
Sbjct: 83  GHTNKIADFRWSRDSKLILSASQDGFMIVWDSLTGLKRSAIPLDSQWVLTCALSPSGALA 142

Query: 469 AIGSMNGQINVYDIKR 484
           A   +N    +Y + R
Sbjct: 143 ASAGLNNNCTIYRMPR 158

>Scas_679.28
          Length = 815

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 74/163 (45%), Gaps = 10/163 (6%)

Query: 278 HRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWV 337
           H   I ++  + +   F +   D    +W+  NG      E    L N+   L  D+ + 
Sbjct: 490 HEKDINALAISPNDSIFATASYDKTCKIWDLENG------ELTATLSNHKRGLW-DVAFC 542

Query: 338 DKDKLVVP-GVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRI 396
             DKL+     + +I ++S+D    +  L GH   +    F +N +L L SS +D  I+I
Sbjct: 543 QYDKLIATCSGDKTIKIWSLDTFSVMKTLEGHTNAVQRCMF-INKQLQLVSSGADGLIKI 601

Query: 397 WHGQKENCCNCFYGHSQSIISLSWIND-DLVISASMDGSVRIW 438
           W     +C     GH   I +L+ IND D+++SA  DG  + W
Sbjct: 602 WDCSTGDCLKTLDGHDNRIWALTEINDGDMIVSADADGVFQFW 644

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 84/176 (47%), Gaps = 12/176 (6%)

Query: 342 LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEF--NVNSRL-LLTSSDSDYSIRIWH 398
           + + G +GSI V  I++      L GH  TIS ++F    NS + LL S D++  +++W 
Sbjct: 121 VALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVWD 180

Query: 399 GQKENCCNCFYGHSQSI--ISLSWINDDL-VISASMDGSVRIW--SVVENC-LVGMAMVD 452
             K  C +    HS ++  + +  + D+  +IS   D    +W  ++ + C L+    V 
Sbjct: 181 LVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLWNFNLKKKCTLLKTIPVH 240

Query: 453 GNAIICGKISHDKNKFAIGSMNGQINVYDIKRFVSRLLKRDKK--QELVVPITIPL 506
                CG I+H+ +   I +  G   +  I    + ++K+ KK  +EL +   +P+
Sbjct: 241 QQVESCGFINHEHDDL-IYTAGGDALLQFISLEKATMIKKTKKHIEELFIIGVLPI 295

>Scas_630.6
          Length = 621

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 98/215 (45%), Gaps = 27/215 (12%)

Query: 241 ITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDL 299
           I ++ +SPDGE + T  E+  +R+WN K+ ++  V   H   I S+ +  D +  +S   
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSG 403

Query: 300 DNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPG----------VNG 349
           D    +W+   G           +E+   ++ V     ++ KL+  G           + 
Sbjct: 404 DRSIRIWDLKTGQCSLTLS----IEDGVTTVAVS---PNEGKLIAAGSLDRSVRIWDSST 456

Query: 350 SILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH-GQKEN----C 404
             LV  +D +   G   GHQ ++  + F  + + +++ S  D ++++W+ G  ++    C
Sbjct: 457 GFLVERLDSDNESGN--GHQDSVYSVAFTKDGQHVVSGS-LDRTVKLWNLGDTQSGTGKC 513

Query: 405 CNCFYGHSQSIISLSWINDD-LVISASMDGSVRIW 438
              + GH   ++S++  NDD  + S S D  V IW
Sbjct: 514 EVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIW 548

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 97/210 (46%), Gaps = 21/210 (10%)

Query: 238 TNQITALSWSPDGELIITSVENGELRLW--NKDGRLQNVFNFHRSPIVSIKWNEDSKHFI 295
           TN ++ + W   G L+ +   +  +R+W  N  GR  N+   H   +  +  + D    I
Sbjct: 278 TNSVSCVKWGGQG-LLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRI 336

Query: 296 SLDLDNI---TILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSIL 352
               D+               L+++E   K   N+E +           +V    + ++ 
Sbjct: 337 GA-FDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEM-----------MVTASDDYTMF 384

Query: 353 VY-SIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGH 411
           ++  +   KPI ++ GHQ  ++ + F+ + R ++++S  D SI++W G+     + F GH
Sbjct: 385 LWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSAS-FDNSIKLWDGRDGKFISTFRGH 443

Query: 412 SQSIISLSWIND-DLVISASMDGSVRIWSV 440
             S+  ++W +D  L++S S D ++++W V
Sbjct: 444 VASVYQVAWSSDCRLLVSCSKDTTLKVWDV 473

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 69/151 (45%), Gaps = 11/151 (7%)

Query: 341 KLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQ 400
           ++V    + +  ++  D   P+  L GH   + C+ ++ +  ++ T S  D +IR+W  +
Sbjct: 158 RMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGS-MDNTIRLWDPK 216

Query: 401 KENCC-NCFYGHSQSIISLSWINDDLV--------ISASMDGSVRIWSVVENCLVGMAMV 451
              C  +   GHS+ I SLSW    LV         S+S DG+++IW  V          
Sbjct: 217 SGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSG 276

Query: 452 DGNAIICGKISHDKNKFAIGSMNGQINVYDI 482
             N++ C K       ++ GS +  + V+DI
Sbjct: 277 HTNSVSCVKWGGQGLLYS-GSHDRTVRVWDI 306

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 77/171 (45%), Gaps = 25/171 (14%)

Query: 342 LVVPGVNGS----ILVYS---IDDNKPIGK----LLGHQGTISCIEFNVNSRLLLTSSDS 390
           L+ PG N +     L+Y+   +   KP+ +    + GH  TI C  F  ++   + +   
Sbjct: 105 LIKPGYNSTEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAG 164

Query: 391 DYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVI-SASMDGSVRIWSVVENCLVGMA 449
           D + RIW    +   +   GH   ++ +SW  D  VI + SMD ++R+W       +G A
Sbjct: 165 DNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDA 224

Query: 450 MVDGNAIICGKISHD---------KNKFAIGSMNGQINVYDIKRFVSRLLK 491
           +  G++     +S +         K + A  S +G I ++D    VSR+ +
Sbjct: 225 L-RGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDT---VSRVCQ 271

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 79/202 (39%), Gaps = 55/202 (27%)

Query: 239 NQITALSWSPDGELIITSVENGELRLWN-KDGR-LQNVFNFHRSPIVSIKWNEDSKHFIS 296
           N +  +SWSPDGE+I T   +  +RLW+ K G+ L +    H   I S+ W         
Sbjct: 187 NWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSW--------- 237

Query: 297 LDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSI 356
                                EP   ++  +           K +L     +G+I ++  
Sbjct: 238 ---------------------EPIHLVKPGS-----------KPRLASSSKDGTIKIWDT 265

Query: 357 DDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH-GQKENCCNCFYGHSQSI 415
                   + GH  ++SC+++    + LL S   D ++R+W    +  C N    H+   
Sbjct: 266 VSRVCQYTMSGHTNSVSCVKW--GGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAH-- 321

Query: 416 ISLSWINDDLVISASMDGSVRI 437
               W+N    +S S D ++RI
Sbjct: 322 ----WVNH---LSLSTDYALRI 336

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/189 (20%), Positives = 72/189 (38%), Gaps = 42/189 (22%)

Query: 253 IITSVENGELRLWNKDGRLQ-NVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAING 311
           ++T   +   R+W+ D +   +    H + ++ + W+ D +   +  +DN   LW+  +G
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSG 218

Query: 312 IILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGT 371
             L        L  +++ +   + W +   LV PG                         
Sbjct: 219 QCLG-----DALRGHSKWI-TSLSW-EPIHLVKPG------------------------- 246

Query: 372 ISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISASM 431
                    S+  L SS  D +I+IW      C     GH+ S+  + W    L+ S S 
Sbjct: 247 ---------SKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSH 297

Query: 432 DGSVRIWSV 440
           D +VR+W +
Sbjct: 298 DRTVRVWDI 306

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 46/91 (50%), Gaps = 4/91 (4%)

Query: 221 SLELRHPFALSSITGRKTNQ---ITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFN 276
           ++ L +P   +    R T     +  +++SPDG  I+++  +  ++LW+ +DG+  + F 
Sbjct: 382 TMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFR 441

Query: 277 FHRSPIVSIKWNEDSKHFISLDLDNITILWN 307
            H + +  + W+ D +  +S   D    +W+
Sbjct: 442 GHVASVYQVAWSSDCRLLVSCSKDTTLKVWD 472

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 61/142 (42%), Gaps = 9/142 (6%)

Query: 300 DNITILWNAINGI-ILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDD 358
           D    LWN +     +      QKL N+  +   D  ++     V    + SI ++   D
Sbjct: 380 DYTMFLWNPLKSTKPIARMTGHQKLVNHV-AFSPDGRYI-----VSASFDNSIKLWDGRD 433

Query: 359 NKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISL 418
            K I    GH  ++  + ++ + RLL++ S  D ++++W  +         GH   + ++
Sbjct: 434 GKFISTFRGHVASVYQVAWSSDCRLLVSCS-KDTTLKVWDVRTRKLSVDLPGHKDEVYTV 492

Query: 419 SW-INDDLVISASMDGSVRIWS 439
            W ++   V S   D  VR+W+
Sbjct: 493 DWSVDGKRVCSGGKDKMVRLWT 514

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 30/150 (20%), Positives = 68/150 (45%), Gaps = 11/150 (7%)

Query: 251 ELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNA 308
           E+++T+ ++  + LWN  K  +       H+  +  + ++ D ++ +S   DN   LW+ 
Sbjct: 372 EMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 309 INGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSIL-VYSIDDNKPIGKLLG 367
            +G  +  F        +  S+   + W    +L+V     + L V+ +   K    L G
Sbjct: 432 RDGKFISTF------RGHVASV-YQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPG 484

Query: 368 HQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           H+  +  ++++V+ + +  S   D  +R+W
Sbjct: 485 HKDEVYTVDWSVDGKRVC-SGGKDKMVRLW 513

>Scas_585.8
          Length = 460

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 57/300 (19%), Positives = 131/300 (43%), Gaps = 34/300 (11%)

Query: 241 ITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLD 300
           I A++W+P+G  ++ +  NGE  LWN     +++   H S +  I+++       S D D
Sbjct: 93  IPAITWTPEGRRLVVATYNGEFSLWNGTSFNESLMQAHDSAVSCIQYSHAGDWMCSGDAD 152

Query: 301 NITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSIL-VYSIDDN 359
               +W         +F   ++ EN       DI + + D   V   + ++L +++  + 
Sbjct: 153 GGIKIWQP-------NFNMVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNG 205

Query: 360 KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLS 419
           +    L GH   I   +++    L++++S  D  +++W  +   C +       +++   
Sbjct: 206 QVERTLSGHHWDIKSCDWHPEMGLIVSAS-KDNLVKLWDPRSGQCISTIIKFKHTVLKTR 264

Query: 420 W--INDDLVISASMDGSVRIWSVVENCLVGMAM---VDGNAIICGKISHDKNKFAIGSMN 474
           +     +L+ + S D S R++ +  +    M +   VD   +    I  +++ F +G+ +
Sbjct: 265 FQPTRGNLLAAISKDKSCRVFDIRHSMKELMCVRDEVDYMTLTWNPI--NESMFTVGNYD 322

Query: 475 GQINVYDIKRFVSRLLKRDKKQELVVPITIPLYGSYQNEKIDDCIFDISWNKSNDLITVA 534
           G +  +D       LL+  +    V+P        Y ++K   C+  +++N + +++  A
Sbjct: 323 GAMKYFD-------LLQDLEGPSHVIP--------YAHDK---CVTSMAYNPAGNILASA 364

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 99/212 (46%), Gaps = 19/212 (8%)

Query: 235 GRKTNQITALSWSPDGELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSK 292
           G  TN ++ + W  +G ++ +   +  +R W+  ++G+  N+   H   +  +  + D  
Sbjct: 277 GGHTNSVSCVKWGGEG-ILYSGSHDKTVRAWDMKQNGKCINILKSHAHWVNHLSLSTDYA 335

Query: 293 HFI-SLDLDNITILWNA--INGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNG 349
             + + D   +    NA       LQ++E   +     E L V       D   +     
Sbjct: 336 LRVGAFDYTGVKPA-NAKEARDKALQNYEKVARKNGKHEELMVTAS----DDFTM----- 385

Query: 350 SILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFY 409
             L   +   KPI ++ GHQ  ++ + F+ + + ++++S  D SI++W G++    + F 
Sbjct: 386 -FLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSAS-FDNSIKLWDGKEGTFLSTFR 443

Query: 410 GHSQSIISLSWIND-DLVISASMDGSVRIWSV 440
           GH  S+  ++W +D  L++S S D ++++W V
Sbjct: 444 GHVASVYQVAWSSDCRLLVSCSKDTTLKVWDV 475

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 76/199 (38%), Gaps = 56/199 (28%)

Query: 253 IITSVENGELRLWNKDGRLQNV-FNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAING 311
           ++T   +   R+W+ D +   V  N HR+ ++ + W+ D +   +  +DN   LW+A +G
Sbjct: 161 VVTGGGDNTARIWDCDTQTPKVTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAESG 220

Query: 312 IILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLL-GHQG 370
                                                           KP+G  L GH  
Sbjct: 221 ------------------------------------------------KPLGDALRGHSK 232

Query: 371 TISCIEF------NVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDD 424
            I+ + +         S+  L S+  D +IRIW   +  C     GH+ S+  + W  + 
Sbjct: 233 WITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDSSRRVCLMTLGGHTNSVSCVKWGGEG 292

Query: 425 LVISASMDGSVRIWSVVEN 443
           ++ S S D +VR W + +N
Sbjct: 293 ILYSGSHDKTVRAWDMKQN 311

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 68/165 (41%), Gaps = 20/165 (12%)

Query: 342 LVVPGVNGSILVYSIDDN-------KPIGK----LLGHQGTISCIEFNVNSRLLLTSSDS 390
           L+ PG N +  + ++D         KPI +    + GH  TI C  F  ++   + +   
Sbjct: 107 LLKPGHNSTEDIITLDFQPRAVFKVKPITRSSSAIAGHGATILCSAFAPHTSSRVVTGGG 166

Query: 391 DYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVIS-ASMDGSVRIWSVVENCLVGMA 449
           D + RIW    +       GH   ++ +SW  D  VI+  SMD ++R+W       +G A
Sbjct: 167 DNTARIWDCDTQTPKVTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAESGKPLGDA 226

Query: 450 MVDGNAIICGKI--------SHDKNKFAIGSMNGQINVYDIKRFV 486
           +   +  I               K + A  S +G I ++D  R V
Sbjct: 227 LRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDSSRRV 271

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/293 (19%), Positives = 108/293 (36%), Gaps = 79/293 (26%)

Query: 158 HNDTEDSAESSFFAKTLNEVQTLDNK----------VVTSSWNLQNERLLAYGQEDSMAK 207
           HN TED     F  + + +V+ +             ++ S++       +  G  D+ A+
Sbjct: 112 HNSTEDIITLDFQPRAVFKVKPITRSSSAIAGHGATILCSAFAPHTSSRVVTGGGDNTAR 171

Query: 208 MIEYNKEDKKIISSLELRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNK 267
           + + + +  K+             ++ G + N +  +SWS DGE+I T   +  +RLW+ 
Sbjct: 172 IWDCDTQTPKV-------------TLNGHR-NWVLCVSWSADGEVIATGSMDNTIRLWDA 217

Query: 268 DG--RLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLEN 325
           +    L +    H   I S+ W                              EP   +E 
Sbjct: 218 ESGKPLGDALRGHSKWITSLTW------------------------------EPIHLVEP 247

Query: 326 NTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLL 385
            +           K +L     +G+I ++       +  L GH  ++SC+++      +L
Sbjct: 248 GS-----------KPRLASASKDGTIRIWDSSRRVCLMTLGGHTNSVSCVKWGGEG--IL 294

Query: 386 TSSDSDYSIRIWH-GQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRI 437
            S   D ++R W   Q   C N    H+       W+N    +S S D ++R+
Sbjct: 295 YSGSHDKTVRAWDMKQNGKCINILKSHAH------WVNH---LSLSTDYALRV 338

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 68/150 (45%), Gaps = 11/150 (7%)

Query: 251 ELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNA 308
           EL++T+ ++  + LWN  K  +  +    H+  +  + ++ D K+ +S   DN   LW+ 
Sbjct: 374 ELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDG 433

Query: 309 INGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSIL-VYSIDDNKPIGKLLG 367
             G  L  F        +  S+   + W    +L+V     + L V+ +   K    L G
Sbjct: 434 KEGTFLSTF------RGHVASV-YQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPG 486

Query: 368 HQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           HQ  +  ++++V+ + +  S   D  +R+W
Sbjct: 487 HQDEVYTVDWSVDGKRVC-SGGKDKMMRLW 515

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 44/79 (55%), Gaps = 2/79 (2%)

Query: 230 LSSITGRKTNQITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWN 288
           +S +TG +   +  +++SPDG+ I+++  +  ++LW+ K+G   + F  H + +  + W+
Sbjct: 397 ISRMTGHQ-KLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFLSTFRGHVASVYQVAWS 455

Query: 289 EDSKHFISLDLDNITILWN 307
            D +  +S   D    +W+
Sbjct: 456 SDCRLLVSCSKDTTLKVWD 474

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 53/86 (61%), Gaps = 2/86 (2%)

Query: 356 IDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSI 415
           +   KPI ++ GHQ  ++ + F+ + R ++++S  D SI++W+G+     + F GH  S+
Sbjct: 389 LKSTKPITRMTGHQKLVNHVAFSPDGRHIVSAS-FDNSIKLWNGRDGKFISTFRGHVASV 447

Query: 416 ISLSWIND-DLVISASMDGSVRIWSV 440
             ++W +D  L++S S D ++++W V
Sbjct: 448 YQVAWSSDCRLLVSCSKDTTLKVWDV 473

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 58/119 (48%), Gaps = 11/119 (9%)

Query: 341 KLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQ 400
           +++    + +  ++  +   P+  L GH   + C+ ++ +  L+ T S  D +IR+W G 
Sbjct: 158 RMITGAGDNTARIWDCNTQTPMSTLKGHFNWVLCVSWSPDGELIATGS-MDNTIRLWEGN 216

Query: 401 K-ENCCNCFYGHSQSIISLSWINDDLV--------ISASMDGSVRIWSVVEN-CLVGMA 449
           K +   +   GH + I SLSW    LV         SAS DG+++IW      CL+ ++
Sbjct: 217 KGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLASASKDGTIKIWDTTRRVCLITLS 275

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 64/141 (45%), Gaps = 15/141 (10%)

Query: 360 KPIGK----LLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSI 415
           KP+ +    + GH  TI C  F  ++   + +   D + RIW    +   +   GH   +
Sbjct: 130 KPVTRSSSAIAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTPMSTLKGHFNWV 189

Query: 416 ISLSWIND-DLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHD---------K 465
           + +SW  D +L+ + SMD ++R+W   +   VG A+  G+      +S +         K
Sbjct: 190 LCVSWSPDGELIATGSMDNTIRLWEGNKGQPVGDAL-RGHGKWITSLSWEPIHLVKPGQK 248

Query: 466 NKFAIGSMNGQINVYDIKRFV 486
            + A  S +G I ++D  R V
Sbjct: 249 PRLASASKDGTIKIWDTTRRV 269

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 79/204 (38%), Gaps = 59/204 (28%)

Query: 239 NQITALSWSPDGELIITSVENGELRLW--NKDGRLQNVFNFHRSPIVSIKWNEDSKHFIS 296
           N +  +SWSPDGELI T   +  +RLW  NK   + +    H   I S+ W  +  H + 
Sbjct: 187 NWVLCVSWSPDGELIATGSMDNTIRLWEGNKGQPVGDALRGHGKWITSLSW--EPIHLV- 243

Query: 297 LDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSI 356
                                +P Q                 K +L     +G+I ++  
Sbjct: 244 ---------------------KPGQ-----------------KPRLASASKDGTIKIWDT 265

Query: 357 DDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH---GQKENCCNCFYGHSQ 413
                +  L GH  ++SCI++    + +L S   D +IR W    G K  C N    H+ 
Sbjct: 266 TRRVCLITLSGHTSSVSCIKW--GGQGVLYSGSHDKTIRAWDMNLGGK--CINILKSHAH 321

Query: 414 SIISLSWINDDLVISASMDGSVRI 437
                 W+N    +S S D ++RI
Sbjct: 322 ------WVNH---LSLSTDYALRI 336

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 53/115 (46%), Gaps = 8/115 (6%)

Query: 334 IEWVDKDKLVVPG-VNGSILVYSIDDNKPIGKLL-GHQGTISCIEF------NVNSRLLL 385
           + W    +L+  G ++ +I ++  +  +P+G  L GH   I+ + +          +  L
Sbjct: 192 VSWSPDGELIATGSMDNTIRLWEGNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRL 251

Query: 386 TSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV 440
            S+  D +I+IW   +  C     GH+ S+  + W    ++ S S D ++R W +
Sbjct: 252 ASASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKWGGQGVLYSGSHDKTIRAWDM 306

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 68/150 (45%), Gaps = 11/150 (7%)

Query: 251 ELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNA 308
           EL++T+ ++  + LWN  K  +       H+  +  + ++ D +H +S   DN   LWN 
Sbjct: 372 ELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNG 431

Query: 309 INGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSIL-VYSIDDNKPIGKLLG 367
            +G  +  F        +  S+   + W    +L+V     + L V+ +   K    L G
Sbjct: 432 RDGKFISTF------RGHVASV-YQVAWSSDCRLLVSCSKDTTLKVWDVKTKKLAVDLPG 484

Query: 368 HQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           H+  +  ++++V+ + +  S   D  +R+W
Sbjct: 485 HKDEVYTVDWSVDGKRVC-SGGKDKMVRLW 513

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 224 LRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPI 282
           L+    ++ +TG +   +  +++SPDG  I+++  +  ++LWN +DG+  + F  H + +
Sbjct: 389 LKSTKPITRMTGHQ-KLVNHVAFSPDGRHIVSASFDNSIKLWNGRDGKFISTFRGHVASV 447

Query: 283 VSIKWNEDSKHFISLDLDNITILWN 307
             + W+ D +  +S   D    +W+
Sbjct: 448 YQVAWSSDCRLLVSCSKDTTLKVWD 472

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 64/143 (44%), Gaps = 10/143 (6%)

Query: 300 DNITI-LWNAINGI-ILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSID 357
           D+ T+ LWN +     +      QKL N+           D   +V    + SI +++  
Sbjct: 379 DDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFS------PDGRHIVSASFDNSIKLWNGR 432

Query: 358 DNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIIS 417
           D K I    GH  ++  + ++ + RLL++ S  D ++++W  + +       GH   + +
Sbjct: 433 DGKFISTFRGHVASVYQVAWSSDCRLLVSCS-KDTTLKVWDVKTKKLAVDLPGHKDEVYT 491

Query: 418 LSW-INDDLVISASMDGSVRIWS 439
           + W ++   V S   D  VR+W+
Sbjct: 492 VDWSVDGKRVCSGGKDKMVRLWT 514

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 61/294 (20%), Positives = 111/294 (37%), Gaps = 57/294 (19%)

Query: 196 LLAYGQEDSMAKM--IEYNKEDKKIISSLELRHPFALSSITGRKTNQITALSWSPDGELI 253
           L A G +DS  K+  ++    D K+ S  + R     +++ G  +  + + S+SPD + +
Sbjct: 435 LAAAGFQDSYIKLWSLDGTPLDSKLPS--KQREKINNTTLIGH-SGTVYSTSFSPDNKYL 491

Query: 254 ITSVENGELRLWNKDGRLQNV-FNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGI 312
           +++ E+  +RLW+ D     V +  H  P+  + ++    +F +   D    LW      
Sbjct: 492 LSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLW------ 545

Query: 313 ILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTI 372
                                                     S D   P+    GH   +
Sbjct: 546 ------------------------------------------SCDHIYPLRIFAGHLNDV 563

Query: 373 SCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVIS-ASM 431
            C+ F+ N   + T S +D + R+W     +    F GH+  +IS +   D   +S  S 
Sbjct: 564 DCVSFHPNGTYVFTGS-TDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSE 622

Query: 432 DGSVRIWSV-VENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIKR 484
           DG + +W +     L  M     NA+     S +      G  +  + V+D+KR
Sbjct: 623 DGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLKR 676

 Score = 36.6 bits (83), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 25/114 (21%), Positives = 54/114 (47%), Gaps = 6/114 (5%)

Query: 238 TNQITALSWSPDGELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSKHFI 295
           T  + + + SPDG  + T  E+G + +W+     RL+ +    ++ + S+ ++++    +
Sbjct: 602 TAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLV 661

Query: 296 SLDLDNITILWNAINGIILQHFEPEQKLE----NNTESLGVDIEWVDKDKLVVP 345
           S   D+   +W+        + EPEQ       + T S+  DI+   + + +VP
Sbjct: 662 SGGADHSVRVWDLKRSTAEPNTEPEQPFTSYFGDATTSVNNDIKDYGRRRTIVP 715

>Scas_695.15
          Length = 327

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 109/227 (48%), Gaps = 25/227 (11%)

Query: 227 PFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNV-FNF-HRSPIVS 284
           P A+++  G K N +T++S+  D + ++TS E+G +++W  D R  +V  N+ H +P+  
Sbjct: 85  PNAVATFEGHKGN-VTSVSFQQDNKWMVTSSEDGTIKVW--DVRSPSVPRNYKHNAPVNE 141

Query: 285 IKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNT--ESLGVDIEWVDKDKL 342
           +  + +    IS D D    +W+           P+   ++NT  +SL V     D   L
Sbjct: 142 VVIHPNQGELISCDRDGTIKIWDLGENQCTHQLIPD---DDNTSLQSLSVA---SDGSML 195

Query: 343 VVPGVNGSILVYSIDDN------KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRI 396
           V     G   V+ + ++      KPI K   H+  I+ +  + + + + T S +D + +I
Sbjct: 196 VAANNKGDCYVWEMPNHTDASNLKPINKFSAHKDYITRVVLSSDVKHMATCS-ADRTAKI 254

Query: 397 WH-GQKENCCN---CFYGHSQSIISLSWINDD-LVISASMDGSVRIW 438
           W  G+ E+  N      GH + +   ++  D   +++AS D  VR+W
Sbjct: 255 WSVGETEDDFNLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 301

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/152 (20%), Positives = 68/152 (44%), Gaps = 10/152 (6%)

Query: 294 FISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILV 353
            +S   D+    W A+ G+  +  +      N        +E  +  KL+      ++ +
Sbjct: 25  LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNR-------LEITNDKKLLAAAGYQNVRL 77

Query: 354 YSIDDNKP--IGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGH 411
           Y I    P  +    GH+G ++ + F  +++ ++TSS+ D +I++W  +  +    +  +
Sbjct: 78  YDIRTTNPNAVATFEGHKGNVTSVSFQQDNKWMVTSSE-DGTIKVWDVRSPSVPRNYKHN 136

Query: 412 SQSIISLSWINDDLVISASMDGSVRIWSVVEN 443
           +     +   N   +IS   DG+++IW + EN
Sbjct: 137 APVNEVVIHPNQGELISCDRDGTIKIWDLGEN 168

 Score = 29.6 bits (65), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 21/103 (20%), Positives = 43/103 (41%), Gaps = 2/103 (1%)

Query: 383 LLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVVE 442
           ++L S+  D++IR W      C          +  L   ND  +++A+   +VR++ +  
Sbjct: 23  VILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGYQNVRLYDIRT 82

Query: 443 NCLVGMAMVDGNA--IICGKISHDKNKFAIGSMNGQINVYDIK 483
                +A  +G+   +       D       S +G I V+D++
Sbjct: 83  TNPNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVR 125

>Scas_692.29
          Length = 456

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 72/158 (45%), Gaps = 34/158 (21%)

Query: 241 ITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLD 300
           I+++  S D + IIT+  +G +R WN  G++Q  ++ H  PI ++K+  D++  +S   D
Sbjct: 106 ISSIDVSQDKKAIITASYDGVIRTWNLSGKVQKQYSGHSGPIRAVKFISDTR-LVSAGND 164

Query: 301 NITILWNAING-IILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDN 359
               LW   N   ++QHF+ E +  N                              I+D 
Sbjct: 165 RTLRLWKTKNNDSVVQHFDEEDEEAN------------------------------IEDG 194

Query: 360 KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           K +  L GH+  +  ++ +  SR+L  SS  D SI +W
Sbjct: 195 KTLAILEGHKAPVVSLDVSNTSRIL--SSSYDNSIGLW 230

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 372 ISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISASM 431
           IS I+ + + + ++T+S  D  IR W+   +     + GHS  I ++ +I+D  ++SA  
Sbjct: 106 ISSIDVSQDKKAIITAS-YDGVIRTWNLSGK-VQKQYSGHSGPIRAVKFISDTRLVSAGN 163

Query: 432 DGSVRIWSVVEN 443
           D ++R+W    N
Sbjct: 164 DRTLRLWKTKNN 175

>Kwal_23.6324
          Length = 514

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 51/83 (61%), Gaps = 2/83 (2%)

Query: 359 NKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISL 418
           +KPI ++ GHQ  ++ + F+ + R ++++S  D SI++W G+       F GH  S+  +
Sbjct: 391 SKPITRMTGHQKLVNHVAFSPDGRYIVSAS-FDNSIKLWDGRNGTFIATFRGHVASVYQV 449

Query: 419 SWIND-DLVISASMDGSVRIWSV 440
           +W +D  L++S S D ++++W V
Sbjct: 450 AWSSDCRLLVSCSKDTTLKVWDV 472

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 67/151 (44%), Gaps = 11/151 (7%)

Query: 341 KLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQ 400
           ++V    + +  ++  + N P+  L GH   + C+ +  +  L+ T S  D +IR+W   
Sbjct: 157 RMVTGSGDNTARIWDCNTNTPMYTLKGHFNWVLCVAWCPDGELIATGS-MDNTIRLWDSN 215

Query: 401 K-ENCCNCFYGHSQSIISLSWINDDLV--------ISASMDGSVRIWSVVENCLVGMAMV 451
           K E+      GH++ I SL+W    LV         SAS DG+++IW       V     
Sbjct: 216 KGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLSG 275

Query: 452 DGNAIICGKISHDKNKFAIGSMNGQINVYDI 482
             N++ C K    +     GS +  I  +D+
Sbjct: 276 HTNSVSCVKWG-GRGILYSGSHDKTIRAWDM 305

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 59/135 (43%), Gaps = 11/135 (8%)

Query: 365 LLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIND- 423
           + GH  TI C  F  ++   + +   D + RIW            GH   ++ ++W  D 
Sbjct: 138 IAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDCNTNTPMYTLKGHFNWVLCVAWCPDG 197

Query: 424 DLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKI---------SHDKNKFAIGSMN 474
           +L+ + SMD ++R+W   +    G A+  G+A     +         + D+ + A  S +
Sbjct: 198 ELIATGSMDNTIRLWDSNKGESYGEAL-RGHAKWITSLTWEPMHLVKAGDQPRLASASKD 256

Query: 475 GQINVYDIKRFVSRL 489
           G I ++D  R V  L
Sbjct: 257 GTIKIWDTTRRVCVL 271

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 89/218 (40%), Gaps = 41/218 (18%)

Query: 231 SSITGRKTNQI-TALSWSPDGELIITSVENGELRLWNKDGR-----LQNVFNFHRSPIVS 284
           S+I G  +  + +A +    G ++  S +N   R+W+ +       L+  FN+    ++ 
Sbjct: 136 SAIAGHGSTILCSAFAPHTSGRMVTGSGDN-TARIWDCNTNTPMYTLKGHFNW----VLC 190

Query: 285 IKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWV------- 337
           + W  D +   +  +DN   LW++  G            E+  E+L    +W+       
Sbjct: 191 VAWCPDGELIATGSMDNTIRLWDSNKG------------ESYGEALRGHAKWITSLTWEP 238

Query: 338 -------DKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDS 390
                  D+ +L     +G+I ++       +  L GH  ++SC+++    R +L S   
Sbjct: 239 MHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLSGHTNSVSCVKW--GGRGILYSGSH 296

Query: 391 DYSIRIWH-GQKENCCNCFYGHSQSIISLSWINDDLVI 427
           D +IR W       C N    H+  I  LS +N D  +
Sbjct: 297 DKTIRAWDMAAGGKCINILKSHAHWINHLS-LNTDYAL 333

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/192 (18%), Positives = 74/192 (38%), Gaps = 52/192 (27%)

Query: 251 ELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNA 308
           EL++T+ ++  + LW+  K  +       H+  +  + ++ D ++ +S   DN   LW+ 
Sbjct: 371 ELMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDG 430

Query: 309 INGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGH 368
            NG  +  F                                                 GH
Sbjct: 431 RNGTFIATFR------------------------------------------------GH 442

Query: 369 QGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW-INDDLVI 427
             ++  + ++ + RLL++ S  D ++++W  + +       GH+  + ++ W ++   V 
Sbjct: 443 VASVYQVAWSSDCRLLVSCS-KDTTLKVWDVRTKKLSVDLPGHNDEVYTVDWSVDGKRVC 501

Query: 428 SASMDGSVRIWS 439
           SA  D  VRIW+
Sbjct: 502 SAGKDKMVRIWT 513

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/151 (20%), Positives = 63/151 (41%), Gaps = 20/151 (13%)

Query: 158 HNDTEDSAESSFFAKTLNEVQTLDNKVVTSSWNLQNERLLAYGQEDSMAKMIEYNKEDKK 217
           H   + S+     AK L   + +  K      N Q E L+    +D    + +  K  K 
Sbjct: 340 HTGEKPSSPEEARAKALKNYEKIAKK------NGQLEELMVTASDDFTMYLWDPLKASKP 393

Query: 218 IISSLELRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFN 276
           I            + +TG +   +  +++SPDG  I+++  +  ++LW+ ++G     F 
Sbjct: 394 I------------TRMTGHQ-KLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFR 440

Query: 277 FHRSPIVSIKWNEDSKHFISLDLDNITILWN 307
            H + +  + W+ D +  +S   D    +W+
Sbjct: 441 GHVASVYQVAWSSDCRLLVSCSKDTTLKVWD 471

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/116 (21%), Positives = 52/116 (44%), Gaps = 8/116 (6%)

Query: 334 IEWVDKDKLVVPG-VNGSILVYSIDDNKPIGKLL-GHQGTISCIEF------NVNSRLLL 385
           + W    +L+  G ++ +I ++  +  +  G+ L GH   I+ + +          +  L
Sbjct: 191 VAWCPDGELIATGSMDNTIRLWDSNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRL 250

Query: 386 TSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVV 441
            S+  D +I+IW   +  C     GH+ S+  + W    ++ S S D ++R W + 
Sbjct: 251 ASASKDGTIKIWDTTRRVCVLTLSGHTNSVSCVKWGGRGILYSGSHDKTIRAWDMA 306

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 73/163 (44%), Gaps = 10/163 (6%)

Query: 278 HRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWV 337
           H   I ++  + +   F +   D    +WN  NG      E E  L N+   L  D+ + 
Sbjct: 490 HEKDINALSVSPNDSIFATASYDKTCKIWNLENG------ELEATLANHKRGLW-DVSFC 542

Query: 338 DKDKLVVPGV-NGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRI 396
             DKL+     + ++ ++S+D    +  L GH   +    F +N +  L S  +D  I+I
Sbjct: 543 QYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSF-INKQKQLISCGADGLIKI 601

Query: 397 WHGQKENCCNCFYGHSQSIISLSWIND-DLVISASMDGSVRIW 438
           W      C     GH+  + +LS +ND D+++SA  DG  + W
Sbjct: 602 WDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFW 644

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 342 LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEF--NVNSRL-LLTSSDSDYSIRIWH 398
           L V G +GSI+V  I++        GH GTIS ++F   +NS++ LL S D++  +++W 
Sbjct: 117 LAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWD 176

Query: 399 GQKENCCNCFYGHSQSIISLSWI----NDDL---VISASMDGSVRIW 438
             K  C +    H+ ++  L  I    ND+    ++S   D  + +W
Sbjct: 177 LVKRKCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGGRDDIINLW 223

 Score = 37.0 bits (84), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 72/159 (45%), Gaps = 10/159 (6%)

Query: 241 ITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDL 299
           I ALS SP+  +  T+  +   ++WN ++G L+     H+  +  + + +  K   +   
Sbjct: 494 INALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATSSG 553

Query: 300 DNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDK-LVVPGVNGSILVYSIDD 358
           D    +W+      L  F   + LE +T ++     +++K K L+  G +G I ++    
Sbjct: 554 DKTVKIWS------LDTFSVMKTLEGHTNAVQ-RCSFINKQKQLISCGADGLIKIWDCSS 606

Query: 359 NKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
            + +  L GH   +  +   +N   ++ S+D+D   + W
Sbjct: 607 GECLKTLDGHNNRLWALS-TMNDGDMIVSADADGVFQFW 644

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 109/248 (43%), Gaps = 48/248 (19%)

Query: 238 TNQITALSWSP-----DGE--LIITSVENGELRLWNKDGRLQ-NVFNFHRSPIVSIKWNE 289
           T  IT+LSW P      GE   + ++ ++G +++W+   R+     + H S +  IKW  
Sbjct: 227 TKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVCIYTLSGHTSSVSCIKWGG 286

Query: 290 DSKHFISLDLDNITILWNAING-----IILQHF------------------------EPE 320
            +  + S   D     W+   G     I+  H                         +P 
Sbjct: 287 RNVLY-SASHDRTVRCWDMAAGGKCINILKSHAHWVNHLSLSTDYALRMGPFDHTGTKPA 345

Query: 321 QKLENNTESLGVDIEWVDK-----DKLVVPGVNGSILVY--SIDDNKPIGKLLGHQGTIS 373
              +    +L  + E V K     ++L+V G +   +     +  +KPI ++ GHQ  ++
Sbjct: 346 SPEDAQARAL-RNYEKVAKKNGTMEELMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVN 404

Query: 374 CIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIND-DLVISASMD 432
            + F+ + R ++++S  D SI++W G+       F GH  S+  ++W +D  L++S S D
Sbjct: 405 HVAFSPDGRYIVSAS-FDNSIKLWDGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKD 463

Query: 433 GSVRIWSV 440
            ++++W V
Sbjct: 464 TTLKVWDV 471

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 22/166 (13%)

Query: 342 LVVPGVNGS----ILVY---SIDDNKPIGK----LLGHQGTISCIEFNVNSRLLLTSSDS 390
           L+ PG+ G+     LVY   ++   +P+ +    + GH  TI C  F  ++   + +   
Sbjct: 103 LLGPGLKGTEDFITLVYTPKAVFKVRPVTRSSSAIAGHGATILCSAFAPHTSSRMVTGAG 162

Query: 391 DYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVIS-ASMDGSVRIWSVVENCLVGMA 449
           D + RIW    +       GHS  ++ ++W  D  VI+  SMD ++R+W   +   +G A
Sbjct: 163 DNTARIWDCDTQTPLCTLKGHSNWVLCVAWSADGEVIATGSMDATIRLWDSEKGQSLGDA 222

Query: 450 MVDGNAIICGKIS---------HDKNKFAIGSMNGQINVYDIKRFV 486
           +  G+      +S          +K + A  S +G I ++D  R V
Sbjct: 223 L-RGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRV 267

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 56/115 (48%), Gaps = 10/115 (8%)

Query: 341 KLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQ 400
           ++V    + +  ++  D   P+  L GH   + C+ ++ +  ++ T S  D +IR+W  +
Sbjct: 156 RMVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWSADGEVIATGS-MDATIRLWDSE 214

Query: 401 K-ENCCNCFYGHSQSIISLSWINDDLV--------ISASMDGSVRIWSVVENCLV 446
           K ++  +   GH++ I SLSW    LV         SAS DG+++IW       +
Sbjct: 215 KGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVCI 269

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 77/203 (37%), Gaps = 55/203 (27%)

Query: 238 TNQITALSWSPDGELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSKHFI 295
           +N +  ++WS DGE+I T   +  +RLW+  K   L +    H   I S+ W        
Sbjct: 184 SNWVLCVAWSADGEVIATGSMDATIRLWDSEKGQSLGDALRGHTKWITSLSW-------- 235

Query: 296 SLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYS 355
                                 EP   ++             +K +L     +G+I ++ 
Sbjct: 236 ----------------------EPIHLVKPG-----------EKPRLASASKDGTIKIWD 262

Query: 356 IDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH-GQKENCCNCFYGHSQS 414
                 I  L GH  ++SCI++    R +L S+  D ++R W       C N    H+  
Sbjct: 263 TTRRVCIYTLSGHTSSVSCIKW--GGRNVLYSASHDRTVRCWDMAAGGKCINILKSHAH- 319

Query: 415 IISLSWINDDLVISASMDGSVRI 437
                W+N    +S S D ++R+
Sbjct: 320 -----WVNH---LSLSTDYALRM 334

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/151 (20%), Positives = 64/151 (42%), Gaps = 20/151 (13%)

Query: 158 HNDTEDSAESSFFAKTLNEVQTLDNKVVTSSWNLQNERLLAYGQEDSMAKMIEYNKEDKK 217
           H  T+ ++     A+ L   + +  K      N   E L+  G +D    +    K  K 
Sbjct: 339 HTGTKPASPEDAQARALRNYEKVAKK------NGTMEELMVTGSDDFTMYLWNPLKGSKP 392

Query: 218 IISSLELRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFN 276
           I+             +TG +   +  +++SPDG  I+++  +  ++LW+ +DG+    F 
Sbjct: 393 ILR------------MTGHQ-KLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFR 439

Query: 277 FHRSPIVSIKWNEDSKHFISLDLDNITILWN 307
            H + +  + W+ D +  +S   D    +W+
Sbjct: 440 GHVASVYQVAWSSDCRLLVSCSKDTTLKVWD 470

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 54/118 (45%), Gaps = 8/118 (6%)

Query: 334 IEWVDKDKLVVPG-VNGSILVYSIDDNKPIGKLL-GHQGTISCIEF------NVNSRLLL 385
           + W    +++  G ++ +I ++  +  + +G  L GH   I+ + +          +  L
Sbjct: 190 VAWSADGEVIATGSMDATIRLWDSEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRL 249

Query: 386 TSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVVEN 443
            S+  D +I+IW   +  C     GH+ S+  + W   +++ SAS D +VR W +   
Sbjct: 250 ASASKDGTIKIWDTTRRVCIYTLSGHTSSVSCIKWGGRNVLYSASHDRTVRCWDMAAG 307

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 66/144 (45%), Gaps = 12/144 (8%)

Query: 300 DNITI-LWNAING--IILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSI 356
           D+ T+ LWN + G   IL+     QKL N+           D   +V    + SI ++  
Sbjct: 377 DDFTMYLWNPLKGSKPILR-MTGHQKLVNHVAFS------PDGRYIVSASFDNSIKLWDG 429

Query: 357 DDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSII 416
            D K I    GH  ++  + ++ + RLL++ S  D ++++W  +         GH+  + 
Sbjct: 430 RDGKFIATFRGHVASVYQVAWSSDCRLLVSCS-KDTTLKVWDVKTRKLTVDLPGHNDEVY 488

Query: 417 SLSW-INDDLVISASMDGSVRIWS 439
           ++ W ++   V S   D  VR+W+
Sbjct: 489 TVDWSVDGKRVCSGGKDKMVRLWT 512

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 30/150 (20%), Positives = 66/150 (44%), Gaps = 11/150 (7%)

Query: 251 ELIITSVENGELRLWNKDGRLQNVFNF--HRSPIVSIKWNEDSKHFISLDLDNITILWNA 308
           EL++T  ++  + LWN     + +     H+  +  + ++ D ++ +S   DN   LW+ 
Sbjct: 370 ELMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDG 429

Query: 309 INGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSIL-VYSIDDNKPIGKLLG 367
            +G  +  F        +  S+   + W    +L+V     + L V+ +   K    L G
Sbjct: 430 RDGKFIATF------RGHVASV-YQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLTVDLPG 482

Query: 368 HQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           H   +  ++++V+ + +  S   D  +R+W
Sbjct: 483 HNDEVYTVDWSVDGKRVC-SGGKDKMVRLW 511

>Kwal_27.12053
          Length = 755

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/302 (21%), Positives = 107/302 (35%), Gaps = 71/302 (23%)

Query: 195 RLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQIT---------ALS 245
           RL A G +DS+ K+   + E  K            L S  G +TN  T         + S
Sbjct: 440 RLAAAGFQDSIIKIWSLDGEPLKN----------KLPSKQGERTNNETLVGHSGTVYSTS 489

Query: 246 WSPDGELIITSVENGELRLWNKDGRLQNV-FNFHRSPIVSIKWNEDSKHFISLDLDNITI 304
           +SPD   ++++ E+  +RLW+ D     V +  H  PI  + ++    +F +   D    
Sbjct: 490 FSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTAR 549

Query: 305 LWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGK 364
           LW                                                S D   P+  
Sbjct: 550 LW------------------------------------------------SCDHIYPLRI 561

Query: 365 LLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDD 424
             GH   +  + F+ N   + T S SD + R+W     +    F GH+  + S +   D 
Sbjct: 562 FAGHLNDVDTVSFHPNGTYVFTGS-SDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDG 620

Query: 425 LVIS-ASMDGSVRIWSV-VENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDI 482
             +S  S DG + +W +     L  M     NA+     S + +    G  +  + V+D+
Sbjct: 621 RWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDV 680

Query: 483 KR 484
           K+
Sbjct: 681 KK 682

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 86/215 (40%), Gaps = 58/215 (26%)

Query: 325 NNTESLGVDIEWVDKDKLVVPGVNGSIL-VYSID----DNKPIGK---------LLGHQG 370
           +NT S    +E+ D  +L   G   SI+ ++S+D     NK   K         L+GH G
Sbjct: 424 HNTNSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSG 483

Query: 371 TISCIEFNVNSRLLLTSSDSDYSIRIW--------------------------------- 397
           T+    F+ ++R LL++S+ D ++R+W                                 
Sbjct: 484 TVYSTSFSPDNRYLLSASE-DKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATA 542

Query: 398 -HGQKENCCNC--------FYGHSQSIISLSW-INDDLVISASMDGSVRIWSVVENCLVG 447
            H Q     +C        F GH   + ++S+  N   V + S D + R+W +     V 
Sbjct: 543 SHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVR 602

Query: 448 MAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDI 482
           + +     +    +S D    + GS +G INV+DI
Sbjct: 603 LFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDI 637

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 53/114 (46%), Gaps = 6/114 (5%)

Query: 238 TNQITALSWSPDGELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSKHFI 295
           T  +T+ + SPDG  + T  E+G + +W+     RL+ +    ++ + S+ ++++    I
Sbjct: 608 TAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLI 667

Query: 296 SLDLDNITILWNAINGIILQHFEPEQKLENN----TESLGVDIEWVDKDKLVVP 345
           S   D+   +W+          EPEQ         T S+  DI+   + + +VP
Sbjct: 668 SGGADHSVRVWDVKKSTAEPGSEPEQPFTGYSGDVTSSVNQDIKEYGRRRTIVP 721

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/268 (21%), Positives = 112/268 (41%), Gaps = 29/268 (10%)

Query: 241 ITALSWSPDGELIITSVENGELRLWNKDGR-LQNVFNFHRSPIVSIKWNEDSKHFISLDL 299
           I ++ +SPDG+ + T  E+  +R+W+   R +  V   H   I S+ + +     +S   
Sbjct: 376 IRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSG 435

Query: 300 DNITILWNAINGIILQHFEPEQKLENNTESLG----VDIEWVDKDKLVVPGVNGSILVYS 355
           D    +W+   G        E  +     S G    V    +D+  + V   N   LV  
Sbjct: 436 DRTIRIWDLHTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDR-TVRVWDSNSGFLVER 494

Query: 356 IDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH-------------GQKE 402
           +D     G  +GH+ ++  + F  + + +++ S  D S+++W+               + 
Sbjct: 495 LDSEGETG--VGHKDSVYSVVFTRDGKNIVSGS-LDRSVKLWNLRNINGASTSPQPKTEG 551

Query: 403 NCCNCFYGHSQSIISLSWI-NDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKI 461
           NC   + GH   ++S++   ND  ++S S D  V  W  V    + M     N++I   +
Sbjct: 552 NCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWDKVSGVPLLMLQGHRNSVISVAV 611

Query: 462 SHDK------NKFAIGSMNGQINVYDIK 483
           ++ K      N FA GS + +  ++  +
Sbjct: 612 ANGKPLGANYNVFATGSGDCKAKIWKFQ 639

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 72/166 (43%), Gaps = 7/166 (4%)

Query: 232 SITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDS 291
           SI      +I  L W PDG  +++   +  ++LW+           H   +  +K +   
Sbjct: 209 SIDAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLWDMTSNSFEELRGHAGRVSRVKVHPSG 268

Query: 292 KHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSI 351
           +   S   D   ILW+    + L      Q  E +++++       D   L   G++   
Sbjct: 269 RLAASASFDLTWILWDLERKVEL------QLQEGHSKAVYTIAFQSDGALLASAGLDAVC 322

Query: 352 LVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
            ++ +   +PI KL GH G IS ++++ N   L T+  +D ++R+W
Sbjct: 323 AIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAG-ADGTVRVW 367

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/215 (19%), Positives = 82/215 (38%), Gaps = 33/215 (15%)

Query: 240 QITALSWSPDGELIITSVENGELRLWNKD--GRLQNVFNFHRSPIVSIKWNEDSKHFISL 297
            ++ ++   DG+ + T    G +++ + +  G  +++   H   I  + W+ D  H +S 
Sbjct: 174 HVSQVAVHRDGQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSG 233

Query: 298 DLDNITILWNAINGIILQ-----------HFEPEQKLENNTESLGVDIEWVDKDKLVVPG 346
             DN+  LW+  +    +              P  +L     S   D+ W+         
Sbjct: 234 GGDNLVKLWDMTSNSFEELRGHAGRVSRVKVHPSGRL---AASASFDLTWI--------- 281

Query: 347 VNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCN 406
                 ++ ++    +    GH   +  I F  +   LL S+  D    IW  +      
Sbjct: 282 ------LWDLERKVELQLQEGHSKAVYTIAFQSDG-ALLASAGLDAVCAIWDLRSGEPIM 334

Query: 407 CFYGHSQSIISLSW-INDDLVISASMDGSVRIWSV 440
              GH+ +I  + W  N   + +A  DG+VR+W +
Sbjct: 335 KLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDI 369

>ACR091W [1138] [Homologous to ScYDR267C - SH]
           complement(520609..521595) [987 bp, 328 aa]
          Length = 328

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 54/269 (20%), Positives = 112/269 (41%), Gaps = 38/269 (14%)

Query: 196 LLAYGQEDSMAKMIEYNKEDKKIISSLE-LRHPFALSSITGRKTNQITALSWSPDGELII 254
           LLA G  D   K+++    + K++  L+   H  A+ S+           +W P   ++ 
Sbjct: 26  LLATGSADRKIKLVDVR--NFKLVEELDDTAHKKAVRSV-----------AWRPHCNVLA 72

Query: 255 TSVENGELRLWNKDG-------RLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWN 307
               +  + +W +D         L  V   H + + S+ W+ D  +  +   D    +W 
Sbjct: 73  AGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWE 132

Query: 308 AINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYS--IDDNKPIGKL 365
           A    + + FE    L+ +++ +   +    +  L     + ++ +++   DD +    L
Sbjct: 133 ADE--LSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVL 190

Query: 366 LGHQGTISCIEF-NVNSRLLLTSSDSDYSIRIWHGQKENCCNCF-----------YGHSQ 413
            GH GT+ C +F    + + L S   D ++RIW    ++  + F             H++
Sbjct: 191 SGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDA-DVFDKEWIQETVLPAVHTR 249

Query: 414 SIISLSWINDDLVISASMDGSVRIWSVVE 442
           ++ S+SW  D L+ S   DG + ++  V+
Sbjct: 250 AVYSVSWSADGLIASVGSDGVLAVYKEVQ 278

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 99/213 (46%), Gaps = 19/213 (8%)

Query: 239 NQITALSWSPD-GELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSKHFI 295
           N  T+L + P  G L+++   +  ++LW+   +  L   +  H   I  + + ++   F 
Sbjct: 136 NGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLNFTDNGHSFA 195

Query: 296 SLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYS 355
           S   D    +WN   GII      +++L  N+    +     DK++LVV   N  I  Y 
Sbjct: 196 SASFDKWVKIWNTEKGII------DKRLRFNSVPNCITFHPKDKNQLVVGLSNSEIRHYD 249

Query: 356 I---DDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHS 412
           +   +++  + K   HQG+I  +++  + + L++SS+ D ++RIW  +         G +
Sbjct: 250 LRLSENHGEVQKYDHHQGSILALKYFPDGKKLISSSE-DKTVRIWENRINIPIKQISGTA 308

Query: 413 QSIISLSWIN----DDLVISASMDGSVRIWSVV 441
           Q   S+ WI+         + SMD ++  +S++
Sbjct: 309 QH--SMPWIDINPQGQSFCTQSMDNTIYTYSML 339

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 57/125 (45%), Gaps = 4/125 (3%)

Query: 362 IGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKEN-CCNCFYGHSQSIISLSW 420
           I +  GH+   + + F   +  LL S  +D  I++W    E      + GHS +I  L++
Sbjct: 128 IAEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLNF 187

Query: 421 I-NDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKI-SHDKNKFAIGSMNGQIN 478
             N     SAS D  V+IW+  E  ++   +   +   C      DKN+  +G  N +I 
Sbjct: 188 TDNGHSFASASFDKWVKIWN-TEKGIIDKRLRFNSVPNCITFHPKDKNQLVVGLSNSEIR 246

Query: 479 VYDIK 483
            YD++
Sbjct: 247 HYDLR 251

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 88/229 (38%), Gaps = 34/229 (14%)

Query: 274 VFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVD 333
           V   H + I   +W+ DSK  +S   D   ++W++ +G+                ++ +D
Sbjct: 87  VLKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGL-------------KQNAIPLD 133

Query: 334 IEWV------DKDKLVV-PGVNGSILVYSIDDNKPIGK-----LLGHQGTISCIEFNVNS 381
            +WV          LV   G+N +  +Y +     + +       GH   IS IEF  N+
Sbjct: 134 SQWVLSCAISPSSTLVASAGLNNNCTIYRVSKENRVAQNVASIFKGHTCYISDIEFTDNA 193

Query: 382 RLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISL-------SWINDDLVISASMDGS 434
            +L  S   D +  +W   K      +  H   +++L       S  + +   S   DG 
Sbjct: 194 HILTAS--GDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEPNSENSSNTFASCGSDGY 251

Query: 435 VRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIK 483
             IW       V    V+ + I   +   D      GS NG IN+YD++
Sbjct: 252 TYIWDSRSPSAVQSFYVNDSDINALRFFKDGMSIVAGSDNGAINMYDLR 300

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/223 (19%), Positives = 89/223 (39%), Gaps = 23/223 (10%)

Query: 239 NQITALSWSPDGELIITSVENGELRLWNK-DGRLQNVFNFHRSPIVSIKWNEDSKHFISL 297
           N+I+   WS D + I+++ ++G + +W+   G  QN        ++S   +  S    S 
Sbjct: 93  NKISDFRWSRDSKRILSASQDGFMLIWDSASGLKQNAIPLDSQWVLSCAISPSSTLVASA 152

Query: 298 DLDNITILWNAINGIILQHFEPEQKLENNTESLG-------VDIEWVDKDKLVVPGVNGS 350
            L+N   ++             E ++  N  S+         DIE+ D   ++    + +
Sbjct: 153 GLNNNCTIY---------RVSKENRVAQNVASIFKGHTCYISDIEFTDNAHILTASGDMT 203

Query: 351 ILVYSIDDNKPIGKLLGHQGTISCIEF-----NVNSRLLLTSSDSDYSIRIWHGQKENCC 405
             ++ I   K + +   H G +  +       + NS     S  SD    IW  +  +  
Sbjct: 204 CALWDIPKAKRVREYSDHLGDVLALAIPEEPNSENSSNTFASCGSDGYTYIWDSRSPSAV 263

Query: 406 NCFYGHSQSIISLSWINDDLVISASMD-GSVRIWSVVENCLVG 447
             FY +   I +L +  D + I A  D G++ ++ +  +C + 
Sbjct: 264 QSFYVNDSDINALRFFKDGMSIVAGSDNGAINMYDLRSDCSIA 306

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 86/181 (47%), Gaps = 19/181 (10%)

Query: 251 ELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAI 309
           +L++T   +  + +W+   G+L    + H   + ++++  D +  I+  LD    +WN +
Sbjct: 270 KLLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYV 327

Query: 310 NGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPG-VNGSILVYSIDDNKPIGKLLGH 368
            G  +  +   Q    + +S           KL+V G  + ++ V+ ++ ++    L GH
Sbjct: 328 TGACVSTYRGHQDSVLSVDSF---------RKLIVSGSADKTVKVWHVE-SRTCYTLRGH 377

Query: 369 QGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGH---SQSIISLSWINDDL 425
            G ++C++ +  S    + SD D +IR+W  +   C   F+GH    Q +I L+ +  DL
Sbjct: 378 TGWVNCVKLHPKSFTCFSGSD-DMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLT-LGSDL 435

Query: 426 V 426
           +
Sbjct: 436 I 436

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 71/145 (48%), Gaps = 6/145 (4%)

Query: 340 DKLVVPG-VNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH 398
           +KL++ G  + ++ ++ +   K I +L GH   +  + F+   + L+T S  D +IR+W+
Sbjct: 269 NKLLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD--DQKLITGS-LDKTIRVWN 325

Query: 399 GQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIIC 458
                C + + GH  S++S+      L++S S D +V++W V       +    G  + C
Sbjct: 326 YVTGACVSTYRGHQDSVLSVDSFR-KLIVSGSADKTVKVWHVESRTCYTLRGHTG-WVNC 383

Query: 459 GKISHDKNKFAIGSMNGQINVYDIK 483
            K+         GS +  I ++DI+
Sbjct: 384 VKLHPKSFTCFSGSDDMTIRMWDIR 408

 Score = 32.3 bits (72), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 4/85 (4%)

Query: 362 IGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWI 421
           I +  GH   +  +   + ++LLLT S  D ++ IW            GH+  + +L   
Sbjct: 252 IQEFKGHMDGV--LSLQLTNKLLLTGS-YDSTVAIWDLATGKLIRRLSGHTDGVKALR-F 307

Query: 422 NDDLVISASMDGSVRIWSVVENCLV 446
           +D  +I+ S+D ++R+W+ V    V
Sbjct: 308 DDQKLITGSLDKTIRVWNYVTGACV 332

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 51/265 (19%), Positives = 109/265 (41%), Gaps = 35/265 (13%)

Query: 189 WNLQNERLLAY--GQEDSMAKMIEYNKEDKKIIS-----SLELRHPFALSSITGRKTNQI 241
           W+L   +L+    G  D + K + +  +D+K+I+     ++ + +    + ++  + +Q 
Sbjct: 284 WDLATGKLIRRLSGHTDGV-KALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQD 340

Query: 242 TALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDN 301
           + LS     +LI++   +  +++W+ + R       H   +  +K +  S    S   D 
Sbjct: 341 SVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDM 400

Query: 302 ITILW----NAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSID 357
              +W    N    +   H    QK+   T  LG D+    KD +V P           D
Sbjct: 401 TIRMWDIRTNTCVRVFHGHVGQVQKVIPLT--LGSDLIEDPKDAVVPP-----------D 447

Query: 358 DNKPIGKLLGHQGTISCIEFN--VNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSI 415
              P      H  ++    F+  +     L S   D +I++W+ +   C    +GH + +
Sbjct: 448 ATAP-----AHDPSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV 502

Query: 416 ISLSWINDDLVISASMDGSVRIWSV 440
             ++  ++  ++S S D S ++W +
Sbjct: 503 WDIA-ADNFRIVSGSHDRSCKVWDL 526

>Kwal_23.5035
          Length = 744

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 70/144 (48%), Gaps = 12/144 (8%)

Query: 339 KDKLVVPGVNGSIL-VYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           +D  V+ G +  ++ VY     K I +L GH G +  +++  +   +L S  +D S+R+W
Sbjct: 379 EDDYVITGADDKMIRVYDAKTEKFITQLSGHDGGVWALKYGHDG--ILVSGSTDRSVRVW 436

Query: 398 HGQKENCCNCFYGHSQSIISLSWINDD---LVISASMDGSVRIWSVVENCLVGMAMVDGN 454
           + +   C + F GH+ ++  L  +  +    +++ S D ++ +W  + NC       D N
Sbjct: 437 NIKSGKCTHVFKGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVWK-LPNC----NAEDYN 491

Query: 455 AIICGKI-SHDKNKFAIGSMNGQI 477
             +C    + D N + +G + G +
Sbjct: 492 PEVCEVFNTTDANPYFVGVLRGHM 515

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 96/235 (40%), Gaps = 43/235 (18%)

Query: 215 DKKIISSLELRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWN-KDGRLQN 273
           D K+I   + +    ++ ++G     + AL +  DG L+  S +   +R+WN K G+  +
Sbjct: 388 DDKMIRVYDAKTEKFITQLSGHD-GGVWALKYGHDGILVSGSTDR-SVRVWNIKSGKCTH 445

Query: 274 VFNFHRSPI--VSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLEN-NTESL 330
           VF  H S +  + I  +   K  ++   D+   +W               KL N N E  
Sbjct: 446 VFKGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVW---------------KLPNCNAEDY 490

Query: 331 GVDIEWVDKDKLVVPGVNGSILVYSIDDNKP--IGKLLGHQGTISCIEFNVNSRLLLTSS 388
             ++                  V++  D  P  +G L GH   +  +  + N   ++ S 
Sbjct: 491 NPEV----------------CEVFNTTDANPYFVGVLRGHMAAVRTVSGHGN---IVVSG 531

Query: 389 DSDYSIRIWHGQKENCCNCFYGHSQSIISLSW-INDDLVISASMDGSVRIWSVVE 442
             D+++ +W   +  C     GH+  I S  +    +  ISA MD +V++W + +
Sbjct: 532 SYDFNLMVWDIAQMKCLYVLTGHTDRIYSTIYDYQRNRCISAGMDSTVKVWDLAD 586

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 61/121 (50%), Gaps = 6/121 (4%)

Query: 365 LLGHQGTI-SCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIND 423
           L GH   I +C++F  +   ++T +D D  IR++  + E       GH   + +L + +D
Sbjct: 365 LRGHTMKIVTCLQFEDD--YVITGAD-DKMIRVYDAKTEKFITQLSGHDGGVWALKYGHD 421

Query: 424 DLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKI-SHDKNKFAI-GSMNGQINVYD 481
            +++S S D SVR+W++       +     + + C  I  H+  KF + GS +  ++V+ 
Sbjct: 422 GILVSGSTDRSVRVWNIKSGKCTHVFKGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVWK 481

Query: 482 I 482
           +
Sbjct: 482 L 482

>KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomyces
           cerevisiae YPL183c, start by similarity
          Length = 990

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 53/93 (56%), Gaps = 3/93 (3%)

Query: 347 VNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCN 406
           +NG I+V+ +D  K I  L GH+G+I  +  + N +LL + SD D SI IW        +
Sbjct: 160 MNG-IIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSD-DRSIIIWDMVSGKLLS 217

Query: 407 CFYGHSQSIISLSWINDDL-VISASMDGSVRIW 438
             +GH+  I +L + NDD  +IS S D + R+W
Sbjct: 218 RAWGHTARIWNLKFFNDDTQLISVSEDCTCRVW 250

>Kwal_55.22067
          Length = 451

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/247 (19%), Positives = 102/247 (41%), Gaps = 13/247 (5%)

Query: 241 ITALSWSPDGELIITSVENGELRLWNKDG-RLQNVFNFHRSPIVSIKWNEDSKHFISLDL 299
           I AL W+P+G  ++ +  +GE  LWN      +++   H S +  +K++      IS D 
Sbjct: 86  IPALEWTPEGRRLVVATYSGEFSLWNGSTFNFESIMQAHDSAVAVMKYSHAGDWLISGDS 145

Query: 300 DNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDN 359
           D    +W     ++    E   +        G D       K V    +  + +++  + 
Sbjct: 146 DGTIKIWQPNFNMVKVLDEAHTQCIRGISFSGTD------SKFVTCSDDNILKIWNFSNG 199

Query: 360 KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLS 419
           +    L GH   +   +++  +  L+ S   D  +++W  +   C +   G   +IIS  
Sbjct: 200 QQESTLSGHHWDVRSCDWHP-TMGLIASGSKDNLVKLWDPRAGQCISTILGCKHTIISTK 258

Query: 420 W--INDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNK--FAIGSMNG 475
           +     +++   S D S RI+ + +N +  +A+    +       H  N+  F +G  +G
Sbjct: 259 FQPTKGNMLAVISKDKSCRIFDIRQN-MKELAVYRDESDYMSLTWHPINESMFTVGCYDG 317

Query: 476 QINVYDI 482
            +  +D+
Sbjct: 318 SMKHFDL 324

>Scas_603.5
          Length = 589

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 82/167 (49%), Gaps = 24/167 (14%)

Query: 348 NGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH--------- 398
           N SI V+ ++ N  +  L  H  +++C++ + +S+ L+T S  D ++++W          
Sbjct: 316 NTSIKVWDLETNDQVMDLDDHIASVTCMQLHPDSKTLITGS-KDATLKLWDLGLAPQTSL 374

Query: 399 ---GQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVVE-NCL----VGMAM 450
                 ++C N F  H+  I S+S+ N+ L +SAS D S+R W +   NC+      ++ 
Sbjct: 375 DSTSNIDSCINTFEAHTAEITSVSYDNEYL-LSASRDKSIRQWDLTTGNCVQTLEATLSH 433

Query: 451 VDGNAIICGKISHDKN---KFAIGSMNGQINVYDIK--RFVSRLLKR 492
             G  I    +   ++     A GS +G I ++D++  + V  LLK 
Sbjct: 434 NSGTNIKDSTVEALQSVGAALATGSKDGIIRLWDLRSGKVVRTLLKH 480

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 61/267 (22%), Positives = 113/267 (42%), Gaps = 42/267 (15%)

Query: 241 ITALSWSPDGELIITSVENGELRLWNKDGRLQ-------------NVFNFHRSPIVSIKW 287
           +T +   PD + +IT  ++  L+LW+     Q             N F  H + I S+ +
Sbjct: 340 VTCMQLHPDSKTLITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVSY 399

Query: 288 NEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDK--DKLVVP 345
             D+++ +S   D     W+   G  +Q  E      + T      +E +      L   
Sbjct: 400 --DNEYLLSASRDKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDSTVEALQSVGAALATG 457

Query: 346 GVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIR-IWHGQKENC 404
             +G I ++ +   K +  LL HQG I+ ++F+ +++++  S+D++ S+  +  G     
Sbjct: 458 SKDGIIRLWDLRSGKVVRTLLKHQGPITSLQFD-STKIITGSTDANISVSDLRTGNILET 516

Query: 405 CNCFYGHSQSIISLSWINDDLVISASMDGSVRI--------WSVVENCLVGMAMVDGNAI 456
            +C       I +  + ND LV++A     VR+        W    NC   + + D +  
Sbjct: 517 YHC----DAPINTFDFENDKLVVAADT-KDVRVINRNNGSHW----NC--DIKVPDESTT 565

Query: 457 ICGKISHDKNKFAI-GSMNGQINVYDI 482
           +  K+   K K  I G  NG IN++ I
Sbjct: 566 VSVKL---KKKLMIEGRSNGVINLWHI 589

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/71 (21%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 371 TISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDD-LVISA 429
           T++C++F++++++L T+   + SI++W  +  +       H  S+  +    D   +I+ 
Sbjct: 296 TVTCLDFDLSTKMLYTAGKYNTSIKVWDLETNDQVMDLDDHIASVTCMQLHPDSKTLITG 355

Query: 430 SMDGSVRIWSV 440
           S D ++++W +
Sbjct: 356 SKDATLKLWDL 366

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 51.6 bits (122), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 93/224 (41%), Gaps = 33/224 (14%)

Query: 278 HRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWV 337
           H + + S +W+ DS+  +S   D   +LW+A  G+              + ++ +  +WV
Sbjct: 126 HNNKVSSFRWSSDSRTILSASQDGFMLLWDAATGL-------------KSNAIPLHSQWV 172

Query: 338 -------DKDKLVVPGVNGSILVYSIDDNKPIGK-----LLGHQGTISCIEFNVNSRLLL 385
                  + + +   G++ +  +Y +     I +       GH   IS IEF ++   +L
Sbjct: 173 LSCAICPNGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCYISEIEF-LDDNSIL 231

Query: 386 TSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWI------NDDLVISASMDGSVRIWS 439
           T+S  D +  +W   K    N F  H   ++SLS        N ++  S   DG + IW 
Sbjct: 232 TAS-GDMTCALWDITKSKRINEFADHLGDVLSLSAAPTETEGNGNVFASGGSDGYLYIWD 290

Query: 440 VVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIK 483
                 V    V  + +   K   + N  A GS +G  N+YD++
Sbjct: 291 KRVPTSVQSFFVSDSDVSKVKFFRNGNTIATGSDDGCTNLYDLR 334

 Score = 36.6 bits (83), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 2/82 (2%)

Query: 360 KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLS 419
           KP+  L GH   +S   ++ +SR +L++S   + + +W        N    HSQ ++S +
Sbjct: 118 KPVTTLKGHNNKVSSFRWSSDSRTILSASQDGFML-LWDAATGLKSNAIPLHSQWVLSCA 176

Query: 420 WI-NDDLVISASMDGSVRIWSV 440
              N +LV SA +D +  I+ V
Sbjct: 177 ICPNGNLVASAGLDNNCTIYRV 198

 Score = 29.6 bits (65), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 40/94 (42%), Gaps = 8/94 (8%)

Query: 410 GHSQSIISLSWINDD-LVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKF 468
           GH+  + S  W +D   ++SAS DG + +W            +    ++   I  + N  
Sbjct: 125 GHNNKVSSFRWSSDSRTILSASQDGFMLLWDAATGLKSNAIPLHSQWVLSCAICPNGNLV 184

Query: 469 AIGSMNGQINVYDIKRFVSRLLKRDKKQELVVPI 502
           A   ++    +Y       R+ ++D+ Q+ +V I
Sbjct: 185 ASAGLDNNCTIY-------RVSRKDRIQQNIVSI 211

>YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protein
           containing five WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           low similarity to a region of S. pombe Tup11p, which is
           a transcriptional repressor functioning redundantly with
           Tup12p [3042 bp, 1013 aa]
          Length = 1013

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 59/107 (55%), Gaps = 4/107 (3%)

Query: 340 DKLVVPG--VNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           DK+ V    V G ++++ +     I  LLGH+G+I  +  + N R + + SD D SIR+W
Sbjct: 148 DKVYVNAGTVMGGVIIWDLFSETKIHNLLGHEGSIFYVNLSNNGRYVASCSD-DRSIRLW 206

Query: 398 HGQKENCCNCFYGHSQSIISLSWI-NDDLVISASMDGSVRIWSVVEN 443
             +     +  + H+  I +L +  ND  +IS S D + R+W+++E+
Sbjct: 207 DLETGKQLSVGWSHTARIWNLMFFDNDSKLISVSEDCTCRVWNIIES 253

>Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement
          Length = 997

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 53/97 (54%), Gaps = 2/97 (2%)

Query: 347 VNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCN 406
           V G + ++ +     +  LLGH+G+I  +  + N   +++ SD D SI++W+ +     +
Sbjct: 159 VMGGVFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSCSD-DRSIKLWNLKSGELLS 217

Query: 407 CFYGHSQSIISLSWI-NDDLVISASMDGSVRIWSVVE 442
             +GH+  I  L +I ND  V+S S D + R+W + +
Sbjct: 218 TGWGHTARIWQLKFIDNDTKVVSVSEDCTCRVWDIAK 254

>AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146)
           [2931 bp, 976 aa]
          Length = 976

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 52/95 (54%), Gaps = 2/95 (2%)

Query: 347 VNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCN 406
           V G ++V+ +     + +L GH+G+I C   + + RL+ + SD D SIR+W  +      
Sbjct: 159 VMGGVVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSD-DRSIRVWSLETGEQVG 217

Query: 407 CFYGHSQSIISLSWIN-DDLVISASMDGSVRIWSV 440
             +GH+  I  L ++   D ++S S D + R+W+V
Sbjct: 218 IAWGHTARIWDLRFLRVADKLVSVSEDCTCRVWAV 252

>Scas_707.22
          Length = 730

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 81/159 (50%), Gaps = 11/159 (6%)

Query: 288 NEDSKHFISLDLDNITILWNAINGIILQHFEPEQK-LENNTESLGVDIEWVDKDKLVVPG 346
           N  S  F    ++++ IL N  N      F+PE+  L  +  S+   +++ D D ++   
Sbjct: 319 NNKSSFFKEKFIESLRILQNWYN----PSFKPERTTLTGHATSVVTCLQFED-DYVITGA 373

Query: 347 VNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCN 406
            +  + +Y     K + +L GH+G +  ++++ +   ++ S  +D S+RIW  ++  C +
Sbjct: 374 DDRQLRIYDARSKKFLKELSGHEGGVWALKYDADG--IIVSGSTDRSVRIWDIKRGCCTH 431

Query: 407 CFYGHSQSIISL---SWINDDLVISASMDGSVRIWSVVE 442
            F GH+ ++  L   ++ N   +++ S D ++ +W +++
Sbjct: 432 VFKGHTSTVRCLEIVTYKNMKYIVTGSRDNTLHVWKLIK 470

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 68/315 (21%), Positives = 130/315 (41%), Gaps = 62/315 (19%)

Query: 166 ESSFFA-KTLNEVQTLDNKVVTSSWNLQNERLLAYGQEDSMAKMIEYNKE------DKKI 218
           +SSFF  K +  ++ L N    S    + ER    G   S+   +++  +      D + 
Sbjct: 321 KSSFFKEKFIESLRILQNWYNPS---FKPERTTLTGHATSVVTCLQFEDDYVITGADDRQ 377

Query: 219 ISSLELRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNF 277
           +   + R    L  ++G +   + AL +  DG +I++   +  +R+W+ K G   +VF  
Sbjct: 378 LRIYDARSKKFLKELSGHE-GGVWALKYDADG-IIVSGSTDRSVRIWDIKRGCCTHVFKG 435

Query: 278 HRSPI--VSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIE 335
           H S +  + I   ++ K+ ++   DN   +W  I          E+K +           
Sbjct: 436 HTSTVRCLEIVTYKNMKYIVTGSRDNTLHVWKLIK---------EEKFDGE--------- 477

Query: 336 WVDKDKLVVPGVNGSILVYSIDDNKP--IGKLLGHQGTISCIEFNVNSRLLLTSSDSDYS 393
                   +P      +VY+  +  P  +G L GH  ++  I  + N   ++ S   D +
Sbjct: 478 --------LP------MVYNTPEENPYFVGVLRGHMASVRTISGHGN---IVISGSYDNN 520

Query: 394 IRIWHGQKENCCNCFYGHSQSIISLSWIND-DLVISASMDGSVRIWSVVE-----NCLVG 447
           + +W   +  C     GH+  I S  + +     ISASMD ++++W +       NC + 
Sbjct: 521 LMVWDIAQMKCLYVLIGHTDRIYSTIYDHKRQRCISASMDSTIKVWDLDNIWNNGNCTI- 579

Query: 448 MAMVDGNAIICGKIS 462
              +  +A  C KI+
Sbjct: 580 ---ITNSATPCTKIT 591

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 61/121 (50%), Gaps = 6/121 (4%)

Query: 365 LLGHQGTI-SCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIND 423
           L GH  ++ +C++F      ++T +D D  +RI+  + +       GH   + +L +  D
Sbjct: 351 LTGHATSVVTCLQFE--DDYVITGAD-DRQLRIYDARSKKFLKELSGHEGGVWALKYDAD 407

Query: 424 DLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKN-KFAI-GSMNGQINVYD 481
            +++S S D SVRIW +   C   +     + + C +I   KN K+ + GS +  ++V+ 
Sbjct: 408 GIIVSGSTDRSVRIWDIKRGCCTHVFKGHTSTVRCLEIVTYKNMKYIVTGSRDNTLHVWK 467

Query: 482 I 482
           +
Sbjct: 468 L 468

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/270 (22%), Positives = 111/270 (41%), Gaps = 27/270 (10%)

Query: 233 ITGRKTNQITALSWSPDGELIITSVENGELRLWNK-DGRLQNVFNFHRSPIVSIKWNEDS 291
           +T      I  L WSPD + I +  E+  + + +   GR++ +   H +P++SI +N   
Sbjct: 64  LTTTHKECINCLCWSPDSKCIASGSEDFTVEITHIIYGRIRRLMG-HTAPVISICYNNKG 122

Query: 292 KHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSI 351
               S  +D     W+ ++G  L+         ++   + +DI   D   L     +G I
Sbjct: 123 NILCSSSMDESIKEWHVLSGTALKTMS-----AHSDAVVSIDIPKFDSSILSSGSYDGLI 177

Query: 352 LVYSIDDNKPIGKL------LGHQGT--ISCIEFNVNSRLLLTSSDSDYSIRIWHGQKEN 403
            ++  +    +  L      +   G   IS ++F+ N + LL  S  D  +++W   +  
Sbjct: 178 RIFDTESGHCLKTLTYDKDWIAEDGVVPISTVKFSRNGKFLLVKS-LDNVVKLWEYTRGT 236

Query: 404 CCNCF-YGHSQSIISLSW----------INDDLVISASMDGSVRIWSVVENCLVGMAMVD 452
               F + H ++   L +            D LVIS +  GS+ +W+V    LV      
Sbjct: 237 VVRTFLWPHQETKAKLKYNCGLELIYPQGKDPLVISGNDSGSMCVWNVYSKNLVQKIDEK 296

Query: 453 GNAIICGKISHDKNKFAIGSMNGQINVYDI 482
                   IS   +K A  S+NG+ N++ +
Sbjct: 297 HRNSPLISISASYDKVATLSLNGECNLFRV 326

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 98/222 (44%), Gaps = 19/222 (8%)

Query: 227 PFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNV-FNF-HRSPIVS 284
           P  ++S  G + N +T++S+  D   ++TS E+G +++W  D R  ++  N+ H +P+  
Sbjct: 65  PNPVASFEGHRGN-VTSVSFQQDNRWMVTSSEDGTIKVW--DVRSPSIPRNYKHNAPVNE 121

Query: 285 IKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVV 344
           +  + +    IS D D    +W+           PE      + S+       D   L  
Sbjct: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMA-----SDGSMLAA 176

Query: 345 PGVNGSILVYSIDDN------KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH 398
               G+  V+ + ++      KP+ K   H   I+ I  + + + L T S +D++ R+W 
Sbjct: 177 ANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCS-ADHTARVWS 235

Query: 399 GQKE-NCCNCFYGHSQSIISLSWINDD-LVISASMDGSVRIW 438
              +        GH + +   ++  D   +++AS D  VR+W
Sbjct: 236 IDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 39/192 (20%), Positives = 86/192 (44%), Gaps = 11/192 (5%)

Query: 294 FISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILV 353
            +S   D+    W A+ G+  +  +      N        +E  +  KL+    + ++ +
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNR-------LEITNDKKLLATAGHQNVRL 57

Query: 354 YSI--DDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGH 411
           Y I   +  P+    GH+G ++ + F  ++R ++TSS+ D +I++W  +  +    +  +
Sbjct: 58  YDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSE-DGTIKVWDVRSPSIPRNYKHN 116

Query: 412 SQSIISLSWINDDLVISASMDGSVRIWSVVEN-CLVGMAMVDGNAIICGKISHDKNKFAI 470
           +     +   N   +IS   DG++RIW + EN C   +   D  ++    ++ D +  A 
Sbjct: 117 APVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAA 176

Query: 471 GSMNGQINVYDI 482
            +  G   V+++
Sbjct: 177 ANTKGNCYVWEM 188

>Scas_721.32
          Length = 822

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 87/204 (42%), Gaps = 12/204 (5%)

Query: 241 ITALSWSPDGELIITSVENGELRLWNKDGRLQNV-FNFHRSPIVSIKWNEDSKHFISLDL 299
           + + S+SPD   +++  E+  +RLW+ D     V +  H  P+  ++++    +F +   
Sbjct: 552 VYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATASH 611

Query: 300 DNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPG-VNGSILVYSIDD 358
           D    LW+        H  P +    +   +   + +      V  G  + +  ++ I  
Sbjct: 612 DQTARLWSC------DHIYPLRIFAGHLSDVDC-VSFHPNGCYVFTGSSDKTCRMWDIST 664

Query: 359 NKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSII-S 417
              +   LGH   + C   + + R L T S+ D  I +W            GH ++ I S
Sbjct: 665 GDSVRLFLGHTAPVLCTAVSPDGRWLATGSE-DGIINLWDIGTAKRLKVMRGHGKNAIHS 723

Query: 418 LSWIND-DLVISASMDGSVRIWSV 440
           LS+  + ++++S   D SVR+W +
Sbjct: 724 LSYCKEGNVLVSGGADHSVRVWDL 747

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 78/380 (20%), Positives = 147/380 (38%), Gaps = 62/380 (16%)

Query: 112 DSESQYEERLAKGKKESEINTPIIPTSGIEEETNTKIKADIEDISIHNDTEDSAESSFFA 171
           ++E   E    K + E +  TP  PTS +E   NT +    E                  
Sbjct: 378 NNEQDKENTTDKAQTEQDATTPA-PTSTLEPPANTTVTVKTE------------------ 418

Query: 172 KTLNEVQTLDNKVVTSSWNLQ--NERLLAYGQEDSMAKMIEYNK----EDKKIISSLELR 225
               E  T  +K V +  NL+  ++ +L    + ++   +E  K     D   + +L+  
Sbjct: 419 ----EKSTTSSKPVIAGENLEAPSKDILPLPPKTALDLKLEIQKVKESRDSIKLDNLQAA 474

Query: 226 HPFALSSITGRKTNQ-ITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVS 284
            P ++   T   TN  +T+L +S D  L+    ++  ++LW+ DG          S +  
Sbjct: 475 LP-SVCMYTFHNTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDG----------SSLKQ 523

Query: 285 IK-WNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLV 343
           I+  + DS +   ++ +  T L      +    F P+ +                   L+
Sbjct: 524 IQEKSADSINTGDMNDNTSTTLIGHSGAVYSTSFSPDNRY------------------LL 565

Query: 344 VPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKEN 403
               + ++ ++S D    +    GH   +  ++F+       T+S  D + R+W      
Sbjct: 566 SGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATAS-HDQTARLWSCDHIY 624

Query: 404 CCNCFYGHSQSIISLSW-INDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKIS 462
               F GH   +  +S+  N   V + S D + R+W +     V + +     ++C  +S
Sbjct: 625 PLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVS 684

Query: 463 HDKNKFAIGSMNGQINVYDI 482
            D    A GS +G IN++DI
Sbjct: 685 PDGRWLATGSEDGIINLWDI 704

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 65/168 (38%), Gaps = 25/168 (14%)

Query: 244 LSWSPDGELIITSVENGELRLWNKDGRLQ-NVFNFHRSPIVSIKWNEDSKHFISLDLDNI 302
           + +SP G    T+  +   RLW+ D      +F  H S +  + ++ +  +  +   D  
Sbjct: 597 VQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKT 656

Query: 303 TILWNAING----IILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDD 358
             +W+   G    + L H  P         ++  D  W     L     +G I ++ I  
Sbjct: 657 CRMWDISTGDSVRLFLGHTAPVL-----CTAVSPDGRW-----LATGSEDGIINLWDIGT 706

Query: 359 NKPIGKLLGH-----QGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK 401
            K +  + GH          C E NV     L S  +D+S+R+W  +K
Sbjct: 707 AKRLKVMRGHGKNAIHSLSYCKEGNV-----LVSGGADHSVRVWDLKK 749

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 102/219 (46%), Gaps = 19/219 (8%)

Query: 230 LSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNV-FNF-HRSPIVSIKW 287
           ++S  G + N +T++S+  D + ++TS E+G +++W  D R  +V  N+ H +P+  +  
Sbjct: 68  VASFEGHRGN-VTSVSFQQDNKWMVTSSEDGTIKVW--DIRSPSVPRNYKHNAPVNEVVI 124

Query: 288 NEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGV 347
           + +    IS D D    +W+           PE  +    +SL V     D   LV    
Sbjct: 125 HPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDVP--LQSLSVA---SDGSMLVAANN 179

Query: 348 NGSILVYSIDDN------KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK 401
            G+  V+ + ++      KP  K   H   I+ +  + + + + T S +D++ RIW  + 
Sbjct: 180 KGNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLLSSDVKHMATCS-ADHTARIWSVED 238

Query: 402 E-NCCNCFYGHSQSIISLSWINDD-LVISASMDGSVRIW 438
             N  +   GH + +   ++  D   +++AS D  VR+W
Sbjct: 239 NFNLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 75/153 (49%), Gaps = 12/153 (7%)

Query: 294 FISLDLDNITILWNAINGIILQHFE-PEQKLENNTESLGVDIEWVDKDKLVVPGVNGSIL 352
            +S   D+    W A+ G+ L+  + P+ ++          +E  +  KL+    + +I 
Sbjct: 5   LVSAGYDHTIRFWEALTGVCLRTIQHPDSQVNR--------LEITNDKKLLAAAGHQNIR 56

Query: 353 VYSI--DDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYG 410
           +Y I   ++ P+    GH+G ++ + F  +++ ++TSS+ D +I++W  +  +    +  
Sbjct: 57  LYDIKTSNSNPVASFEGHRGNVTSVSFQQDNKWMVTSSE-DGTIKVWDIRSPSVPRNYKH 115

Query: 411 HSQSIISLSWINDDLVISASMDGSVRIWSVVEN 443
           ++     +   N   +IS   DG++RIW + EN
Sbjct: 116 NAPVNEVVIHPNQGELISCDRDGNIRIWDLGEN 148

 Score = 29.6 bits (65), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 22/103 (21%), Positives = 44/103 (42%), Gaps = 2/103 (1%)

Query: 383 LLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVVE 442
           +LL S+  D++IR W      C          +  L   ND  +++A+   ++R++ +  
Sbjct: 3   VLLVSAGYDHTIRFWEALTGVCLRTIQHPDSQVNRLEITNDKKLLAAAGHQNIRLYDIKT 62

Query: 443 NCLVGMAMVDGNA--IICGKISHDKNKFAIGSMNGQINVYDIK 483
           +    +A  +G+   +       D       S +G I V+DI+
Sbjct: 63  SNSNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIR 105

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/268 (19%), Positives = 114/268 (42%), Gaps = 31/268 (11%)

Query: 194 ERLLAYGQEDSMAKMIE----YNKE---------DKKIISSLELRHPFALSSITGRKTNQ 240
           +RL  Y + +  A  I+    Y  E         +K++I++     P   + ++  K   
Sbjct: 28  DRLYYYSRHNLPAPHIQPETTYTTEILPPDAYYGNKRVINT-----PTKFTHLSSNKVKH 82

Query: 241 -ITALSWSPDGELIITSVENGELRLWNKDG-RLQNVFNFHRSPIVSIKWNEDSKHFISLD 298
            I A+ W+P+G  ++ +  +GE  LWN      +++   H S + +++++      IS D
Sbjct: 83  VIPAIKWTPEGRRLVVATYSGEFSLWNGSTFNFESIMQAHDSAVTTMEYSHAGDWLISGD 142

Query: 299 LDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSIL-VYSID 357
            D I  +W         +F   + L+        D+ +   D   V   + +IL +++  
Sbjct: 143 SDGIIKIWQP-------NFNMVKVLDQAHMECVRDVSFSGTDSKFVTCSDDNILKIWNFS 195

Query: 358 DNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIIS 417
           + +    L GH   +   +++    L+++ S  D  I++W  +   C +   G   +II 
Sbjct: 196 NGQQERVLSGHHWDVKSCDWHPTMGLIVSGS-KDNLIKLWDPRSGQCISTILGFKHTIIK 254

Query: 418 LSW--INDDLVISASMDGSVRIWSVVEN 443
             +     +L+   + D S +I+ + +N
Sbjct: 255 TKFQPTKGNLLAVVAKDKSCKIFDIRQN 282

>Scas_721.7
          Length = 325

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 75/144 (52%), Gaps = 11/144 (7%)

Query: 368 HQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIND--DL 425
           H   IS + ++ +++ L ++SD D++I I H     C +   GH+  +ISL++ ND  +L
Sbjct: 56  HVAPISEVAWSPDNQCLASASD-DFTIEITH-LTHGCLHRLMGHTAPVISLTY-NDSGNL 112

Query: 426 VISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNK--FAIGSMNGQINVYDIK 483
           + ++SMD S++IW      ++        +++   I  D++    A GS +G I ++D +
Sbjct: 113 LFTSSMDESIKIWDTFHGAILKTISAHSESVVSLSICPDRDSSVLASGSFDGLIRLFDTR 172

Query: 484 R-FVSRLLKRD---KKQELVVPIT 503
                + L  D   K  + VVPI+
Sbjct: 173 TGHCLKTLTYDKDWKSDDGVVPIS 196

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/124 (20%), Positives = 59/124 (47%), Gaps = 16/124 (12%)

Query: 193 NERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQITALSWSPDGEL 252
           N RL+A  Q   + +++ Y+ + + I S +   H              I+ ++WSPD + 
Sbjct: 26  NGRLIAVTQ---LTQILIYDLQTRAIHSIIPTSH-----------VAPISEVAWSPDNQC 71

Query: 253 IITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAING 311
           + ++ ++  + + +   G L  +   H +P++S+ +N+      +  +D    +W+  +G
Sbjct: 72  LASASDDFTIEITHLTHGCLHRLMG-HTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHG 130

Query: 312 IILQ 315
            IL+
Sbjct: 131 AILK 134

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/93 (18%), Positives = 43/93 (46%), Gaps = 11/93 (11%)

Query: 238 TNQITALSWSPD--GELIITSVENGELRLWN-KDGRLQNVFNFHRS--------PIVSIK 286
           +  + +LS  PD    ++ +   +G +RL++ + G       + +         PI  ++
Sbjct: 140 SESVVSLSICPDRDSSVLASGSFDGLIRLFDTRTGHCLKTLTYDKDWKSDDGVVPISQVR 199

Query: 287 WNEDSKHFISLDLDNITILWNAINGIILQHFEP 319
           ++ + K  +    D I  +W+ + G +++ F+P
Sbjct: 200 FSPNGKFLLVSSFDGIVKIWDCVRGYVVRTFKP 232

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 74/159 (46%), Gaps = 19/159 (11%)

Query: 341 KLVVPGVNGSILVYSIDDNKPIG---KLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           K+V  G   +I ++   D    G    L GH   ++C+ F   + +++++S+ D+ +R+W
Sbjct: 25  KVVAYGAGKTIALWKSMDTSHHGVFKTLKGHTAEVTCVRFVKGTDMMVSASE-DFEVRVW 83

Query: 398 --------HGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVVENCLV--- 446
                   H  +  C      H  +I   + + + LV+  + DGS+ +WS +E+  V   
Sbjct: 84  NFPKLREGHMDEVECIQVIKHHKHTITVFAVLKNLLVVGCA-DGSISVWSFIEDQYVLQE 142

Query: 447 GMAMVDGNAIICGKISH-DKNKF--AIGSMNGQINVYDI 482
             ++  G   +C  +   +K +F  AIG  N  + +Y +
Sbjct: 143 EFSVQKGVFPLCLSMHEIEKTQFILAIGGTNVNVFIYSL 181

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 47/227 (20%), Positives = 97/227 (42%), Gaps = 36/227 (15%)

Query: 192 QNERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQITALSWSPDGE 251
           +  +++AYG   ++A           +  S++  H     ++ G  T ++T + +    +
Sbjct: 22  ETTKVVAYGAGKTIA-----------LWKSMDTSHHGVFKTLKGH-TAEVTCVRFVKGTD 69

Query: 252 LIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLD--LDNITILWNAI 309
           +++++ E+ E+R+WN       +   H   +  I+  +  KH I++   L N+ ++  A 
Sbjct: 70  MMVSASEDFEVRVWN----FPKLREGHMDEVECIQVIKHHKHTITVFAVLKNLLVVGCAD 125

Query: 310 NGIILQHF-------EPEQKLENNTESLGVDIEWVDKDK--LVVPGVNGSILVYSIDDNK 360
             I +  F       + E  ++     L + +  ++K +  L + G N ++ +YS+  N 
Sbjct: 126 GSISVWSFIEDQYVLQEEFSVQKGVFPLCLSMHEIEKTQFILAIGGTNVNVFIYSLVSNS 185

Query: 361 P-------IGKLLGHQGTISCIEF--NVNSRLLLTSSDSDYSIRIWH 398
                     KL GH+  I  + F   V    LL S   D  IR+W 
Sbjct: 186 EGVSKLEFATKLEGHEDWIKSLVFRETVPGDYLLASGSQDRYIRLWR 232

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 48/89 (53%), Gaps = 10/89 (11%)

Query: 240 QITALSWSPDGELIITS-----VENGELRLWNKDG--RLQNVFNFHRSPIVSIKWNEDSK 292
           +I+ +  SPD +LI T+      ++  +RL++ +   +L  V  FH   I  +++++D++
Sbjct: 561 EISCIDVSPDRKLIATACKSNNAQHAVIRLFDAENWNQLPQVLPFHNLTITKLRFSKDNR 620

Query: 293 HFISLDLDNITILWNA---INGIILQHFE 318
           + +S+  D +  LW      N  +L+ F+
Sbjct: 621 YLLSVSRDRLWSLWERNFDNNSFVLRSFK 649

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 55/109 (50%), Gaps = 11/109 (10%)

Query: 340 DKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYS----IR 395
           D+L+ P +   +  +++     I KL GH   ISCI+ + + +L+ T+  S+ +    IR
Sbjct: 532 DELLTPPLEDQLQRHTL--WPEIEKLYGHGYEISCIDVSPDRKLIATACKSNNAQHAVIR 589

Query: 396 IWHGQKEN-CCNCFYGHSQSIISLSWINDD-LVISASMDGSVRIWSVVE 442
           ++  +  N        H+ +I  L +  D+  ++S S D   R+WS+ E
Sbjct: 590 LFDAENWNQLPQVLPFHNLTITKLRFSKDNRYLLSVSRD---RLWSLWE 635

>Scas_465.4
          Length = 1002

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 57/99 (57%), Gaps = 4/99 (4%)

Query: 347 VNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK-ENCC 405
           V G +L++ +     +  L+GH+G+I     + N R + + SD D SI++W+ Q  E  C
Sbjct: 157 VMGGVLIWDLFLETKLYNLVGHEGSIFYATISDNGRYITSCSD-DRSIKLWNLQTGEELC 215

Query: 406 NCFYGHSQSIISLSWINDDL-VISASMDGSVRIWSVVEN 443
              +GH+  I +L + N+D  +IS S D + R+W ++++
Sbjct: 216 TG-WGHTARIWNLKFFNNDTQLISVSEDNTCRVWDILQD 253

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 76/145 (52%), Gaps = 10/145 (6%)

Query: 347 VNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCN 406
           V G  +V+ +   + I  L GH+G+I  I+ + +++L+ + SD D SIR+W  +     +
Sbjct: 157 VMGGAIVWDLYKEELIHNLTGHEGSIFYIQSSEHNKLIASCSD-DRSIRLWDRETGKELS 215

Query: 407 CFYGHSQSIISLSWINDDL-VISASMDGSVRIWSVVENCLVGMAMVDGNAI-------IC 458
             + H+  I +L + N+D  ++S S D + R+W+++ N + G  +   N         + 
Sbjct: 216 IGWSHTARIWNLKFFNNDENLVSVSEDCTCRVWNIIPNDISGYELQISNIFEGHLLKNVW 275

Query: 459 G-KISHDKNKFAIGSMNGQINVYDI 482
           G  ++ +K   A    +G+INV D+
Sbjct: 276 GVDVNDEKRIIATSGNDGRINVIDL 300

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 71/163 (43%), Gaps = 10/163 (6%)

Query: 278 HRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWV 337
           H   I +I    +   F +   D    LWN   G      EP   L N+   L  D+ + 
Sbjct: 494 HEKDINAISMAPNDSIFATASYDKTCKLWNVDTG------EPVATLANHKRGLW-DVSFC 546

Query: 338 DKDK-LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRI 396
           + +K +     + ++ ++S++    +  L GH   +    F +N +  L S+ +D  I++
Sbjct: 547 ESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSF-MNKQKQLVSAGADGLIKV 605

Query: 397 WHGQKENCCNCFYGHSQSIISLSWIND-DLVISASMDGSVRIW 438
           W     +C     GHS  I +LS + D DL+ISA  D   + W
Sbjct: 606 WDIASGDCIKNLDGHSNRIWALSVLEDGDLIISADADSVFQFW 648

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 67/303 (22%), Positives = 123/303 (40%), Gaps = 26/303 (8%)

Query: 221 SLELRHPFALSSITGRKTNQITALSWSPDGELIITSV--ENGELRLWNKDGRLQNVFNFH 278
           S +L+  +  +S++    +  +  + S DG L+   V  E   ++L      L ++ N  
Sbjct: 2   SSDLKCSYKSTSLSPIYASTGSVATISADGSLLACPVLDEINIIQLIPNRKLLHSIDNAD 61

Query: 279 RSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVD 338
              I  I    D K+ I +    +  + N   G+I +      K+ + +  +  D     
Sbjct: 62  EQEITGISLTPDGKYLIYVSQSQLVKIVNVETGVITRSL----KVSSPSYVMTCD---PT 114

Query: 339 KDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEF--NVNSRL-LLTSSDSDYSIR 395
              + + G +GSI V  I++        GH GTIS ++F   + + + LL S D++   +
Sbjct: 115 STLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGELGTNIWLLGSGDTNGMAK 174

Query: 396 IWHGQKENCCNCFYGHSQSIISLSWI-NDDL----VISASMDGSVRIWSV----VENCLV 446
           +W      C      HS +I  + +  NDD     +I+   D  + +W        + LV
Sbjct: 175 VWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLWRFNIKGKSSKLV 234

Query: 447 GMAMVDGNAIICGKISHDKNKFA-IGSMNGQINVYDIKRFVSRLLKRDKK--QELVVPIT 503
                      CG I+H+   FA     +    + D+    S ++K  KK  +EL +   
Sbjct: 235 KTIPAHLQIEACGFITHNDETFAYTAGGDAVFQIIDLNE--SSVVKCTKKPIEELFITGV 292

Query: 504 IPL 506
           IP+
Sbjct: 293 IPI 295

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/90 (21%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query: 353 VYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHS 412
           ++++D  +P+  L  H+  +  + F  + + + T S  D +++IW  +         GH+
Sbjct: 521 LWNVDTGEPVATLANHKRGLWDVSFCESEKWIATCS-GDKTVKIWSLESFTVLKTLEGHT 579

Query: 413 QSIISLSWINDD-LVISASMDGSVRIWSVV 441
            ++   S++N    ++SA  DG +++W + 
Sbjct: 580 NAVQRCSFMNKQKQLVSAGADGLIKVWDIA 609

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 92/211 (43%), Gaps = 17/211 (8%)

Query: 241 ITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDL 299
           I ++ +SPDG+ + T  E+  +R+W+ +  ++      H   I S+ +       +S   
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSG 468

Query: 300 DNITILWNAINGIILQHFEPEQKLENNTESLG----VDIEWVDKDKLVVPGVNGSILVYS 355
           D    +W+   G        E  +     S G    +    +D+   V     G  LV  
Sbjct: 469 DRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTG-FLVER 527

Query: 356 IDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH-----GQKEN--CCNCF 408
           +D    +G   GH+ ++  + F  + + +++ S  D S+++W+     GQK +  C   +
Sbjct: 528 LDSENELGT--GHRDSVYSVVFTRDGKGVVSGS-LDRSVKLWNLNGLSGQKSHAECEVTY 584

Query: 409 YGHSQSIISLSWI-NDDLVISASMDGSVRIW 438
            GH   ++S++   ND+ ++S S D  V  W
Sbjct: 585 TGHKDFVLSVATTQNDEYILSGSKDRGVLFW 615

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 51/262 (19%), Positives = 108/262 (41%), Gaps = 35/262 (13%)

Query: 195 RLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQITALSWSPDGELII 254
           + LA G ED + ++  ++ E KKI+ +L+           G + + I +L + P G  ++
Sbjct: 419 KFLATGAEDKLIRI--WDLETKKIVMTLK-----------GHEQD-IYSLDYFPSGNKLV 464

Query: 255 TSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISL-DLDNITILWNAINGII 313
           +   +  +R+W+      ++       + ++  +     FI+   LD    +W++  G +
Sbjct: 465 SGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFL 524

Query: 314 LQHFEPEQKLENNTESLGVDIEWVDKDKLVVPG-VNGSILVYSIDDNKPIGK-------- 364
           ++  + E +L          + +    K VV G ++ S+ ++++  N   G+        
Sbjct: 525 VERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNL--NGLSGQKSHAECEV 582

Query: 365 -LLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIND 423
              GH+  +  +    N   +L+ S  D  +  W  +  N      GH  S+IS++  N 
Sbjct: 583 TYTGHKDFVLSVATTQNDEYILSGS-KDRGVLFWDTKSGNPLLMLQGHRNSVISVTVANG 641

Query: 424 -------DLVISASMDGSVRIW 438
                   +  + S D   RIW
Sbjct: 642 HPLGPEYGVFATGSGDCKARIW 663

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 47/222 (21%), Positives = 101/222 (45%), Gaps = 19/222 (8%)

Query: 227 PFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSI 285
           P  ++S  G + N +T++S+  D + +++S E+G +++W+ +   +Q  +  H +P+  +
Sbjct: 65  PNPVTSFEGHRGN-VTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYK-HHAPVNEV 122

Query: 286 KWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVP 345
             + +    IS D D    +W+           PE      + S+  D        ++V 
Sbjct: 123 VIHPNQGELISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIASD------GSMLVA 176

Query: 346 GVN-GSILVYSIDDN------KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH 398
           G N G+  V+ + ++      KP+ K   H   I+ +  + + + L T S +D++ R+W 
Sbjct: 177 GNNKGNCYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCS-ADHTARVWS 235

Query: 399 GQKE-NCCNCFYGHSQSIISLSWINDD-LVISASMDGSVRIW 438
            +          GH + +   ++  D   +++A  D  VR+W
Sbjct: 236 IEDNFKLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLW 277

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 81/192 (42%), Gaps = 11/192 (5%)

Query: 294 FISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILV 353
             S   D+    W A+ G+  +  +      N  E         DK  L   G +  + +
Sbjct: 5   LASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITS------DKRFLAAAG-HLHVRL 57

Query: 354 YSI--DDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGH 411
           Y I   +  P+    GH+G ++ I F  +++ +++SS+ D +I++W  +  +    +  H
Sbjct: 58  YDIRTTNPNPVTSFEGHRGNVTSISFQQDNKWMVSSSE-DGTIKVWDVRAPSVQRNYKHH 116

Query: 412 SQSIISLSWINDDLVISASMDGSVRIWSVVEN-CLVGMAMVDGNAIICGKISHDKNKFAI 470
           +     +   N   +IS   DG++RIW + EN C   +   D   +    I+ D +    
Sbjct: 117 APVNEVVIHPNQGELISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIASDGSMLVA 176

Query: 471 GSMNGQINVYDI 482
           G+  G   V+ +
Sbjct: 177 GNNKGNCYVWQM 188

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 57/270 (21%), Positives = 113/270 (41%), Gaps = 28/270 (10%)

Query: 241 ITALSWSPDGELIITSVENGELRLWNKDGR-LQNVFNFHRSPIVSIKWNEDSKHFISLDL 299
           I ++ +SPDG+ + T  E+  +R+W+ + R +  +   H   I S+ +       +S   
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 505

Query: 300 DNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDK---DKLV-VPGVNGSILVYS 355
           D    +W+   G        E  +     S G D +++     D+ V V       LV  
Sbjct: 506 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPG-DGKYIAAGSLDRAVRVWDSETGFLVER 564

Query: 356 IDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKEN------------ 403
           +D     G   GH+ ++  + F  + + +++ S  D S+++W+ Q  N            
Sbjct: 565 LDSENESG--TGHKDSVYSVVFTRDGQSVVSGS-LDRSVKLWNLQNANNKSDSKTPNSGT 621

Query: 404 CCNCFYGHSQSIISLSWI-NDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKIS 462
           C   + GH   ++S++   ND+ ++S S D  V  W       + M     N++I   ++
Sbjct: 622 CEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVA 681

Query: 463 H------DKNKFAIGSMNGQINVYDIKRFV 486
           +      + N FA GS + +  ++  K+  
Sbjct: 682 NGSPLGPEYNVFATGSGDCKARIWKYKKIA 711

>CAGL0M04081g complement(450572..451939) highly similar to sp|P42841
           Saccharomyces cerevisiae YNL317w PFS2 polyadenylation
           factor I, hypothetical start
          Length = 455

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 61/315 (19%), Positives = 138/315 (43%), Gaps = 34/315 (10%)

Query: 227 PFALSSITGRKTNQ-ITALSWSPDGELIITSVENGELRLWNKDG-RLQNVFNFHRSPIVS 284
           P   + ++  K    I A+ WSP+G  +I +  +GE  LWN      + +   H + + +
Sbjct: 70  PTKFTHLSSNKVKHVIPAIQWSPEGRRLIVATFSGEFSLWNGSSFTFETIMQAHDTSVTT 129

Query: 285 IKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLEN-NTESLGVDIEWVDKDKLV 343
           +K++      IS D D    +W         +F   ++L+  +TE +  D+ + + D   
Sbjct: 130 MKYSHAGDWMISGDADGTIKIWQP-------NFNMVKELDRIHTEGIR-DVAFSNNDSKF 181

Query: 344 VPGVNGSIL-VYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKE 402
           V   + +IL +++  + +    L GH   +   +++    L+++ S  D  +++W  +  
Sbjct: 182 VTCSDDNILKIWNFSNGQQERVLSGHHWDVRSCDWHPELGLIVSGS-KDNLVKLWDPRSG 240

Query: 403 NCCNCFYGHSQSIISLSW--INDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGK 460
            C +       +++   +     +L+ + S D S R++ +  +    M + D    +  +
Sbjct: 241 QCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLRASMNELMCVRDEVDFMELE 300

Query: 461 ISH-DKNKFAIGSMNGQINVYDIKRFVSRLLKRDKKQELVVPITIPLYGSYQNEKIDDCI 519
            S  +++ F +G  +G +  +D        L +D ++ + +   IP    + +EK   CI
Sbjct: 301 WSTINESMFTVGCYDGSLKHFD--------LGQDTEKPIHI---IP----FAHEK---CI 342

Query: 520 FDISWNKSNDLITVA 534
             I++N    ++  A
Sbjct: 343 SAIAYNPVGHILATA 357

>Kwal_23.5351
          Length = 474

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 47/225 (20%), Positives = 98/225 (43%), Gaps = 17/225 (7%)

Query: 226 HPFAL---SSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQN-----VFNF 277
           HP +L    S+ G   ++I  ++WS D +L+ T   +  +++WN   +  +     V   
Sbjct: 210 HPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRG 269

Query: 278 HRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWV 337
           H + +  +K++   +   S   D    LW+      LQ  E   K     E   +D +  
Sbjct: 270 HEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAK-----EVYCLDFQ-C 323

Query: 338 DKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           D   L   G++    V+ +   + +  L GH   I  + ++ N   + T S  D ++++W
Sbjct: 324 DGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGS-GDGTVQVW 382

Query: 398 HGQKENCCNCFYGHSQ--SIISLSWINDDLVISASMDGSVRIWSV 440
             +K N  +    H+   S ++    N + ++S+S D ++ +++ 
Sbjct: 383 DIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFAT 427

 Score = 32.7 bits (73), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 25/122 (20%), Positives = 52/122 (42%), Gaps = 6/122 (4%)

Query: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNC----FYGHSQSIISLSW-I 421
            H   I  + ++ +S+LL T   +D  ++IW+ Q ++          GH   +  + +  
Sbjct: 223 AHDDKIGGVAWSSDSQLLATGG-ADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHP 281

Query: 422 NDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYD 481
           +D  V SAS D + R+W V     + +       + C     D +      ++   +V+D
Sbjct: 282 SDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWD 341

Query: 482 IK 483
           ++
Sbjct: 342 MR 343

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 106/224 (47%), Gaps = 23/224 (10%)

Query: 227 PFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSI 285
           P  ++S  G + N +T++++  D + +++S E+G +++W+ +   +Q  +  H +P+  +
Sbjct: 65  PNPVTSFEGHRGN-VTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNYK-HDAPVNEV 122

Query: 286 KWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVP 345
             + +    IS D D    +W+    +       +  LE+NT    + I   D   LV  
Sbjct: 123 VIHPNQGELISCDQDGNIKIWD----LGENQCTNQLALEDNTALQSLSIA-SDGSMLVAG 177

Query: 346 GVNGSILVYSIDDN------KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW-- 397
              G+  V+ + ++      KP+ K   H   I+ +  +V+ + L T S +D++ R+W  
Sbjct: 178 NNKGNCYVWKMPNHTDTASLKPVTKFRSHSKYITRVLLSVDVKHLATCS-ADHTARVWSV 236

Query: 398 --HGQKENCCNCFYGHSQSIISLSWINDD-LVISASMDGSVRIW 438
             + Q E   +    HS+ +   ++  D   +++A  D  VR+W
Sbjct: 237 EDNFQLETTLD---AHSRWVWDCAFSADSAYLVTACSDHYVRLW 277

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 84/193 (43%), Gaps = 13/193 (6%)

Query: 294 FISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILV 353
             S   D+    W A+ G+  +  +      N  E         DK  L   G +  + +
Sbjct: 5   LASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITS------DKRYLAAAG-HLHVRM 57

Query: 354 YSI--DDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGH 411
           Y I   +  P+    GH+G ++ I F  +++ +++SS+ D +I++W  +  +     Y H
Sbjct: 58  YDIRTTNPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSE-DGTIKVWDVRSPSVQR-NYKH 115

Query: 412 SQSIISLS-WINDDLVISASMDGSVRIWSVVEN-CLVGMAMVDGNAIICGKISHDKNKFA 469
              +  +    N   +IS   DG+++IW + EN C   +A+ D  A+    I+ D +   
Sbjct: 116 DAPVNEVVIHPNQGELISCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIASDGSMLV 175

Query: 470 IGSMNGQINVYDI 482
            G+  G   V+ +
Sbjct: 176 AGNNKGNCYVWKM 188

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 92/214 (42%), Gaps = 13/214 (6%)

Query: 231 SSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNV-FNFHRSPIVSIKWNE 289
           S++ G  +  + + S+SPD   +++  E+  ++LW+ D     V +  H  P+  +K++ 
Sbjct: 527 STLVGH-SGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSP 585

Query: 290 DSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPG-VN 348
              +F S   D    LW         H  P +    +T  +   + +      V  G  +
Sbjct: 586 LGHYFASASHDQTARLW------ACDHIYPLRIFAGHTNDVDT-VSFHPNGCYVFTGSSD 638

Query: 349 GSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCF 408
            +  ++ +     +   LGH   +   + + + R L T S+ D  I +W           
Sbjct: 639 KTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSE-DGVICLWDIGTGKRIKQM 697

Query: 409 YGHSQSII-SLSWIND-DLVISASMDGSVRIWSV 440
            GH ++ + SLS+  + +++IS   D SVR+W V
Sbjct: 698 RGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDV 731

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 55/114 (48%), Gaps = 6/114 (5%)

Query: 238 TNQITALSWSPDGELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSKHFI 295
           T  + +   SPDG  + T  E+G + LW+     R++ +    ++ + S+ +N++    I
Sbjct: 659 TAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLI 718

Query: 296 SLDLDNITILWNAINGIILQHFEPEQKLENN----TESLGVDIEWVDKDKLVVP 345
           S   D+   +W+  +G   Q  EPEQ    +    T S+  DI+   + + ++P
Sbjct: 719 SGGADHSVRVWDVKHGTTEQGPEPEQPFNAHVGDITASINQDIKDYGRRRTIIP 772

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/224 (21%), Positives = 95/224 (42%), Gaps = 33/224 (14%)

Query: 278 HRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWV 337
           H + I   +W+ DSK  +S   D   ++W+ ++G+                ++ +D +WV
Sbjct: 87  HNNKISDFRWSRDSKSILSASQDGFMLIWDPMSGL-------------KKNAIPLDSQWV 133

Query: 338 -------DKDKLVVPGVNGSILVYSID-DNKPIGKLL----GHQGTISCIEFNVNSRLLL 385
                   ++ +   G++ +  +Y I  +N+   K++    GH   +S +EF +N+  +L
Sbjct: 134 LACAISPSRNLVASGGLSNNCTIYRISQENRTQQKIVSIFKGHTCYVSDLEF-INNESIL 192

Query: 386 TSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIN------DDLVISASMDGSVRIWS 439
           T+S  D +  +W   K    + +  H   +++LS         D +  S   DG V +W 
Sbjct: 193 TAS-GDMTCALWDIPKSKRVSEYSDHLGDVLTLSVPPAGTTSYDSMFASGGSDGYVYLWD 251

Query: 440 VVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIK 483
                 V    V  + I   +   D N    GS +G   ++D++
Sbjct: 252 TRSPSSVQNFFVSDSDISTVRFFSDGNSIITGSDDGIARLFDLR 295

 Score = 33.9 bits (76), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 41/94 (43%), Gaps = 8/94 (8%)

Query: 410 GHSQSIISLSWINDDL-VISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKF 468
           GH+  I    W  D   ++SAS DG + IW  +         +D   ++   IS  +N  
Sbjct: 86  GHNNKISDFRWSRDSKSILSASQDGFMLIWDPMSGLKKNAIPLDSQWVLACAISPSRNLV 145

Query: 469 AIGSMNGQINVYDIKRFVSRLLKRDKKQELVVPI 502
           A G ++    +Y       R+ + ++ Q+ +V I
Sbjct: 146 ASGGLSNNCTIY-------RISQENRTQQKIVSI 172

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 61/131 (46%), Gaps = 8/131 (6%)

Query: 361 PIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW 420
           P+    GH   +       + +  L++S  D ++R+W  Q   C   F GH   ++S+S 
Sbjct: 73  PVRSFKGHSHIVQDCTVTHDGKYALSAS-WDKTLRLWDLQSGKCIKRFVGHKSDVMSVS- 130

Query: 421 INDDL--VISASMDGSVRIWSVVENCLVGMA----MVDGNAIICGKISHDKNKFAIGSMN 474
           I+     ++SAS D +V++W+ V +C+V +      V    I   + S D        M+
Sbjct: 131 IDPRATQIVSASRDKTVKVWNTVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMD 190

Query: 475 GQINVYDIKRF 485
             + V+D++ F
Sbjct: 191 KVVKVWDLQSF 201

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/67 (22%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 249 DGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWN 307
           DG+  +++  +  LRLW+ + G+    F  H+S ++S+  +  +   +S   D    +WN
Sbjct: 92  DGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWN 151

Query: 308 AINGIIL 314
            +   ++
Sbjct: 152 TVGDCVV 158

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 96/206 (46%), Gaps = 30/206 (14%)

Query: 224 LRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWN----------------K 267
           L+ P+ L+   G++  +I  +  S DG+ + T   +G++R+W+                +
Sbjct: 4   LKLPW-LTHQEGQRNYEIYTVDVSSDGQRVATGGLDGKIRIWSVADILVFAKPKVSWPAR 62

Query: 268 DGRLQNVF---NFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLE 324
           + +L+      + H   + ++K++ D+K+  S   D I ++W    G +   F+ E  LE
Sbjct: 63  EEQLRKPLANMSRHTGSVTALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLFDMENDLE 122

Query: 325 N-NTESLGV-------DIEWV-DKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCI 375
           + N     V       DI W  D   LV  G++ SI+V++    + I +   HQ  +  +
Sbjct: 123 HWNVRRRLVAHDNDIQDICWAPDSSILVTVGLDRSIIVWNGSTFEKIKRFDVHQSHVKGV 182

Query: 376 EFNVNSRLLLTSSDSDYSIRIWHGQK 401
            F+  ++   T+SD D +++++   K
Sbjct: 183 VFDPANKYFATASD-DRTVKVFRYHK 207

>YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein
           essential for replication of M double-stranded RNA
           (dsRNA) virus, member of the WD (WD-40) repeat family
           [1407 bp, 468 aa]
          Length = 468

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 65/142 (45%), Gaps = 19/142 (13%)

Query: 316 HFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCI 375
           HF P    +    SL +    V +  LV    +  I +Y +   K +G LL HQG+I+ +
Sbjct: 95  HFMPIFHFQ--AHSLSIKCLAVSRRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITAL 152

Query: 376 EF---------------NVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLS- 419
           +F               + NS+ LL++S+ D+ I +W  +         GH+  +  +  
Sbjct: 153 QFSHPASSSEDAAVSKGSKNSKWLLSASE-DHKIMVWRVKDWETVGTLKGHTARVNDVDI 211

Query: 420 WINDDLVISASMDGSVRIWSVV 441
              + + IS S D S+R+W+++
Sbjct: 212 HPTNRIAISVSDDHSIRLWNLM 233

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 70/147 (47%), Gaps = 10/147 (6%)

Query: 339 KDKLVVPGVNGSIL-VYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           +D  V+ G +  ++ +Y     K + +L GH G +  +++  N   +L S  +D S+RIW
Sbjct: 378 EDNYVITGADDKMIRIYDSITKKFLIELSGHDGGVWALKYAGNG--ILVSGSTDRSVRIW 435

Query: 398 HGQKENCCNCFYGHSQSIISLSWINDD---LVISASMDGSVRIWSVVE----NCLVGMAM 450
           +     C + F GH+ ++  L  +  +    +++ S D ++ IW + +    N   GM  
Sbjct: 436 NIHLGKCTHVFKGHTSTVRCLDIVEHEGVKYIVTGSRDNTLHIWKLPQMSDSNIDEGMPN 495

Query: 451 VDGNAIICGKISHDKNKFAIGSMNGQI 477
           V  N       S ++N + +G + G I
Sbjct: 496 VYSNNGPLFFHSPEENPYFVGVLRGHI 522

 Score = 36.6 bits (83), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 4/77 (5%)

Query: 365 LLGHQGTI-SCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIND 423
           L GH  ++ +C++F  N   ++T +D D  IRI+    +       GH   + +L +  +
Sbjct: 364 LKGHMTSVVTCLQFEDN--YVITGAD-DKMIRIYDSITKKFLIELSGHDGGVWALKYAGN 420

Query: 424 DLVISASMDGSVRIWSV 440
            +++S S D SVRIW++
Sbjct: 421 GILVSGSTDRSVRIWNI 437

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 56/244 (22%), Positives = 106/244 (43%), Gaps = 56/244 (22%)

Query: 243 ALSWSPDGELIITSVENGELRLWNKD-GRLQNVFNFHRSPI--VSIKWNEDSKHFISLDL 299
           AL ++ +G L+  S +   +R+WN   G+  +VF  H S +  + I  +E  K+ ++   
Sbjct: 414 ALKYAGNGILVSGSTDR-SVRIWNIHLGKCTHVFKGHTSTVRCLDIVEHEGVKYIVTGSR 472

Query: 300 DNITILWN-----------------AINGIILQHFEPEQKLENNTESLGV------DIEW 336
           DN   +W                  + NG +  H  PE+    N   +GV       +  
Sbjct: 473 DNTLHIWKLPQMSDSNIDEGMPNVYSNNGPLFFH-SPEE----NPYFVGVLRGHIASVRT 527

Query: 337 VD-KDKLVVPG-VNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSI 394
           V    ++V+ G  + +++V+ I   K +  L+GH   I    ++      +++S  D +I
Sbjct: 528 VSGHGRIVISGSYDNNLIVWDIIQMKCLYILMGHTDRIYSTIYDYKRNRCISAS-MDSTI 586

Query: 395 RIW-------HGQKENCCNC-------------FYGHSQSIISLSWINDDLVISASMDGS 434
           +IW       +G+  N  N                GH+ +++ L  ++D  ++SA+ DGS
Sbjct: 587 KIWDLQNIWNNGECVNVTNATVPCTKITGPMMTLQGHT-ALVGLLKLSDKFLVSAAADGS 645

Query: 435 VRIW 438
           +R W
Sbjct: 646 LRGW 649

 Score = 29.3 bits (64), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 34/172 (19%), Positives = 71/172 (41%), Gaps = 32/172 (18%)

Query: 342 LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEF--NVNSRLLLTSSDSDYSIRIW-- 397
           LV    + S+ +++I   K      GH  T+ C++   +   + ++T S  D ++ IW  
Sbjct: 423 LVSGSTDRSVRIWNIHLGKCTHVFKGHTSTVRCLDIVEHEGVKYIVTGS-RDNTLHIWKL 481

Query: 398 ------------------------HGQKENC--CNCFYGHSQSIISLSWINDDLVISASM 431
                                   H  +EN        GH  S+ ++S  +  +VIS S 
Sbjct: 482 PQMSDSNIDEGMPNVYSNNGPLFFHSPEENPYFVGVLRGHIASVRTVSG-HGRIVISGSY 540

Query: 432 DGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIK 483
           D ++ +W +++   + + M   + I      + +N+    SM+  I ++D++
Sbjct: 541 DNNLIVWDIIQMKCLYILMGHTDRIYSTIYDYKRNRCISASMDSTIKIWDLQ 592

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/254 (21%), Positives = 106/254 (41%), Gaps = 50/254 (19%)

Query: 238 TNQITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFIS 296
           T+++TALS  P    +++  ++  +R W+ + G+     +   + +++   N        
Sbjct: 502 TDEVTALSLDP--SFLVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTN-------- 551

Query: 297 LDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSI 356
           +DL   T+L                   N   S+G  ++  D   L     +G + ++ +
Sbjct: 552 VDLSKSTLLTQ----------------RNERPSIGA-LQSFDA-ALATGTKDGVVRLWDL 593

Query: 357 DDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSII 416
              K I  L GH   I+ ++F+  S  L+T S  D ++RIW   +    N F+ +S  ++
Sbjct: 594 RSGKVIRTLKGHTDAITSLKFD--SACLVTGS-YDRTVRIWD-LRTGLLNKFHAYSAPVL 649

Query: 417 SLSWINDDLVISASMDGSVRI--------WSVVENCLVGMAMVDGNAIICGKISHDKNKF 468
           SL    ++  +  + + SV+I        WS VE          GN      + + +N  
Sbjct: 650 SLDLFQENAAVVVADEPSVQIYDSEKDESWSCVEQ---------GNETSVSTVKYKENYM 700

Query: 469 AIGSMNGQINVYDI 482
             G  NG +N++ +
Sbjct: 701 VEGRENGDVNIWAV 714

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/110 (21%), Positives = 53/110 (48%), Gaps = 21/110 (19%)

Query: 350 SILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW--------HGQK 401
           ++ ++ +     IG+L GH  TI+C++ N +   L+T    D ++++W        + + 
Sbjct: 422 TVKIWDLSKQNKIGELAGHLATINCMQINRDYGTLVTGG-RDAALKLWNLNLAQQLYQET 480

Query: 402 EN-----------CCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV 440
           +N           C + F  H+  + +LS ++   ++S S D ++R W +
Sbjct: 481 QNLTSPTNHIDSPCVHTFEAHTDEVTALS-LDPSFLVSGSQDRTIRQWDL 529

 Score = 37.0 bits (84), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 44/82 (53%), Gaps = 4/82 (4%)

Query: 362 IGKLLG-HQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW 420
           IG ++  H   ++C++F+     L T+   D++++IW   K+N      GH  +I  +  
Sbjct: 390 IGSIMSTHDDFLTCLDFDAPFGTLCTAGYLDHTVKIWDLSKQNKIGELAGHLATINCMQ- 448

Query: 421 INDDL--VISASMDGSVRIWSV 440
           IN D   +++   D ++++W++
Sbjct: 449 INRDYGTLVTGGRDAALKLWNL 470

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 115/294 (39%), Gaps = 57/294 (19%)

Query: 241 ITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDL 299
           I ++ +SPDG+ + T  E+  +R+W+    ++      H   I S+ +       +S   
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSG 414

Query: 300 DNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDD- 358
           D    +W+               L     SL + IE       V PG    I   S+D  
Sbjct: 415 DRTVRIWD---------------LRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRT 459

Query: 359 ----NKPIGKLL-----------GHQGTISCIEFNVNSRLLLTSSDSDYSIRIW-----H 398
               +   G L+           GH+ ++  + F  + + +++ S  D S+++W     +
Sbjct: 460 VRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGS-LDRSVKLWDLRGLN 518

Query: 399 GQKEN--CCNCFYGHSQSIISLSWINDD-LVISASMDGSVRIWSVV-----------ENC 444
           GQK +  C   + GH   ++S++   DD  ++S S D  V  W               N 
Sbjct: 519 GQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNS 578

Query: 445 LVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIKRFVSRLLKRDKKQEL 498
           ++ +A+V+G       +  D   FA GS + +  ++   +  +      K QEL
Sbjct: 579 VISVAVVNGF-----PLGPDVGVFATGSGDCKARIWKYTKKSNPTATGAKLQEL 627

>Scas_397.2
          Length = 410

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 76/177 (42%), Gaps = 21/177 (11%)

Query: 198 AYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQITALSWSPDGELIITSV 257
           A+ + + +A  I  N+E    +   +  H +          ++IT L + P GE++++  
Sbjct: 102 AFARANDVASYIVGNEEGSISLYDSQFSHEWTQEDA---HCSEITTLKFFPSGEVVLSGS 158

Query: 258 ENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQH 316
            + +L+LW+ KD     +F  H S I      E  + F+S  LD    LW   +G  ++ 
Sbjct: 159 SDMQLKLWSIKDASCPRIFRGHTSKITDSVLIERGRDFVSSSLDGTMKLWECGSGSTVRT 218

Query: 317 FEPEQKLENNTESL----------------GVDIEWVDKDKLVVPG-VNGSILVYSI 356
           F   +   +   S+                G ++++  + K VV G V+G I ++ I
Sbjct: 219 FMRRENPNDGINSMALIADSNTTTIDTTTKGSNLDFGTQGKKVVAGHVSGVITIHDI 275

 Score = 36.6 bits (83), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 51/114 (44%), Gaps = 2/114 (1%)

Query: 338 DKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           D    +V    GSI +Y    +    +   H   I+ ++F  +  ++L+ S SD  +++W
Sbjct: 108 DVASYIVGNEEGSISLYDSQFSHEWTQEDAHCSEITTLKFFPSGEVVLSGS-SDMQLKLW 166

Query: 398 HGQKENCCNCFYGHSQSIISLSWINDDL-VISASMDGSVRIWSVVENCLVGMAM 450
             +  +C   F GH+  I     I      +S+S+DG++++W       V   M
Sbjct: 167 SIKDASCPRIFRGHTSKITDSVLIERGRDFVSSSLDGTMKLWECGSGSTVRTFM 220

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 72/162 (44%), Gaps = 14/162 (8%)

Query: 244 LSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNIT 303
           L WSPDG+ I T+ ++  + + +    L + F  H +P++S+ +N       +  +D   
Sbjct: 61  LCWSPDGQCIATASDDFSVEIIHLSYGLLHTFIGHTAPVISLTFNRKGNLLFTSSMDESI 120

Query: 304 ILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIG 363
            +W+ +NG +++      +       + VD+   D   L     +G I ++  +    + 
Sbjct: 121 KIWDTLNGSLMKTISAHSE-----AVVSVDVPMNDSSILSSGSYDGLIRIFDAETGHCLK 175

Query: 364 KLLGHQG--------TISCIEFNVNSRLLLTSSDSDYSIRIW 397
            L   +          IS ++F+ N+R LL  S  D  ++IW
Sbjct: 176 TLTYDKDWKRENGVVPISQVKFSENARYLLVKS-LDGVVKIW 216

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 3/76 (3%)

Query: 365 LLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW-IND 423
            +GH   +  + FN    LL TSS  D SI+IW     +       HS++++S+   +ND
Sbjct: 92  FIGHTAPVISLTFNRKGNLLFTSS-MDESIKIWDTLNGSLMKTISAHSEAVVSVDVPMND 150

Query: 424 DLVISA-SMDGSVRIW 438
             ++S+ S DG +RI+
Sbjct: 151 SSILSSGSYDGLIRIF 166

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 7/60 (11%)

Query: 252 LIITSVENGELRLWNKDGR-----LQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILW 306
           L+I+  ENG++  WN D +     L      H SP++SI    +     SL L+    LW
Sbjct: 255 LVISGYENGDIYCWNSDTKSLLQLLDGSLYHHSSPVMSIHCFGNI--MCSLALNGDCCLW 312

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 77/165 (46%), Gaps = 13/165 (7%)

Query: 242 TALSWSPD-GELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLD 298
           TAL + P  G LI++   +  +++W+   D      F  H  PI ++++ ED + F+S  
Sbjct: 166 TALKFLPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKALRFTEDCQSFLSSS 225

Query: 299 LDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYS--I 356
            D    +W+   G +      + +L  N+    V+    +  + +V   N  IL Y   +
Sbjct: 226 FDRSVKIWDTETGKV------KTRLHLNSTPADVESRPTNPHEFIVGLSNSKILHYDDRV 279

Query: 357 DDNKPIGKLLGHQ-GTISCIEFNVNSRLLLTSSDSDYSIRIWHGQ 400
            +N+ + +   H   +I  +++  +    ++SS+ D ++RIW  Q
Sbjct: 280 SENQGLVQTYDHHLSSILALKYFPDGSKFISSSE-DKTVRIWENQ 323

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 56/124 (45%), Gaps = 2/124 (1%)

Query: 360 KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKE-NCCNCFYGHSQSIISL 418
           K I    GH    + ++F   +  L+ S  +D++I+IW    +  C   F GH++ I +L
Sbjct: 153 KVIRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKAL 212

Query: 419 SWIND-DLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQI 477
            +  D    +S+S D SV+IW      +     ++           + ++F +G  N +I
Sbjct: 213 RFTEDCQSFLSSSFDRSVKIWDTETGKVKTRLHLNSTPADVESRPTNPHEFIVGLSNSKI 272

Query: 478 NVYD 481
             YD
Sbjct: 273 LHYD 276

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/257 (19%), Positives = 111/257 (43%), Gaps = 28/257 (10%)

Query: 201 QEDSMAKMIEYNKEDKKIISSLELR---------HPFALSSITGRKTNQITALSWSPDGE 251
             DS    +E   + K + ++  L          +P  +SS  G K N +T++++  +  
Sbjct: 30  HADSQVNRLEITSDKKYLAAAGHLHVRLYDIRSNNPNPVSSFEGHKGN-VTSIAFQQENR 88

Query: 252 LIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAIN 310
            +++S E+G +++W+ +   +Q  +  H +P+  +  + +    IS D D    +W+   
Sbjct: 89  WMVSSSEDGTIKVWDVRSPSVQRNYK-HNAPVNEVAIHPNQGELISCDQDGNIRIWDLGE 147

Query: 311 GIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVN-GSILVYSIDDN------KPIG 363
                   PE      + S+  D        ++V G N G+  V+ +  +      +P+ 
Sbjct: 148 NQCTNQLTPEDNTPLQSLSVASD------GSMLVAGNNKGNCYVWKMPHHTDASTLEPVT 201

Query: 364 KLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKE-NCCNCFYGHSQSIISLSWIN 422
           K   H   I+ +  + + + L T S +D++ R+W+ +          GH + +   ++  
Sbjct: 202 KFKSHTKYITRVLLSADVKHLATCS-ADHTARVWNIEDNFELETTLDGHQRWVWDCAFSA 260

Query: 423 DD-LVISASMDGSVRIW 438
           D   +++A  D  VR+W
Sbjct: 261 DSAYLVTACSDHYVRLW 277

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 81/193 (41%), Gaps = 13/193 (6%)

Query: 294 FISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILV 353
             S   D+    W A+ G+  +  +      N  E         DK  L   G +  + +
Sbjct: 5   LASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITS------DKKYLAAAG-HLHVRL 57

Query: 354 YSIDDNKP--IGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGH 411
           Y I  N P  +    GH+G ++ I F   +R +++SS+ D +I++W   +       Y H
Sbjct: 58  YDIRSNNPNPVSSFEGHKGNVTSIAFQQENRWMVSSSE-DGTIKVW-DVRSPSVQRNYKH 115

Query: 412 SQSIISLS-WINDDLVISASMDGSVRIWSVVEN-CLVGMAMVDGNAIICGKISHDKNKFA 469
           +  +  ++   N   +IS   DG++RIW + EN C   +   D   +    ++ D +   
Sbjct: 116 NAPVNEVAIHPNQGELISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVASDGSMLV 175

Query: 470 IGSMNGQINVYDI 482
            G+  G   V+ +
Sbjct: 176 AGNNKGNCYVWKM 188

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 49/263 (18%), Positives = 113/263 (42%), Gaps = 16/263 (6%)

Query: 227 PFALSSITGRKTNQ-ITALSWSPDGELIITSVENGELRLWNKDG-RLQNVFNFHRSPIVS 284
           P   + ++  K    I A++W+P+G  ++ +  +GE  LWN      +++   H S +  
Sbjct: 67  PTKFTHLSSNKVKHVIPAITWTPEGRRLVVATYSGEFSLWNGSSFNFESIMQAHDSAVTV 126

Query: 285 IKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVV 344
           ++++      IS D D    +W         +F   + L+        DI +   D+  V
Sbjct: 127 MQYSHAGDWLISGDADGTIKIWQP-------NFNMVKVLDRAHTECMRDISFSYSDQKFV 179

Query: 345 PGVNGSIL-VYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKEN 403
              + ++L +++  + +    L GH   +   +++    L+++ S  D  I++W  +   
Sbjct: 180 TCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMGLIVSGS-KDNLIKLWDPRTGR 238

Query: 404 CCNCFYGHSQSIISLSW--INDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKI 461
             +   G   ++I   +     +L+   S D S++I+ + ++ +  +  +  +       
Sbjct: 239 NVSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDMRQH-MRELQTIRDDMDYMSLS 297

Query: 462 SHDKNK--FAIGSMNGQINVYDI 482
            H  N+  F++G  NG I  +D+
Sbjct: 298 WHPINETIFSVGCYNGAIKHFDL 320

 Score = 29.6 bits (65), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/96 (19%), Positives = 44/96 (45%), Gaps = 10/96 (10%)

Query: 174 LNEVQTL--DNKVVTSSWNLQNERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALS 231
           + E+QT+  D   ++ SW+  NE + + G  +   K  +   ++             A  
Sbjct: 281 MRELQTIRDDMDYMSLSWHPINETIFSVGCYNGAIKHFDLLHDNSNSTP--------ACH 332

Query: 232 SITGRKTNQITALSWSPDGELIITSVENGELRLWNK 267
           +I       +T+L++SP G ++ ++ ++  +R W +
Sbjct: 333 TIPYAHEKSVTSLAYSPVGHILASAAKDRTIRFWAR 368

>Scas_704.40
          Length = 608

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 76/166 (45%), Gaps = 9/166 (5%)

Query: 342 LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK 401
           L     + ++ ++ +  NK I +L GH   +  + F+      L +   D +IR+W+ + 
Sbjct: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD---EAKLVTGSLDKTIRVWNYKT 322

Query: 402 ENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV-VENCLVGMAMVDGNAIICGK 460
             C + + GH+ S++S+      +++S S D +V+IW V    C       +   + C K
Sbjct: 323 GECISTYRGHTDSVMSVDAFK-KIIVSGSADKTVKIWHVESRTCYTLRGHTEW--VNCVK 379

Query: 461 ISHDKNKFAIGSMNGQINVYDIKRFVSRLLKRDKKQEL--VVPITI 504
           +         GS +  I ++DI+      + R    ++  V+P+TI
Sbjct: 380 LHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTI 425

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/189 (20%), Positives = 83/189 (43%), Gaps = 28/189 (14%)

Query: 265 WNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLE 324
           W K       F  H   ++++++N   +   +   D+   +W+  +  +++      +L 
Sbjct: 239 WRKGNCQVQEFKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIR------RLS 290

Query: 325 NNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLL 384
            +T+  GV   + D+ KLV   ++ +I V++    + I    GH  ++  ++     + +
Sbjct: 291 GHTD--GVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD---AFKKI 345

Query: 385 LTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIN-------DDLVISASMDGSVRI 437
           + S  +D +++IWH +   C     GH++      W+N            S S D ++R+
Sbjct: 346 IVSGSADKTVKIWHVESRTCYT-LRGHTE------WVNCVKLHPKSFTCFSGSDDTTIRM 398

Query: 438 WSVVEN-CL 445
           W +  N CL
Sbjct: 399 WDIRTNSCL 407

 Score = 36.2 bits (82), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 71/150 (47%), Gaps = 17/150 (11%)

Query: 290 DSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTES-LGVDIEWVDKDKLVVPG-V 347
           D    ++  LD    +WN   G  +  +        +T+S + VD       K++V G  
Sbjct: 302 DEAKLVTGSLDKTIRVWNYKTGECISTYR------GHTDSVMSVDAF----KKIIVSGSA 351

Query: 348 NGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNC 407
           + ++ ++ ++ ++    L GH   ++C++ +  S    + SD D +IR+W  +  +C   
Sbjct: 352 DKTVKIWHVE-SRTCYTLRGHTEWVNCVKLHPKSFTCFSGSD-DTTIRMWDIRTNSCLKV 409

Query: 408 FYGH---SQSIISLSWINDDLVISASMDGS 434
           F GH    Q +I L+ I+ + ++  ++ GS
Sbjct: 410 FRGHVGQVQKVIPLTIIDAENLVVDNISGS 439

 Score = 33.5 bits (75), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 385 LTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV 440
           L S   D +I++W  Q   C    +GH + +  ++  ++  +IS S DGS++IW +
Sbjct: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA-ADNFRIISGSHDGSIKIWDL 534

>Scas_605.18
          Length = 424

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/226 (19%), Positives = 84/226 (37%), Gaps = 35/226 (15%)

Query: 278 HRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWV 337
           H + I   +W+ DSK  +S   D   ++W+  +G+                ++ +D +WV
Sbjct: 90  HNNKISDFRWSRDSKSILSASQDGFMLIWDTASGL-------------KRNAIPLDSQWV 136

Query: 338 DKDKL-------VVPGVNGSILVYSIDDNKPIGK-----LLGHQGTISCIEFNVNSRLLL 385
               L          G+N +  +Y +     + +       GH   IS IEF  NS ++ 
Sbjct: 137 LSCALSPSGNLAASAGLNNNCTIYRVSKENRVQQNVVSIFKGHTCYISDIEFLDNSHII- 195

Query: 386 TSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW--------INDDLVISASMDGSVRI 437
            +S  D +  +W   K      +  H   +++L+            ++  S   DG   I
Sbjct: 196 -TSSGDMTCALWDIPKAKRVREYADHLGDVLALALPPPSADENTGANIFASCGSDGYTYI 254

Query: 438 WSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIK 483
           W    +  V         +   +   D N    G  +G IN++D++
Sbjct: 255 WDTRTSAAVQKFFASDTDVNAIQFFKDGNSIVTGGDDGVINMFDLR 300

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 36/224 (16%), Positives = 87/224 (38%), Gaps = 24/224 (10%)

Query: 239 NQITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISL 297
           N+I+   WS D + I+++ ++G + +W+   G  +N        ++S   +       S 
Sbjct: 92  NKISDFRWSRDSKSILSASQDGFMLIWDTASGLKRNAIPLDSQWVLSCALSPSGNLAASA 151

Query: 298 DLDNITILWNAINGIILQHFEPEQKLENNTESLG-------VDIEWVDKDKLVVPGVNGS 350
            L+N   ++             E +++ N  S+         DIE++D   ++    + +
Sbjct: 152 GLNNNCTIY---------RVSKENRVQQNVVSIFKGHTCYISDIEFLDNSHIITSSGDMT 202

Query: 351 ILVYSIDDNKPIGKLLGHQGTISCIEFNVNS------RLLLTSSDSDYSIRIWHGQKENC 404
             ++ I   K + +   H G +  +     S        +  S  SD    IW  +    
Sbjct: 203 CALWDIPKAKRVREYADHLGDVLALALPPPSADENTGANIFASCGSDGYTYIWDTRTSAA 262

Query: 405 CNCFYGHSQSIISLSWIND-DLVISASMDGSVRIWSVVENCLVG 447
              F+     + ++ +  D + +++   DG + ++ +  +C + 
Sbjct: 263 VQKFFASDTDVNAIQFFKDGNSIVTGGDDGVINMFDLRSDCAIA 306

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 38/94 (40%), Gaps = 8/94 (8%)

Query: 410 GHSQSIISLSWINDDL-VISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKF 468
           GH+  I    W  D   ++SAS DG + IW            +D   ++   +S   N  
Sbjct: 89  GHNNKISDFRWSRDSKSILSASQDGFMLIWDTASGLKRNAIPLDSQWVLSCALSPSGNLA 148

Query: 469 AIGSMNGQINVYDIKRFVSRLLKRDKKQELVVPI 502
           A   +N    +Y       R+ K ++ Q+ VV I
Sbjct: 149 ASAGLNNNCTIY-------RVSKENRVQQNVVSI 175

>Scas_711.11
          Length = 695

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 62/148 (41%), Gaps = 17/148 (11%)

Query: 370 GTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISA 429
           G + C +        L +   D  +R+W  +         GHS SI  L + N ++V + 
Sbjct: 543 GALQCFD------AALATGTRDGIVRLWDLRAGKVVRALEGHSGSITCLKFDNKNIV-TG 595

Query: 430 SMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIKRFVSRL 489
           S+D +VRIW +    L  M   +   +    +  DKNK AI + +    VYD  R ++ L
Sbjct: 596 SIDKTVRIWDLRSGILSDMLTFEKPVL---SVDFDKNKIAIATHDEACKVYD--RQLNNL 650

Query: 490 LKRDKKQEL-----VVPITIPLYGSYQN 512
                  E       +P++     SYQN
Sbjct: 651 QTCTSTDEASTSDPTIPVSTVETMSYQN 678

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 51/118 (43%), Gaps = 27/118 (22%)

Query: 351 ILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH------------ 398
           I ++ +  +K IG++ GH  T++C++   N   +L S   D  +++W+            
Sbjct: 397 IKIWDLSRSKQIGRMTGHVATVNCMQITNN---MLVSGGKDALLKLWNLNVGVQSFRNVL 453

Query: 399 ----------GQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVVEN-CL 445
                         +C + F  H   I S++   ++L IS S D ++R W +    CL
Sbjct: 454 PTNNSNLEPISSSASCIHTFDSHVDEITSVTVAGENL-ISGSQDRTIRQWDIPSGKCL 510

 Score = 36.2 bits (82), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 16/74 (21%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLV 426
            H   I+C++F++    L T+   D+ I+IW   +        GH  ++  +  I ++++
Sbjct: 370 AHDDNITCLDFDLPFGTLCTAGHLDHVIKIWDLSRSKQIGRMTGHVATVNCMQ-ITNNML 428

Query: 427 ISASMDGSVRIWSV 440
           +S   D  +++W++
Sbjct: 429 VSGGKDALLKLWNL 442

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 348 NGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           +G + ++ +   K +  L GH G+I+C++F  +++ ++T S  D ++RIW
Sbjct: 558 DGIVRLWDLRAGKVVRALEGHSGSITCLKF--DNKNIVTGS-IDKTVRIW 604

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 56/256 (21%), Positives = 108/256 (42%), Gaps = 28/256 (10%)

Query: 241 ITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDL 299
           I ++ +SPDG+ + T  E+  +R+W+ +  ++  V   H   I S+ +       +S   
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSG 617

Query: 300 DNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDK---DKLV-VPGVNGSILVYS 355
           D    +W+   G        E  +     S G D +++     D+ V V   +   LV  
Sbjct: 618 DRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPG-DGKFIAAGSLDRAVRVWDSDTGFLVER 676

Query: 356 IDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKEN------------ 403
           +D    +G   GH+ ++  + F  +   +++ S  D S+++W+ +  N            
Sbjct: 677 LDSENELG--TGHKDSVYSVVFTRDGNGVVSGS-LDRSVKLWNLRNVNHNNADGKPTSGT 733

Query: 404 CCNCFYGHSQSIISLSWINDD-LVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKIS 462
           C   + GH   ++S++   DD  ++S S D  V  W  V    + M     N++I   ++
Sbjct: 734 CEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLLMLQGHRNSVISVAVN 793

Query: 463 H------DKNKFAIGS 472
           H      + + FA GS
Sbjct: 794 HGHPLGPNYHIFATGS 809

>Kwal_23.6429
          Length = 750

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 56/277 (20%), Positives = 106/277 (38%), Gaps = 40/277 (14%)

Query: 241 ITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDL 299
           I ++ +SPDG+ + T  E+  +R+W+    R+      H   I S+ +       +S   
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 532

Query: 300 DNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPG----------VNG 349
           D    +W+   G        E  +     S G         KL+  G             
Sbjct: 533 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPG-------DGKLIAAGSLDRTVRIWDSET 585

Query: 350 SILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH------GQKEN 403
             LV  +D    +G   GH+ ++  + F  +   +++ S  D S+++W+      G  E 
Sbjct: 586 GFLVERLDSENELGT--GHKDSVYSVVFTRDGHGVVSGS-LDRSVKLWNLRSANGGTAEG 642

Query: 404 CCN------CFYGHSQSIISLSWI-NDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAI 456
             N       + GH   ++S++   ND+ ++S S D  V  W       + M     N++
Sbjct: 643 KANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSV 702

Query: 457 ICGKISHDK------NKFAIGSMNGQINVYDIKRFVS 487
           I   +++D         FA GS + +  ++   +  S
Sbjct: 703 ISVAVANDHPLGPEYGVFATGSGDCKARIWKYSKQTS 739

>YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Protein
           containing seven WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to WD40 protein Ciao1 (human CIAO1), which
           binds and inhibits Wilms tumor suppressor protein (human
           WT1) transactivation activity [993 bp, 330 aa]
          Length = 330

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 53/264 (20%), Positives = 109/264 (41%), Gaps = 18/264 (6%)

Query: 193 NERLLAYGQEDSMAKMIEYNKEDKKIISSL-ELRHPFALSSITGRKTNQITALSWSPDGE 251
           ++ +LA G  D   K++    +D  +I  L E  H  A+ S+  R    + A   S D  
Sbjct: 23  SQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAG-SFDST 81

Query: 252 LIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAING 311
           + I + E    R +  D  L  +   H + +  + W+ D  +  +   D    +W     
Sbjct: 82  VSIWAKEESADRTFEMD--LLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDES 139

Query: 312 IILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSI--DDNKPIGKLLGHQ 369
              + +E    L+ +++ +   I    +  L     + ++ ++    DD + +  L GH+
Sbjct: 140 --GEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHE 197

Query: 370 GTISCIEFNVNSRLL-LTSSDSDYSIRIWH-------GQKENCCNCFYG--HSQSIISLS 419
           GT+   +F+    +  L S   D ++R+W         Q+E  C       H + + +++
Sbjct: 198 GTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVA 257

Query: 420 WINDDLVISASMDGSVRIWSVVEN 443
           W  + L+ S   DG + ++  V+ 
Sbjct: 258 WGFNGLIASVGADGVLAVYEEVDG 281

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 85/188 (45%), Gaps = 26/188 (13%)

Query: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH----GQKENCCNCFYGHSQSIISLSW-I 421
           GH+  +  + ++ +   L T S  D S+ IW     G++  C +    HSQ +  + W  
Sbjct: 105 GHENEVKGVAWSNDGYYLATCS-RDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHP 163

Query: 422 NDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKN----KFAIGSMNGQI 477
           ++ L+ S+S D +VRIW   ++    +A+++G+         DK     +   GS +  +
Sbjct: 164 SEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTV 223

Query: 478 NVYDIKRFVSRLLKRDKKQELVVPITIPLYGSYQNEKIDDCIFDISWNKSNDLITVANSI 537
            V+   +++      D +QE V    +P     Q       +++++W   N LI    S+
Sbjct: 224 RVW---KYMGD--DEDDQQEWVCEAILPDVHKRQ-------VYNVAWG-FNGLIA---SV 267

Query: 538 GEGSIIAI 545
           G   ++A+
Sbjct: 268 GADGVLAV 275

>Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement
          Length = 1261

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 80/352 (22%), Positives = 147/352 (41%), Gaps = 55/352 (15%)

Query: 183 KVVTSSWNLQNERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQIT 242
           +  T +W+     LLA G         +++ E     S+LEL     LS+   +    IT
Sbjct: 9   RTATFAWSHDKVPLLATGTASGTVDA-DFSSE-----STLELWS--LLSADVEKPQGSIT 60

Query: 243 A------LSWSPDGELIITSVENGELRLWNKDGRLQNVFNF--HRSPIVSIKWNEDSKHF 294
           A      L WSPD  ++  +++NG +  ++    L++V     H +P+ ++K+N    + 
Sbjct: 61  ASAKFNDLDWSPDNSILAGALDNGIVEFFSPK-ELKSVAKISKHTTPVNTLKFNAKQDNV 119

Query: 295 I-SLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDK-----------DKL 342
           + S D      +W+ IN I    + P         S GV +  +D+              
Sbjct: 120 LCSGDSRGEIFIWD-INKITSSGYVP--------FSPGVAMTPIDEVYSLAWNQSLAHVF 170

Query: 343 VVPGVNGSILVYSIDDNKPIGKL------LGHQGTISCIEFNV-NSRLLLTSS--DSDYS 393
              G +G   ++ +   K +  L       G +  +S +E++  NS  + T++  D+D  
Sbjct: 171 ASAGSSGYTSIWDLKAKKEVLHLSYTSPSTGAKNHLSVVEWHPSNSTKIATATGNDNDPV 230

Query: 394 IRIW--HGQKENCCNCFYGHSQSIISLSWINDD--LVISASMDGSVRIWSVVENCLVGMA 449
           I +W     K        GHS+ I+SL W   D  L++S+  D +  +W+      +   
Sbjct: 231 ILVWDLRNAKAPLQAMSQGHSKGILSLDWCKQDENLLLSSGRDNTCALWNPQTAQKLSQF 290

Query: 450 MVDGNAIICGKISHD-KNKFAIGSMNGQINVYDIKRFVSRLLKRD---KKQE 497
              GN     K + +  + FA  S++ +I V  ++   ++L   D   K+QE
Sbjct: 291 PTRGNWCFKTKFAPEAPDLFASASLDNKIQVQTLQNLTNKLDLEDIVSKQQE 342

>Kwal_23.4118
          Length = 939

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 48/226 (21%), Positives = 99/226 (43%), Gaps = 30/226 (13%)

Query: 251 ELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKH-----FISLD------- 298
           E++  ++EN       + G  +N+   H+    +  W+  +K      F ++D       
Sbjct: 414 EILCMAIENA------RQGEWENILTAHKDEKFARSWDLATKRVGRWTFPTIDEGLAKSV 467

Query: 299 ----LDNITILWNAINGII---LQHFEPEQKLENNTESL-GVDIEWVDKDKLVVPGVNGS 350
                 N   + ++  GI    LQ   P +K   + +++ G+ ++ +++ K+V  G++G 
Sbjct: 468 AISPCGNFGFVGSSNGGIGVYNLQSGLPRKKYRLHKKAVSGIAVDGMNR-KMVSCGLDGI 526

Query: 351 ILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYG 410
           +  Y    +  +GKL      ++ + ++ +S L   + D D+SI +     +      +G
Sbjct: 527 VGFYDFSKSSYLGKL-QLDAPVTSMVYHRSSDLFALALD-DFSIVVVDAVTQKVVRQLWG 584

Query: 411 HSQSIISLSWINDDL-VISASMDGSVRIWSVVENCLVGMAMVDGNA 455
           HS  I S  +  D   +IS S+DG+ R W +   C +    +D  A
Sbjct: 585 HSNRISSFDFSPDGRWIISTSLDGTARTWDLPTGCCIDGIRLDSVA 630

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 70/166 (42%), Gaps = 16/166 (9%)

Query: 278 HRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESL-GV---D 333
           H   I +I  + +   F +   D    +WN   G      E E  L N+   L GV   +
Sbjct: 487 HEKDINAISMSPNDSIFATASYDKTCKIWNVDTG------EVEATLANHKRGLWGVAFCE 540

Query: 334 IEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYS 393
            +W+    L     + SI ++S++    +  L GH   +  + F +N    L S+ +D  
Sbjct: 541 YDWL----LATCSGDRSINLWSLESFTVLKTLEGHTNAVQRVSF-INGNKQLVSTGADGL 595

Query: 394 IRIWHGQKENCCNCFYGHSQSIISLSWIND-DLVISASMDGSVRIW 438
           ++IW      C      H+  I +L+  ND  L+I+A  DG  + W
Sbjct: 596 VKIWDCSTGECVRTLDAHNNRIWALAVANDGQLIITADADGVFQFW 641

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 87/206 (42%), Gaps = 20/206 (9%)

Query: 222 LELRHPFALSSITGRKTNQITALSWSPDGELIITSVEN--GELRLWNKDGRLQNVFNFHR 279
           ++L+  F   ++     N     S + DG L+ T V +    +RL      +  + N   
Sbjct: 1   MDLKTTFLNRTLAPFYANSGAVASVTGDGSLLATCVLDDINIVRLEEPHAIIHKIENEDE 60

Query: 280 SPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDK 339
             + +++   D ++           L  A    +L+ ++ E K    +  +      +D 
Sbjct: 61  QDVTALRLTPDGRY-----------LCYASQNQLLRFYDLETKRTTRSMKISSPAYVLDC 109

Query: 340 DK----LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEF--NVNSRL-LLTSSDSDY 392
           D+    L V G +GS+ V+ I +      L GH  TIS ++F   V+S + LL S D++ 
Sbjct: 110 DESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNG 169

Query: 393 SIRIWHGQKENCCNCFYGHSQSIISL 418
            ++IW   K  C +    H+ ++  L
Sbjct: 170 MVKIWDLVKRRCIHTVQEHTAAVRGL 195

>KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 852

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 71/321 (22%), Positives = 133/321 (41%), Gaps = 54/321 (16%)

Query: 194 ERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPF-------ALSSITGRKTNQIT---- 242
           +R L  G+   + +  +  K+ +++I + ELR PF       + S+  G  T  +     
Sbjct: 70  KRHLKTGEHMKVYRKKKGFKQFRRLILAQELR-PFGNEFQDSSSSNEKGTATEPMKNGGA 128

Query: 243 --ALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLD 300
              + +S DG+ + T+ ++  LR+W              SP   ++ N+ S  F+    +
Sbjct: 129 VWCIRFSHDGKFMATAGKDEILRIWK----------VISSPAERLELNQHSISFLKSTAN 178

Query: 301 NITILWNAINGIILQHFEPEQKLENNTESLGVDIEWV-----DKDKLVVPGV-------- 347
            I+ L    NG + Q+         N+ S    ++ +     ++D      V        
Sbjct: 179 AISQL----NGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQT 234

Query: 348 NGSILVYSIDDN-------KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQ 400
            G    Y + D+        P+     H   I  I+++ NS +L  S D   S ++WH  
Sbjct: 235 QGHRHPYGLGDSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDK--SCKLWHCA 292

Query: 401 KENCCNCFYGHSQSIISLSWINDD--LVISASMDGSVRIWSVVENCLVGMAMVDGNAIIC 458
           +      F  HS  + ++ +  +D    +SA +D   R+WS++E  ++      G+ I  
Sbjct: 293 RPTSLKTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVI-FEYDCGDLITA 350

Query: 459 GKISHDKNKFAIGSMNGQINV 479
             IS+D N   +G+ NG I+V
Sbjct: 351 MDISYDGNYTILGTFNGYIHV 371

>Kwal_26.8776
          Length = 433

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/298 (18%), Positives = 125/298 (41%), Gaps = 17/298 (5%)

Query: 192 QNERLL--AYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQITALSWSP- 248
           Q+E L+   +G++DS   ++E +K+  ++    E   P+ L  +       +  +   P 
Sbjct: 75  QSESLVQKVFGEKDSFGSLMERHKQQLEL--QPEWHAPWKLMRVINGHNGWVRCVCPDPV 132

Query: 249 DGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWN 307
           D     T   +  +++W+   G+L+     H   + S+  ++      S   D +   W+
Sbjct: 133 DNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMTVRSVAVSQRHPLMFSASEDKMVKCWD 192

Query: 308 AINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLG 367
                 ++ +       N      VD+     D +   G +  + ++ I    P+  L G
Sbjct: 193 LERNAAIRDYHGHFSGVNT-----VDVH-PTLDLIASAGRDAVVRLWDIRTRLPVMTLAG 246

Query: 368 HQGTISCIE-FNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLV 426
           H+  I+ ++ F V+ +++  SSD+  ++R+W  +          HS+S+ +++    +  
Sbjct: 247 HKSPINQVKCFPVDPQIMSCSSDA--TVRLWDIRAGKATKILTHHSKSVRAIAAHPAESS 304

Query: 427 ISASMDGSVRIWSVVENCLVGMAMVDGNAIICG-KISHDKNKFAIGSMNGQINVYDIK 483
           ++ +    VR W   +  L+     +G  II    ++ D   F  G  +G ++ +D K
Sbjct: 305 VATASTSDVRSWRHSDGQLLTNYHSEGIGIINSLSVNADGVLFG-GGDDGNLSFFDYK 361

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 71/132 (53%), Gaps = 11/132 (8%)

Query: 351 ILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYG 410
           I VY  +++  + +L GH+G +  ++F V+ ++L++ S +D S+RIW+ +   C + F G
Sbjct: 282 INVYDAENDLFLLELNGHEGGVWALKF-VDGKILVSGS-TDRSVRIWNIETGKCTHVFKG 339

Query: 411 HSQSIISLSWI---NDDLVISASMDGSVRIWSVVENCLVGMAMVD-GNAIICGKISHDKN 466
           H+ ++  L  +   +   +++ S D ++ +W      L  M  +D G+       + ++N
Sbjct: 340 HTSTVRCLEVVEYGDSKYIVTGSRDNTLHVWK-----LPPMKELDKGSQEPIFYRTPEEN 394

Query: 467 KFAIGSMNGQIN 478
            + +G + G ++
Sbjct: 395 PYFVGVLRGHMS 406

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/285 (22%), Positives = 124/285 (43%), Gaps = 43/285 (15%)

Query: 249 DGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNE--DSKHFISLDLDNITIL 305
           DG+++++   +  +R+WN + G+  +VF  H S +  ++  E  DSK+ ++   DN   +
Sbjct: 310 DGKILVSGSTDRSVRIWNIETGKCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHV 369

Query: 306 WN--AINGIILQHFEP--EQKLENNTESLGV------DIEWVD-KDKLVVPG-VNGSILV 353
           W    +  +     EP   +  E N   +GV       +  V    ++V+ G  + +++V
Sbjct: 370 WKLPPMKELDKGSQEPIFYRTPEENPYFVGVLRGHMSSVRTVSGHGRIVISGSYDHNLMV 429

Query: 354 YSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCN------- 406
           + I   K +  L GH   +    ++      +++S  D ++ IW    EN  N       
Sbjct: 430 WDIISMKLLYILTGHTDRVYSTIYDYKRNRCISAS-MDTTVMIW--DLENIENNGTTTTI 486

Query: 407 -------------CFYGHSQSIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDG 453
                        C YGH+ +++ L  +++  ++SA+ DGS+R W    +     +    
Sbjct: 487 NDGASIKVVGSMKCLYGHT-ALVGLLCLSNKFLVSAAADGSIRGWD-PNDYSRKFSFHHT 544

Query: 454 NAIICGKISHDKNKFAIGSMNGQINVYDIK--RFVSRLLKRDKKQ 496
           N       S + N    GS   Q NVY+++  + + R L  D +Q
Sbjct: 545 NLAAITSFSMNDNILVSGSER-QFNVYNLRTGKLIHRKLLTDSEQ 588

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 84/184 (45%), Gaps = 25/184 (13%)

Query: 323 LENNTESLGV-DIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEF--NV 379
           LE N    GV  +++VD   LV    + S+ +++I+  K      GH  T+ C+E     
Sbjct: 294 LELNGHEGGVWALKFVDGKILVSGSTDRSVRIWNIETGKCTHVFKGHTSTVRCLEVVEYG 353

Query: 380 NSRLLLTSSDSDYSIRIWH---------GQKENCC------NCFY-----GHSQSIISLS 419
           +S+ ++T S  D ++ +W          G +E         N ++     GH  S+ ++S
Sbjct: 354 DSKYIVTGS-RDNTLHVWKLPPMKELDKGSQEPIFYRTPEENPYFVGVLRGHMSSVRTVS 412

Query: 420 WINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINV 479
             +  +VIS S D ++ +W ++   L+ +     + +      + +N+    SM+  + +
Sbjct: 413 G-HGRIVISGSYDHNLMVWDIISMKLLYILTGHTDRVYSTIYDYKRNRCISASMDTTVMI 471

Query: 480 YDIK 483
           +D++
Sbjct: 472 WDLE 475

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 46/87 (52%), Gaps = 6/87 (6%)

Query: 357 DDNKPIGK--LLGHQ-GTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQ 413
           D N   G+  L GH    ++C++F  N   ++T +D D  I ++  + +       GH  
Sbjct: 245 DPNYKPGRTCLDGHSTNVVTCLQFENN--YIITGAD-DKKINVYDAENDLFLLELNGHEG 301

Query: 414 SIISLSWINDDLVISASMDGSVRIWSV 440
            + +L +++  +++S S D SVRIW++
Sbjct: 302 GVWALKFVDGKILVSGSTDRSVRIWNI 328

>ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH]
           complement(353684..355888) [2205 bp, 734 aa]
          Length = 734

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 62/128 (48%), Gaps = 7/128 (5%)

Query: 353 VYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCF-YGH 411
           V+  D ++  G+ L  Q  + C +++ NS LL  S D   ++++WH  +      F +  
Sbjct: 201 VFHPDPHRVFGEHL--QDILDC-DWSKNSFLLTASMDK--TVKLWHINRTTSLKTFVHPD 255

Query: 412 SQSIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIG 471
             + +     +D    S  +D +VR WS++E   V  A   G+ I+   +S D N   IG
Sbjct: 256 FVTCVRFHPHDDRFFFSGCLDHTVRTWSILEG-EVAEAFNCGDLIMALDVSPDGNWLLIG 314

Query: 472 SMNGQINV 479
           + NG ++V
Sbjct: 315 TFNGYVHV 322

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 35/76 (46%), Gaps = 2/76 (2%)

Query: 408 FYGHSQSIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKI-SHDKN 466
           F  H Q I+   W  +  +++ASMD +V++W +     +    V  + + C +   HD  
Sbjct: 210 FGEHLQDILDCDWSKNSFLLTASMDKTVKLWHINRTTSL-KTFVHPDFVTCVRFHPHDDR 268

Query: 467 KFAIGSMNGQINVYDI 482
            F  G ++  +  + I
Sbjct: 269 FFFSGCLDHTVRTWSI 284

>Kwal_23.5769
          Length = 627

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 77/168 (45%), Gaps = 13/168 (7%)

Query: 342 LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK 401
           L     + ++ ++ +   K + +L GH+  +  I F+   + L+T S  D  IR+W+   
Sbjct: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD--GQKLITGS-LDRMIRVWNYVT 386

Query: 402 ENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV-VENCLVGMAMVDGNAIICGK 460
             C   + GHS S++S+      +++S S D +V++W V    C      + G+    G 
Sbjct: 387 GACVAAYPGHSDSVLSVDSYK-KIIVSGSADKTVKVWHVESRTCYT----LRGHTEWVGT 441

Query: 461 ISHDKNKFAI--GSMNGQINVYDIKRFVSRLLKRDKKQEL--VVPITI 504
           +      F    GS +  I ++DI+      + R    ++  V+P+TI
Sbjct: 442 VKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTI 489

 Score = 32.7 bits (73), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 27/130 (20%), Positives = 55/130 (42%), Gaps = 6/130 (4%)

Query: 362 IGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWI 421
           I +  GH   +  ++FN   RLL T S  D ++ IW            GH   + ++ + 
Sbjct: 310 IQEFKGHMDGVLSLQFNY--RLLFTGS-YDSTVAIWDLATGKLVRRLTGHRDGVKAI-YF 365

Query: 422 NDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYD 481
           +   +I+ S+D  +R+W+ V    V       ++++   +   K     GS +  + V+ 
Sbjct: 366 DGQKLITGSLDRMIRVWNYVTGACVAAYPGHSDSVL--SVDSYKKIIVSGSADKTVKVWH 423

Query: 482 IKRFVSRLLK 491
           ++      L+
Sbjct: 424 VESRTCYTLR 433

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 32/191 (16%), Positives = 77/191 (40%), Gaps = 13/191 (6%)

Query: 251 ELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAIN 310
           ++I++   +  +++W+ + R       H   + ++K +  S    S   D    +W+  +
Sbjct: 408 KIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRS 467

Query: 311 GIILQHFEPEQKLENNTESLGV-DIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQ 369
              ++ F            L + D E +  D+   P  N +       D           
Sbjct: 468 NTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQDPPD----------- 516

Query: 370 GTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISA 429
           G +S ++ ++     L S   D +I++W  +   C    +GH + I  ++  ++  ++S 
Sbjct: 517 GQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIA-ADNFRIVSG 575

Query: 430 SMDGSVRIWSV 440
           + D +V++W +
Sbjct: 576 AHDKTVKVWDL 586

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/251 (18%), Positives = 107/251 (42%), Gaps = 17/251 (6%)

Query: 241 ITALSWSPDGELIITSVENGELRLWNKDG-RLQNVFNFHRSPIVSIKWNEDSKHFISLDL 299
           I AL+W+P+G  ++ +  NGE  LW+      +++   H S +  + ++      +S   
Sbjct: 84  IPALTWTPEGRRLVVATYNGEFSLWSGSSFNFESIMQAHDSAVTVMTYSHTGDWMVSGSA 143

Query: 300 DNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSIL-VYSIDD 358
           D    +W         +F   + ++        +I +   D+  V   + ++L +++  +
Sbjct: 144 DGELKIWQP-------NFNMVKVMDQAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSN 196

Query: 359 NKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISL 418
            +    L GH   +   +++    L+++ S  D  I+ W  +  +C +   G   +IIS 
Sbjct: 197 GQQERVLSGHHWDVKSCDWHPKMGLIVSGS-KDNLIKFWDPRSGSCVSTMLGFKHTIIST 255

Query: 419 SW--INDDLVISASMDGSVRIWSVVENCLVGMAM---VDGNAIICGKISHDKNKFAIGSM 473
            +     +L+   S D + +++ + +      ++   VD   +    I  D+  F +G  
Sbjct: 256 KFQPKQGNLLSVISKDKTCKVYDIRQQAKELFSVRDDVDYMTLQWHPI--DETVFTVGCY 313

Query: 474 NGQINVYDIKR 484
           +G I  +D+ +
Sbjct: 314 DGSIKHFDLSQ 324

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/263 (19%), Positives = 101/263 (38%), Gaps = 58/263 (22%)

Query: 228 FALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFN-FHRSPIVSIK 286
           F   SI     + +T +++S  G+ +++   +GEL++W  +  +  V +  H   +  I 
Sbjct: 113 FNFESIMQAHDSAVTVMTYSHTGDWMVSGSADGELKIWQPNFNMVKVMDQAHMECVREIS 172

Query: 287 WNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPG 346
           ++   + F+S   DN+  +WN  NG      + E+ L  +   +    +W  K  L+V G
Sbjct: 173 FSPTDQKFVSCSDDNVLKIWNFSNG------QQERVLSGHHWDVK-SCDWHPKMGLIVSG 225

Query: 347 VNGSIL-VYSIDDNKPIGKLLGHQGTI--------------------SCIEFNVNSR--- 382
              +++  +       +  +LG + TI                    +C  +++  +   
Sbjct: 226 SKDNLIKFWDPRSGSCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVYDIRQQAKE 285

Query: 383 LLLTSSDSDYSIRIWHGQKEN--CCNCF-----------------------YGHSQSIIS 417
           L     D DY    WH   E      C+                       Y H + + S
Sbjct: 286 LFSVRDDVDYMTLQWHPIDETVFTVGCYDGSIKHFDLSQENQPNKPTHNIPYAHEKCVTS 345

Query: 418 LSWIN-DDLVISASMDGSVRIWS 439
           L++     ++ SAS D ++R W+
Sbjct: 346 LAYSPIGHIMASASKDRTIRFWT 368

>YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein
           containing three WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           weak similarity to a region of S. pombe Cwf1p, which is
           a putative spliceosomal subunit and component of a 40S
           snRNP-containing complex [1254 bp, 417 aa]
          Length = 417

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 62/136 (45%), Gaps = 19/136 (13%)

Query: 240 QITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLD 298
           +IT L + P GE +I+S ++ +L++W+ KDG        HR+ +  I   +  ++ +S  
Sbjct: 138 EITKLKFFPSGEALISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRNVLSAS 197

Query: 299 LDNITILWNAINGIILQHFEPEQKLENNTESLGV-----------------DIEWVDKDK 341
           LD    LW    G  +  F  ++   +   S+ +                 ++E+    K
Sbjct: 198 LDGTIRLWECGTGTTIHTFNRKENPHDGVNSIALFVGTDRQLHEISTSKKNNLEFGTYGK 257

Query: 342 LVVPG-VNGSILVYSI 356
            V+ G V+G I V+++
Sbjct: 258 YVIAGHVSGVITVHNV 273

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 65/149 (43%), Gaps = 13/149 (8%)

Query: 293 HFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSIL 352
           H     LD    L+N I            K+    +   VD   +   + ++    G I 
Sbjct: 67  HLYKARLDGHDFLFNTI-------IRDGSKMLKRADYTAVDTAKLQMRRFILGTTEGDIK 119

Query: 353 VYSIDDNKPIGKLL--GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYG 410
           V  +D N  + + +   H   I+ ++F  +   L++SS  D  ++IW  +  +      G
Sbjct: 120 V--LDSNFNLQREIDQAHVSEITKLKFFPSGEALISSS-QDMQLKIWSVKDGSNPRTLIG 176

Query: 411 HSQSIISLSWINDDL-VISASMDGSVRIW 438
           H  ++  ++ I+    V+SAS+DG++R+W
Sbjct: 177 HRATVTDIAIIDRGRNVLSASLDGTIRLW 205

>Scas_702.16
          Length = 816

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 51/116 (43%), Gaps = 20/116 (17%)

Query: 223 ELRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGR--LQNVFN---- 276
           EL+ P A  S   R T  +T L +SP+G+ + +  ++  L +W  D    +Q +F     
Sbjct: 67  ELKKPLASMS---RHTGSVTCLKFSPNGKYLASGSDDRILLIWTLDEERPIQPIFGGESE 123

Query: 277 -----------FHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQ 321
                       H + I  I W  DS   +S+ LD   I+WN I    L+ F+  Q
Sbjct: 124 KERWAVRKRLVAHDNDIQDICWAPDSSLLVSVGLDRAVIIWNGITFEKLKRFDVHQ 179

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 65/162 (40%), Gaps = 43/162 (26%)

Query: 314 LQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDD--------------- 358
           L H E  +  E  T    VD+   D  ++   G++G I ++S+D                
Sbjct: 9   LSHIEESRSYEIYT----VDVS-PDGKRVATGGLDGKIRIWSVDSIKQIVKILSLKDEVP 63

Query: 359 -----NKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYG--- 410
                 KP+  +  H G+++C++F+ N + L + SD D  + IW   +E      +G   
Sbjct: 64  IDKELKKPLASMSRHTGSVTCLKFSPNGKYLASGSD-DRILLIWTLDEERPIQPIFGGES 122

Query: 411 -------------HSQSIISLSWIND-DLVISASMDGSVRIW 438
                        H   I  + W  D  L++S  +D +V IW
Sbjct: 123 EKERWAVRKRLVAHDNDIQDICWAPDSSLLVSVGLDRAVIIW 164

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 91/215 (42%), Gaps = 45/215 (20%)

Query: 224 LRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNV--------- 274
           L+ P+ LS I   ++ +I  +  SPDG+ + T   +G++R+W+ D   Q V         
Sbjct: 4   LKLPW-LSHIEESRSYEIYTVDVSPDGKRVATGGLDGKIRIWSVDSIKQIVKILSLKDEV 62

Query: 275 ------------FNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQK 322
                        + H   +  +K++ + K+  S   D I ++W       L    P Q 
Sbjct: 63  PIDKELKKPLASMSRHTGSVTCLKFSPNGKYLASGSDDRILLIWT------LDEERPIQP 116

Query: 323 L---ENNTESLGV------------DIEWV-DKDKLVVPGVNGSILVYSIDDNKPIGKLL 366
           +   E+  E   V            DI W  D   LV  G++ ++++++    + + +  
Sbjct: 117 IFGGESEKERWAVRKRLVAHDNDIQDICWAPDSSLLVSVGLDRAVIIWNGITFEKLKRFD 176

Query: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK 401
            HQ  +  + F+  ++   T+SD D +++I+   K
Sbjct: 177 VHQSHVKGVIFDPANKYFATASD-DRTMKIFRYHK 210

 Score = 29.6 bits (65), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 13/90 (14%)

Query: 200 GQEDSMAKMIEYNKEDKKII--SSLELRHPFALSSITGRKTNQITALSWSPDGE-LIITS 256
           G  DSM  +I    +DK ++  S+   R  F    I  +    IT + W+PDG  L +TS
Sbjct: 307 GPNDSMESIIATAGQDKTVVVWSTTRARPIFIAFDIANK---SITDMQWTPDGTMLFLTS 363

Query: 257 VENGELRLWNKDGRL-------QNVFNFHR 279
           +++    L  +D  L       +N+   HR
Sbjct: 364 LDSSITILVFEDNELGKIIPLEKNIEQLHR 393

>Scas_615.11
          Length = 349

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 49/100 (49%), Gaps = 14/100 (14%)

Query: 357 DDNKPIGKLLGHQGTISCIEF----NVNSRLLLTSSDSDYSIRIWH-------GQKENCC 405
           DD +    L GH+GT+ C +F    N  S  L + SD D ++R+W        GQ+E  C
Sbjct: 199 DDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSD-DSTVRVWRYIDDDEDGQQEWIC 257

Query: 406 NCFYG--HSQSIISLSWINDDLVISASMDGSVRIWSVVEN 443
                  H + I S+SW  + L+ S   DG++ ++  V N
Sbjct: 258 EAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSN 297

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 63/133 (47%), Gaps = 15/133 (11%)

Query: 351 ILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYG 410
           I VY  D  +   +L+GH+G +  +++  +   +L S  +D ++RIW+ +   C + F G
Sbjct: 389 INVYDADREQFKLELVGHEGGVWALKYAGDE--ILVSGSTDRTVRIWNVKAGKCTHVFRG 446

Query: 411 HSQSIISLSWIND---DLVISASMDGSVRIWSVVENCLVGM---AMVDGNAIICGKISHD 464
           H+ ++  L  +       V++ S D ++ +W + +         AM   N+I       +
Sbjct: 447 HTSTVRCLDVVEHGGIKYVVTGSRDNTLHVWKLPDPNSPDYNPNAMRQFNSI-------E 499

Query: 465 KNKFAIGSMNGQI 477
            N F +G + G +
Sbjct: 500 DNPFFVGVLRGHM 512

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 125/297 (42%), Gaps = 56/297 (18%)

Query: 243 ALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDS--KHFISLDL 299
           AL ++ D E++++   +  +R+WN K G+  +VF  H S +  +   E    K+ ++   
Sbjct: 412 ALKYAGD-EILVSGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDVVEHGGIKYVVTGSR 470

Query: 300 DNITILWNA-------INGIILQHFEPEQKLENNTESLGV------DIEWVD-KDKLVVP 345
           DN   +W          N   ++ F     +E+N   +GV       +  V     +VV 
Sbjct: 471 DNTLHVWKLPDPNSPDYNPNAMRQF---NSIEDNPFFVGVLRGHMASVRTVSGHGNIVVS 527

Query: 346 G-VNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW------- 397
           G  + +++V+ I   K +  L GH   I    ++ + R    S+  D ++++W       
Sbjct: 528 GSYDHNLMVWDIAKMKLLYVLTGHTDRIYSTLYD-HKRKRCISASMDTTVKVWDLSDINN 586

Query: 398 ---------------HGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVVE 442
                           G     C    GH+ +++ L  ++D  ++SA+ DGS+R W   +
Sbjct: 587 NGPVSQINSTSALKVSGSVRTLC----GHT-ALVGLLGLSDKYLVSAAADGSLRGWDASD 641

Query: 443 -NCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIK--RFVSRLLKRDKKQ 496
            +        + +AI    +S   N    GS + Q N+YD++  R V R L  D  Q
Sbjct: 642 YSKRFSFHHTNQSAITTFFVS--DNILVSGSEH-QFNIYDLRTGRLVHRHLLNDAAQ 695

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 4/77 (5%)

Query: 365 LLGHQG-TISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIND 423
           L GH+   ++C +F  N   ++T +D D  I ++   +E       GH   + +L +  D
Sbjct: 362 LDGHRTKVVTCFQFEGN--YIITGAD-DKRINVYDADREQFKLELVGHEGGVWALKYAGD 418

Query: 424 DLVISASMDGSVRIWSV 440
           ++++S S D +VRIW+V
Sbjct: 419 EILVSGSTDRTVRIWNV 435

>Scas_629.12
          Length = 671

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/322 (19%), Positives = 126/322 (39%), Gaps = 75/322 (23%)

Query: 211 YNKEDKKIISSLE---LRHPFALSSITGRKTNQ---ITALSWSPDGELIITSVENGELRL 264
           Y   D ++I+ L    +  P   S+ +G   +    I ++ +SPDGE + T  E+  +R+
Sbjct: 354 YRVSDGELIAKLSDDSVTSPDTSSATSGSTPSTDLYIRSVCFSPDGEFLATGAEDKLIRI 413

Query: 265 WN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKL 323
           W+ ++ ++  V   H   + S+ +  + +  +S   D    +W+               L
Sbjct: 414 WDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWD---------------L 458

Query: 324 ENNTESLGVDIEWVDKDKLVVPG-----VNGSI-------------LVYSIDDNKPIGKL 365
                SL + IE+      V P        GS+             LV  +D    +G  
Sbjct: 459 RTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENELG-- 516

Query: 366 LGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH--------------GQKENCCNCFY-G 410
            GH+ ++  + F  +   +++ S  D ++++W+              G     C   Y G
Sbjct: 517 TGHRDSVYSVVFTRDGNEVVSGS-LDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVG 575

Query: 411 HSQSIISLSWINDD-LVISASMDGSVRIWSVV-----------ENCLVGMAMVDGNAIIC 458
           H   ++S++   DD  ++S S D  +  W               N ++ +A+ +G+A   
Sbjct: 576 HKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLMLQGHRNSVISVAVANGSA--- 632

Query: 459 GKISHDKNKFAIGSMNGQINVY 480
             +    N FA GS + +  ++
Sbjct: 633 --LGPKYNVFATGSGDCKARIW 652

>Kwal_33.15475
          Length = 783

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 61/129 (47%), Gaps = 13/129 (10%)

Query: 365 LLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKEN-----CCNCFYGHSQSIISLS 419
           L GH   ++C++F   + L+++SS+ D  +R+W  ++++     C      H  +I SLS
Sbjct: 52  LKGHNAEVTCVKFVPGTNLMVSSSE-DSQVRLWAFEEKDQDALKCVQVIDHHKHTITSLS 110

Query: 420 WINDDLVISASMDGSVRIWSVVEN---CLVGMAMVDGNAIICGK---ISHDKNKFAIGSM 473
            I++ L +  + DGSV +W    N    L    +      +C     +  DK   AIG  
Sbjct: 111 VISNILSVGCA-DGSVSLWLTENNQAILLHSFNLQTNVYPLCMALKLVEGDKYLLAIGGT 169

Query: 474 NGQINVYDI 482
           N ++ +Y  
Sbjct: 170 NPRVFIYSF 178

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 49/100 (49%), Gaps = 4/100 (4%)

Query: 385 LTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVVENC 444
           L +   D  +R+W  +         GH+  I SL + ++ LV + SMD SVRIW +  + 
Sbjct: 518 LATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLV-TGSMDNSVRIWDLRTSS 576

Query: 445 LVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIKR 484
           ++ +   D   +    +  D     +G+  G +NV++++R
Sbjct: 577 ILDVIAYD---LPVSSLDFDGKLITVGANEGGVNVFNMER 613

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 57/140 (40%), Gaps = 22/140 (15%)

Query: 275 FNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFE------------PEQK 322
           F  H+  I ++ +  DS+  +S   D     W+   G  +Q  +            P + 
Sbjct: 436 FELHKDEITALSF--DSEALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARS 493

Query: 323 LENNTESLGVDIEWVDK-----DKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEF 377
           L N    LG +   +         L     +G + ++ +   KP+  L GH   I+ ++F
Sbjct: 494 LNNGACLLGTEAPMIGALQCYNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKF 553

Query: 378 NVNSRLLLTSSDSDYSIRIW 397
             +S  L+T S  D S+RIW
Sbjct: 554 --DSEKLVTGS-MDNSVRIW 570

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 32/175 (18%), Positives = 70/175 (40%), Gaps = 43/175 (24%)

Query: 351 ILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW-----------HG 399
           + V+ ++    +G+L GH  T++C++ +  +  +L +   D ++++W           H 
Sbjct: 360 VKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNMLITGSKDATLKLWDLNLSREIYLDHS 419

Query: 400 Q-KEN-------CCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVVENCLV----- 446
             KE        C + F  H   I +LS+ ++ LV S S D  +  W +     +     
Sbjct: 420 PLKEKTEEIVTPCIHNFELHKDEITALSFDSEALV-SGSRDKKIFHWDLTTGKCIQQLDL 478

Query: 447 ------------------GMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIK 483
                             G  ++   A + G +    +  A G+ +G + ++D++
Sbjct: 479 IFTPTHSDIKMPARSLNNGACLLGTEAPMIGALQCYNSALATGTKDGIVRLWDLR 533

>YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and
           COMPASS complex, contains a WD (WD-40) repeat [1281 bp,
           426 aa]
          Length = 426

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 73/159 (45%), Gaps = 19/159 (11%)

Query: 340 DKLVVPGVNGSILVYSIDDNKPI---GKLLG-HQGTISCIEFNVNSRLLLTSSDSDYSIR 395
           D L +   NG++++Y +D  +PI   G +LG H   I+ I ++ + RLLLTSS  D+SI+
Sbjct: 39  DYLALGCANGALVIYDMDTFRPICVPGNMLGAHVRPITSIAWSPDGRLLLTSS-RDWSIK 97

Query: 396 IWHGQKEN-----------CCNCFYGHSQSIISLSWI---NDDLVISASMDGSVRIWSVV 441
           +W   K +              C +  ++  + ++ I   +D  VI  S D    + S  
Sbjct: 98  LWDLSKPSKPLKEIRFDSPIWGCQWLDAKRRLCVATIFEESDAYVIDFSNDPVASLLSKS 157

Query: 442 ENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVY 480
           +   +      G  ++C   +   N   +G+  G ++ Y
Sbjct: 158 DEKQLSSTPDHGYVLVCTVHTKHPNIIIVGTSKGWLDFY 196

 Score = 38.1 bits (87), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 4/73 (5%)

Query: 218 IISSLELRHPFALS-SITGRKTNQITALSWSPDGELIITSVENGELRLWN--KDGRLQNV 274
           +I  ++   P  +  ++ G     IT+++WSPDG L++TS  +  ++LW+  K  +    
Sbjct: 51  VIYDMDTFRPICVPGNMLGAHVRPITSIAWSPDGRLLLTSSRDWSIKLWDLSKPSKPLKE 110

Query: 275 FNFHRSPIVSIKW 287
             F  SPI   +W
Sbjct: 111 IRFD-SPIWGCQW 122

 Score = 37.4 bits (85), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 64/149 (42%), Gaps = 15/149 (10%)

Query: 226 HPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQ-----NVFNFHRS 280
           HP  L+  T     +   L +SP G+ +     NG L +++ D         N+   H  
Sbjct: 15  HPEKLTH-TIENPLRTECLQFSPCGDYLALGCANGALVIYDMDTFRPICVPGNMLGAHVR 73

Query: 281 PIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVD-K 339
           PI SI W+ D +  ++   D    LW+     + +  +P +++  ++   G   +W+D K
Sbjct: 74  PITSIAWSPDGRLLLTSSRDWSIKLWD-----LSKPSKPLKEIRFDSPIWGC--QWLDAK 126

Query: 340 DKLVVPGVNGSILVYSID-DNKPIGKLLG 367
            +L V  +      Y ID  N P+  LL 
Sbjct: 127 RRLCVATIFEESDAYVIDFSNDPVASLLS 155

>Kwal_0.212
          Length = 303

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 90/197 (45%), Gaps = 21/197 (10%)

Query: 294 FISLDLDNITILWNAINGII---LQHFEPE-QKLENNTESLGVDIEWVDKDKLVVPGVNG 349
             S   D+    W A+ G+    +QH + +  +LE ++          DK  L   G + 
Sbjct: 5   LASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISS----------DKRFLAAAG-HL 53

Query: 350 SILVYSI--DDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNC 407
           ++ +Y I   +  P+    GH+G ++ I F   ++ +++SS+ D +I++W  +  +    
Sbjct: 54  NVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSE-DGTIKVWDVRAPSVQR- 111

Query: 408 FYGHSQSIISLS-WINDDLVISASMDGSVRIWSVVEN-CLVGMAMVDGNAIICGKISHDK 465
            Y H  ++  +    N   +IS   DG+VRIW + EN C+  +A  D   +    ++ D 
Sbjct: 112 NYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDG 171

Query: 466 NKFAIGSMNGQINVYDI 482
           +    G+  G   V+ +
Sbjct: 172 SMLVAGNNKGNCYVWQM 188

 Score = 41.6 bits (96), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 36/179 (20%), Positives = 84/179 (46%), Gaps = 17/179 (9%)

Query: 227 PFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSI 285
           P  ++S  G + N +T++++  + + +++S E+G +++W+ +   +Q  +  H++ +  +
Sbjct: 65  PNPVTSFEGHRGN-VTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEV 122

Query: 286 KWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVP 345
             + +    IS D D    +W+      +    PE      + S+  D        ++V 
Sbjct: 123 VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASD------GSMLVA 176

Query: 346 GVN-GSILVYSID------DNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           G N G+  V+ +       + KP+ K   H   I+ +  + + + L T S +D++ R+W
Sbjct: 177 GNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCS-ADHTARVW 234

>AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248)
           [1242 bp, 413 aa]
          Length = 413

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 57/131 (43%), Gaps = 14/131 (10%)

Query: 238 TNQITALSWSPDGELIITSVENGELRLWNK-DGRLQNVFNFHRSPIVSIKWNEDSKHFIS 296
           +  IT+L + P G++++++  + +L++W+  DG        H +PI      E  ++ +S
Sbjct: 146 SGHITSLHYFPSGKVLLSASIDMQLKIWSAADGTNPRTLFGHTAPITGCGLIERGRNVLS 205

Query: 297 LDLDNITILWNAINGIILQHFEPEQKLENNTES-------------LGVDIEWVDKDKLV 343
              D    LW   +G +L+ F    +  +   +             LG  +E+  +DK  
Sbjct: 206 SSKDGSVRLWECGSGSMLRAFHRRDRHSDGVNALQVLNVQSHSHNGLGNPLEFGTEDKAF 265

Query: 344 VPGVNGSILVY 354
           + G    +L Y
Sbjct: 266 IAGHASGVLTY 276

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 2/75 (2%)

Query: 365 LLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDD 424
           L GH G I+ + +  + ++LL++S  D  ++IW           +GH+  I     I   
Sbjct: 142 LDGHSGHITSLHYFPSGKVLLSAS-IDMQLKIWSAADGTNPRTLFGHTAPITGCGLIERG 200

Query: 425 L-VISASMDGSVRIW 438
             V+S+S DGSVR+W
Sbjct: 201 RNVLSSSKDGSVRLW 215

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 48/103 (46%), Gaps = 13/103 (12%)

Query: 405 CNCFYGHSQSIISLSWI-NDDLVISASMDGSVRIWSVVEN----CLVG-MAMVDGNAIIC 458
           C    GHS  I SL +  +  +++SAS+D  ++IWS  +      L G  A + G    C
Sbjct: 139 CRSLDGHSGHITSLHYFPSGKVLLSASIDMQLKIWSAADGTNPRTLFGHTAPITG----C 194

Query: 459 GKISHDKNKFAIGSMNGQINVYDI--KRFVSRLLKRDKKQELV 499
           G I   +N  +  S +G + +++      +    +RD+  + V
Sbjct: 195 GLIERGRNVLS-SSKDGSVRLWECGSGSMLRAFHRRDRHSDGV 236

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 74/167 (44%), Gaps = 33/167 (19%)

Query: 347 VNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK----- 401
           ++ +I V+++  NK +  + GH  T+SC++ +  + L+    D+   +++W  QK     
Sbjct: 432 LDPTIKVWNLSKNKHVASITGHLATVSCMQMDQYNTLITGGRDA--LLKMWDIQKAIDND 489

Query: 402 -----ENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV---------------- 440
                E C   F  H   I +LS+  ++LV S S D ++R W +                
Sbjct: 490 SIPSDEVCIYTFDSHIDEITALSFEANNLV-SGSQDRTIRQWDLNNGKCVQTLDINFATG 548

Query: 441 --VENCLVGMAMVDGN--AIICGKISHDKNKFAIGSMNGQINVYDIK 483
             +   ++G   ++ N    I G I       A G+ +G + ++D++
Sbjct: 549 GNLSRSMIGSGFLNTNNDHPIIGAIQCYDAALATGTKDGIVRLWDLR 595

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 10/112 (8%)

Query: 370 GTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISA 429
           G I C +        L +   D  +R+W  +         GHS ++ SL + + +LV + 
Sbjct: 571 GAIQCYD------AALATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQFDSLNLV-TG 623

Query: 430 SMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYD 481
           S+D S+RIW +    L      + + + C  +  D NK  + +  G + VY+
Sbjct: 624 SLDNSIRIWDLRTGTLADTFSYE-HPVTC--LQFDLNKIVVANQEGTVKVYN 672

 Score = 36.2 bits (82), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 14/74 (18%), Positives = 36/74 (48%)

Query: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLV 426
            H+  ++C++FN+    L ++   D +I++W+  K        GH  ++  +     + +
Sbjct: 409 AHEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVASITGHLATVSCMQMDQYNTL 468

Query: 427 ISASMDGSVRIWSV 440
           I+   D  +++W +
Sbjct: 469 ITGGRDALLKMWDI 482

>KLLA0D00814g complement(76687..77913) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2 subunit of the
           major yeast histone acetyltransferase, start by
           similarity
          Length = 408

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 85/177 (48%), Gaps = 16/177 (9%)

Query: 229 ALSSITGRKTNQITALSWSP--DGELIITSVENGELRLWN----KDGRLQNVFNFHRSPI 282
           A++S +  K N    L+++P   G+L+  S ++G + LW+     +      F+ H   +
Sbjct: 161 AIASFSYHKENGY-GLAFNPTVSGQLLSAS-DDGTVALWDVTSTANKSPSQTFDVHTDIV 218

Query: 283 VSIKWNE-DSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDK 341
              KW+E  S  F ++  DN  I+ +  +   +Q      KL  ++    +      ++ 
Sbjct: 219 NDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQ------KLSVSSAFNTLAFSKRSENL 272

Query: 342 LVVPGVNGSILVYSIDD-NKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           L   G + ++ +Y +    KP+  + GH+ +++ +EF+ +   LLTSS SD  I +W
Sbjct: 273 LAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMW 329

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 57/125 (45%), Gaps = 10/125 (8%)

Query: 327 TESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEF--------- 377
             SL V    + K  LV    + +I +Y +   K +G LLGHQG+I+ + F         
Sbjct: 39  AHSLSVKCLDISKRYLVSGSNDENIRIYDLQKRKELGTLLGHQGSITNLRFSRGKDADGQ 98

Query: 378 NVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLS-WINDDLVISASMDGSVR 436
           ++     L S+  D+ I +W  +         GH+  I       ++ + +S S D S+R
Sbjct: 99  DIQLNKWLLSASEDHKIIVWRVKDWENFGTLKGHTARINDFDIHPSNRVAVSVSEDHSIR 158

Query: 437 IWSVV 441
           +W+++
Sbjct: 159 LWNLM 163

>Kwal_47.17572
          Length = 434

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 40/63 (63%), Gaps = 7/63 (11%)

Query: 340 DKLVVPGVNGSILVYSIDDNKPIGKLLGHQG-----TISCIEFNVNSRLLLTSSDSDYSI 394
           D L +   NG++++Y +D  KPI  +LG++G     +I  I ++ N R LLTSS  D+++
Sbjct: 40  DYLAMGCTNGAVIIYDMDTAKPIA-MLGNKGGAHVRSIQSIAWSKNGRYLLTSS-RDWTV 97

Query: 395 RIW 397
           ++W
Sbjct: 98  KVW 100

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 8/76 (10%)

Query: 218 IISSLELRHPFA-LSSITGRKTNQITALSWSPDGELIITSVENGELRLWN----KDGRLQ 272
           II  ++   P A L +  G     I +++WS +G  ++TS  +  +++W+     +   Q
Sbjct: 52  IIYDMDTAKPIAMLGNKGGAHVRSIQSIAWSKNGRYLLTSSRDWTVKVWDLSMPGEPMRQ 111

Query: 273 NVFNFHRSPIVSIKWN 288
            VF+   SPI + +W+
Sbjct: 112 AVFD---SPIWACQWS 124

>Kwal_14.884
          Length = 395

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 62/135 (45%), Gaps = 21/135 (15%)

Query: 327 TESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNV------- 379
             SL V    + K  LV    +  I +Y +   K +G LL HQG+I+ ++F+        
Sbjct: 39  AHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDK 98

Query: 380 ------------NSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLS-WINDDLV 426
                       NS+ L+++SD D+++ IW  +         GH+  I       ++ + 
Sbjct: 99  NEDDTGLTTGRGNSKWLISASD-DHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIA 157

Query: 427 ISASMDGSVRIWSVV 441
           IS S D S+R+W+++
Sbjct: 158 ISVSEDHSIRLWNLM 172

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 82/172 (47%), Gaps = 14/172 (8%)

Query: 341 KLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH-- 398
           K +      S L+Y++ D         H  ++S I ++ +S+ + T+SD D++I I H  
Sbjct: 28  KFIAVSQGTSYLLYNVSDGLSAFIPTSHVESMSDICWSPDSQCIATASD-DFTIEINHIT 86

Query: 399 -GQKENCCNCFYGHSQSIISLSWIND-DLVISASMDGSVRIWSVVENCLVGMAMVDGNAI 456
            G+         GH+  ++SL + +  +L+ SASMD S++IW V+   L+         +
Sbjct: 87  YGRLHR----LVGHTAPVLSLVYTSKGNLLCSASMDESIKIWDVLTGTLLKTISAHSEPV 142

Query: 457 ICGKIS-HDKNKFAIGSMNGQINVYDIKR-FVSRLLKRD---KKQELVVPIT 503
           +   +   D +  + GS +G I ++D       + L  D   K +  VVPI+
Sbjct: 143 VSIDMPVCDPSILSSGSYDGLIRIFDTTTGHCLKTLTYDKDWKSENGVVPIS 194

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 71/167 (42%), Gaps = 24/167 (14%)

Query: 244 LSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNI 302
           + WSPD + I T+ ++  + + +   GRL  +   H +P++S+ +        S  +D  
Sbjct: 62  ICWSPDSQCIATASDDFTIEINHITYGRLHRLVG-HTAPVLSLVYTSKGNLLCSASMDES 120

Query: 303 TILWNAINGIILQ----HFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDD 358
             +W+ + G +L+    H EP          + +D+   D   L     +G I ++    
Sbjct: 121 IKIWDVLTGTLLKTISAHSEPV---------VSIDMPVCDPSILSSGSYDGLIRIFDTTT 171

Query: 359 NKPIGKLLGHQG--------TISCIEFNVNSRLLLTSSDSDYSIRIW 397
              +  L   +          IS ++F+VN + LL  S  D  ++IW
Sbjct: 172 GHCLKTLTYDKDWKSENGVVPISQVKFSVNGKYLLVKS-LDGVLKIW 217

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 50/230 (21%), Positives = 92/230 (40%), Gaps = 19/230 (8%)

Query: 228 FALSSITGRKTNQI-TALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIK 286
           F  S  T  K+  I T+   SPDG+ I  S     L     DG    +   H   +  I 
Sbjct: 4   FQTSIPTSEKSVGICTSAKVSPDGKFIAVSQGTSYLLYNVSDGLSAFIPTSHVESMSDIC 63

Query: 287 WNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPG 346
           W+ DS+  I+   D+ TI  N I       +    +L  +T  + + + +  K  L+   
Sbjct: 64  WSPDSQ-CIATASDDFTIEINHIT------YGRLHRLVGHTAPV-LSLVYTSKGNLLCSA 115

Query: 347 -VNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCC 405
            ++ SI ++ +     +  +  H   +  I+  V    +L+S   D  IRI+     +C 
Sbjct: 116 SMDESIKIWDVLTGTLLKTISAHSEPVVSIDMPVCDPSILSSGSYDGLIRIFDTTTGHCL 175

Query: 406 NCF-----YGHSQSIISLSW----INDDLVISASMDGSVRIWSVVENCLV 446
                   +     ++ +S     +N   ++  S+DG ++IW  +   +V
Sbjct: 176 KTLTYDKDWKSENGVVPISQVKFSVNGKYLLVKSLDGVLKIWDFIRGSVV 225

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 95/207 (45%), Gaps = 29/207 (14%)

Query: 200 GQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQITALSWSPDGELIITSVEN 259
           G +D   ++  YN  +K  ++  E  HP           + I +++  P    ++T  ++
Sbjct: 73  GSDDFKLRVYNYNTGEK--VTEFE-AHP-----------DYIRSIAVHPTKPFVLTGSDD 118

Query: 260 GELRLWN--KDGRLQNVFNFHRSPIVSIKWN-EDSKHFISLDLDNITILWNAINGIILQH 316
             ++LWN  K+   Q  F  H   ++S+ +N +D   F S  LD+   +W+    +    
Sbjct: 119 LTIKLWNWEKNWGCQQTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSIGQDV---- 174

Query: 317 FEPEQKLENNTESLGVD-IEWV---DKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTI 372
             P   L+ + E+ GV+ +++    DK  L+    +G+I V+       +  L GH   +
Sbjct: 175 --PNFTLKAH-ETKGVNYVDYYPLQDKPYLITTSDDGTIKVWDYQTKSNVATLEGHMANV 231

Query: 373 SCIEFNVNSRLLLTSSDSDYSIRIWHG 399
           S   F+    ++++ S+ D +++IW+ 
Sbjct: 232 SYAVFHPTLPIIISGSE-DGTLKIWNA 257

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 88/195 (45%), Gaps = 14/195 (7%)

Query: 253 IITSVENGELRLWNKD-GRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITI-LWN-AI 309
           ++   ++ +LR++N + G     F  H   I SI  +  +K F+    D++TI LWN   
Sbjct: 70  VVVGSDDFKLRVYNYNTGEKVTEFEAHPDYIRSIAVHP-TKPFVLTGSDDLTIKLWNWEK 128

Query: 310 NGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQ 369
           N    Q F   +        + V     D ++     ++ +I V+SI  + P   L  H+
Sbjct: 129 NWGCQQTFTGHEHF-----VMSVAFNPKDPNQFASGCLDHTIKVWSIGQDVPNFTLKAHE 183

Query: 370 --GTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDL-- 425
             G      + +  +  L ++  D +I++W  Q ++      GH  ++ S +  +  L  
Sbjct: 184 TKGVNYVDYYPLQDKPYLITTSDDGTIKVWDYQTKSNVATLEGHMANV-SYAVFHPTLPI 242

Query: 426 VISASMDGSVRIWSV 440
           +IS S DG+++IW+ 
Sbjct: 243 IISGSEDGTLKIWNA 257

>CAGL0L03201g complement(366795..368534) some similarities with
           sp|P47025 Saccharomyces cerevisiae YJL112w MDV1 or
           sp|P36130 Saccharomyces cerevisiae YKR036c CAF4 CCR4,
           hypothetical start
          Length = 579

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 73/166 (43%), Gaps = 26/166 (15%)

Query: 278 HRSPIVSIKWNEDSK-HFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEW 336
           H   I++ + N D K   ++L+ DN  I      G  LQ +    KL+   +S G DIE 
Sbjct: 210 HEHTIITSENNTDDKVSLLTLEPDNAQI------GNKLQRYFEAMKLKK--KSSGFDIE- 260

Query: 337 VDKDKLVVPGVNGSILVYSIDDNKPIGKLLG-HQGTISCIEFNVNSRLLLTSSDSDYSIR 395
              D   + G  G +           GK L  H   I+ +  N    +L ++++ D  I+
Sbjct: 261 ---DFENIIGTKGQL-----------GKTLKCHDDYINSLAINAQLGVLSSTANLDNEIK 306

Query: 396 IWHGQKENCCNCFYGHSQSIISLSWINDD-LVISASMDGSVRIWSV 440
           +W      C     GH  ++ +  +I+D  L+ SA  D SV++W V
Sbjct: 307 LWDISTTQCLGVLSGHRATVNTTRFIDDTRLLASAGKDASVKVWDV 352

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 43/219 (19%), Positives = 82/219 (37%), Gaps = 37/219 (16%)

Query: 250 GELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNA 308
           G L  T+  + E++LW+    +   V + HR+ + + ++ +D++   S   D    +W+ 
Sbjct: 293 GVLSSTANLDNEIKLWDISTTQCLGVLSGHRATVNTTRFIDDTRLLASAGKDASVKVWDV 352

Query: 309 INGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGH 368
            N +         K  N  ++L +      KD +      G+ +V   +D       LG 
Sbjct: 353 DNIV--------DKDGNANDNLCLATFDGHKDSVTALATTGNAIVSGSNDKTLRHWDLGS 404

Query: 369 QGTISCIEFNVNSRLL---------------------------LTSSDSDYSIRIWHGQK 401
              I  I+  +  +++                           L +   D  + +W  + 
Sbjct: 405 GKCIQSIDLTIALKMVPQSVSKLDITPSFNTPLIGGADCIDNALVTGTKDGIVYLWDLRI 464

Query: 402 ENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV 440
                   GH   I SL ++  +L I+ SMD S RIW +
Sbjct: 465 GRVVGSLEGHRGPITSLKYMGSEL-ITGSMDKSTRIWDL 502

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 52/99 (52%), Gaps = 4/99 (4%)

Query: 342 LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK 401
           L     + +I ++ +   K I +L GH   +  + F+   R L+T S  D +IR+W+   
Sbjct: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD--DRKLITGS-LDKTIRVWNYIT 371

Query: 402 ENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV 440
             C + + GHS S++S+      +++S S D +V++W V
Sbjct: 372 GECISTYRGHSDSVLSVDSYQ-KVIVSGSADKTVKVWHV 409

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 87/191 (45%), Gaps = 21/191 (10%)

Query: 251 ELIITSVENGELRLWNK-DGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAI 309
            L+ T   +  + +W+   G+L    + H   + ++ +  D +  I+  LD    +WN I
Sbjct: 313 RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYI 370

Query: 310 NGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPG-VNGSILVYSIDDNKPIGKLLGH 368
            G  +  +       ++   L VD       K++V G  + ++ V+ ++ ++    L GH
Sbjct: 371 TGECISTYR-----GHSDSVLSVD----SYQKVIVSGSADKTVKVWHVE-SRTCYTLRGH 420

Query: 369 QGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGH---SQSIISLSWIND-- 423
              ++C++ +  S    + SD D +IR+W  +  +C   F GH    Q II L+ I D  
Sbjct: 421 TEWVNCVKLHPKSFSCFSCSD-DTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLT-IKDVE 478

Query: 424 DLVISASMDGS 434
           +L    + DGS
Sbjct: 479 NLATDNTSDGS 489

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 4/80 (5%)

Query: 362 IGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWI 421
           I +  GH   +  ++FN   RLL T S  D +I IW            GHS  + +L + 
Sbjct: 295 IQEFKGHMDGVLTLQFNY--RLLFTGS-YDSTIGIWDLFTGKLIRRLSGHSDGVKTL-YF 350

Query: 422 NDDLVISASMDGSVRIWSVV 441
           +D  +I+ S+D ++R+W+ +
Sbjct: 351 DDRKLITGSLDKTIRVWNYI 370

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 385 LTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV 440
           L S   D +I++W  +   C    +GH + +  ++  ++  +IS S DGS+++W +
Sbjct: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA-ADNFRIISGSHDGSIKVWDL 579

>YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin
           assembly complex, subunit 3, involved in both nucleosome
           assembly linked with DNA replication and negative
           regulation of the RAS pathway, has WD (WD-40) repeats
           [1269 bp, 422 aa]
          Length = 422

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 67/299 (22%), Positives = 127/299 (42%), Gaps = 57/299 (19%)

Query: 192 QNERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPF---------ALSSITGRKT---- 238
           QN  ++A    D    + +  K     I   ++ HPF          +  +    T    
Sbjct: 140 QNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHGVIQDVEAMDTSSAD 199

Query: 239 -NQITALSWSPDGE-LIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFIS 296
            N+ T+L+W+   E L+++S  NG++++W+           H +PI+ +         +S
Sbjct: 200 INEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYS------HENPIIDLP-------LVS 246

Query: 297 LDLDNITI---LW--------------NAINGIILQHFEPEQKLENNTESL--GVD-IEW 336
           ++ D   +    W              NA++ + L+    ++KL++N E    GV+   +
Sbjct: 247 INSDGTAVNDVTWMPTHDSLFAACTEGNAVSLLDLR--TKKEKLQSNREKHDGGVNSCRF 304

Query: 337 VDKDKLVVPGV--NGSILVYSIDD-NKPIGKLLGHQGTISCIEFNVN-SRLLLTSSDSDY 392
             K+ L++     NG + ++ I + NK     + H  ++S +E++ N   +L T+   D 
Sbjct: 305 NYKNSLILASADSNGRLNLWDIRNMNKSPIATMEHGTSVSTLEWSPNFDTVLATAGQEDG 364

Query: 393 SIRIWHGQKENCCNCFYGHSQSIISLSWINDD--LVISASMDGSVRIWSVVENCLVGMA 449
            +++W    E       GH   +  +SW   D  L+ S + D SV IW    N LVG +
Sbjct: 365 LVKLWDTSCEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAGN-LVGHS 422

>KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces
           cerevisiae YLR409c singleton, start by similarity
          Length = 942

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 102/233 (43%), Gaps = 29/233 (12%)

Query: 266 NKDGRLQNVFNFHRSPIVSIKWNEDSKHF-----------------ISLDLDNITILWNA 308
           N+ G+ +N+   H+    +  WN  +K                   IS    N  ++ ++
Sbjct: 424 NRQGQWENILTVHKGEKFARTWNSRTKRVGRWTIPTNDEGFAKSVAIS-QCGNFGLVGSS 482

Query: 309 INGIILQHFEPEQKLE----NNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGK 364
             GI + + +  QK +    +     G+ ++ +++ K+V  G++G +  Y    +  +GK
Sbjct: 483 NGGISVHNLQSGQKRKVYRLHKKAVTGIAMDGMNR-KMVSCGLDGIVGFYDFSKSTFLGK 541

Query: 365 LLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDD 424
            L     I+ + ++ +S L   + D D SI +     +      +GHS  I S  +  D 
Sbjct: 542 -LKLDSPITSMVYHRSSDLFALALD-DLSIVVVDSVTQKVVRQLWGHSNRISSFDFSPDG 599

Query: 425 L-VISASMDGSVRIWSV-VENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNG 475
             ++S+S+D ++R W +    C+ GM +   N I   K S + +  A  S++G
Sbjct: 600 RWIVSSSLDSTIRTWDLPTGGCIDGMKVE--NVITNIKFSPNGDLLATTSVSG 650

>Kwal_55.21559
          Length = 351

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/261 (19%), Positives = 108/261 (41%), Gaps = 35/261 (13%)

Query: 196 LLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQITALSWSPDGELIIT 255
           L+A    D   K++     D +++  L+          T +K+  + ++S+ P   ++  
Sbjct: 45  LMATSSSDRKIKLVNLKNMDFQLVEELD--------DSTHKKS--VRSVSFRPHSSILAA 94

Query: 256 SVENGELRLWNKD-----------GRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITI 304
              +  + +W K+             L  +   H + + ++ W+    +  S   D    
Sbjct: 95  GSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVW 154

Query: 305 LWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYS--IDDNKPI 362
           +W A    + + +E    L+ + + +   +   +   L     + +I ++    DD +  
Sbjct: 155 IWEADE--LGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECA 212

Query: 363 GKLLGHQGTISCIEFNVN-SRLLLTSSDSDYSIRIWH--GQKENCCNCFYG-------HS 412
             L GH+GT+ C +F  + S L L S   D ++R+W+   ++EN  + +         HS
Sbjct: 213 AVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHS 272

Query: 413 QSIISLSWINDDLVISASMDG 433
           +++ S+SW  D  + S   DG
Sbjct: 273 RAVYSVSWSLDGYIASVGSDG 293

>Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement
          Length = 263

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 342 LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFN-VNSRLLLTSSDSDYSIRIWHGQ 400
           L V   +G I ++ +     +    GH+  I+ + F+   +RL+  S DSD  I IW   
Sbjct: 90  LAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSD--IIIWDLV 147

Query: 401 KENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGK 460
            E        H  SI  +   N+D +IS S DG ++IW +     V   M   +   C  
Sbjct: 148 GEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTSE--CWG 205

Query: 461 ISHDKNKFAIGSMNGQINVYDI---KRFVSRLLK----RDKKQELVVPITIPL 506
           ++   +     S   QI ++++   K   S+L+K    R+K  + V P ++ L
Sbjct: 206 LAIHNDLVITTSTESQIKIWNLDLDKDMGSKLMKKAFMRNKVDKEVSPWSLSL 258

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/205 (20%), Positives = 81/205 (39%), Gaps = 52/205 (25%)

Query: 237 KTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNV-FNFHRSPIVSIKWNEDSKHFI 295
           K  + T L + P+  L+     +G +++W+   +   + FN H+S I  ++++      I
Sbjct: 74  KLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLI 133

Query: 296 SLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYS 355
           S   D+  I+W+ +                                       G + +Y 
Sbjct: 134 SGSKDSDIIIWDLV---------------------------------------GEVGLY- 153

Query: 356 IDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSI 415
                   KL  H+ +I+ I       L+ TS D    I+IW  + + C      H+   
Sbjct: 154 --------KLRSHKDSITGIWCENEDWLISTSKDG--LIKIWDLKTQQCVETHMAHTSEC 203

Query: 416 ISLSWINDDLVISASMDGSVRIWSV 440
             L+ I++DLVI+ S +  ++IW++
Sbjct: 204 WGLA-IHNDLVITTSTESQIKIWNL 227

>AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372)
           [3072 bp, 1023 aa]
          Length = 1023

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 64/123 (52%), Gaps = 7/123 (5%)

Query: 331 GVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKL-LGHQGTISCIEFNVNSRLLLTSSD 389
           G+ ++ +++ K+V  G++G +  Y    N  +GKL LG    I+ + ++  S L   + D
Sbjct: 595 GLAVDGMNR-KMVSCGLDGLVGFYDFTTNSFLGKLQLG--APITQLVYHRASELFAVALD 651

Query: 390 SDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDL-VISASMDGSVRIWSV-VENCLVG 447
            D+SI++     +      +GHS  I +  +  D   ++SAS+D ++R W +    C+ G
Sbjct: 652 -DFSIQVIDSVTQRVVRQLWGHSNRITAFDFSPDGRWIVSASLDSTLRTWDLPTGTCIDG 710

Query: 448 MAM 450
           + +
Sbjct: 711 VRL 713

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (68%)

Query: 238 TNQITALSWSPDGELIITSVENGELRLWN 266
           +N+ITA  +SPDG  I+++  +  LR W+
Sbjct: 673 SNRITAFDFSPDGRWIVSASLDSTLRTWD 701

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 56/132 (42%), Gaps = 32/132 (24%)

Query: 338 DKDKLVVPGVNGSILVYSID---------------DNKPIGKLLGHQGTISCIEFNVNSR 382
           D  ++   G++G I ++S+D                ++P+  +  H G+++C++F+ +  
Sbjct: 28  DGKRVATGGLDGKIRIWSVDALVSAAAGESGVDRDTHRPLASMSRHTGSVTCVKFSPDGN 87

Query: 383 LLLTSSDSDYSIRIWHGQKENCCNCF---------------YGHSQSIISLSWIND-DLV 426
            L + SD D  + IW   +EN    F                 H   I  + W  D  ++
Sbjct: 88  YLASGSD-DRILLIWAMDEENHGGSFGSEGEKEHWTVRKRLVAHDNDIQDICWAPDSSIL 146

Query: 427 ISASMDGSVRIW 438
           ++  +D SV +W
Sbjct: 147 VTVGLDRSVIVW 158

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 44/104 (42%), Gaps = 16/104 (15%)

Query: 236 RKTNQITALSWSPDGELIITSVENGELRLWNKDGR----------------LQNVFNFHR 279
           R T  +T + +SPDG  + +  ++  L +W  D                  ++     H 
Sbjct: 72  RHTGSVTCVKFSPDGNYLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTVRKRLVAHD 131

Query: 280 SPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKL 323
           + I  I W  DS   +++ LD   I+WN +N   L+ F+  Q L
Sbjct: 132 NDIQDICWAPDSSILVTVGLDRSVIVWNGLNFERLKRFDVHQSL 175

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 80/187 (42%), Gaps = 26/187 (13%)

Query: 240 QITALSWSPDGELIITSVENGELRLWNKDG----------------RLQNVFNFHRSPIV 283
           +I  +  SPDG+ + T   +G++R+W+ D                 R     + H   + 
Sbjct: 19  EIYTVDVSPDGKRVATGGLDGKIRIWSVDALVSAAAGESGVDRDTHRPLASMSRHTGSVT 78

Query: 284 SIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGV--------DIE 335
            +K++ D  +  S   D I ++W          F  E + E+ T    +        DI 
Sbjct: 79  CVKFSPDGNYLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTVRKRLVAHDNDIQDIC 138

Query: 336 WV-DKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSI 394
           W  D   LV  G++ S++V++  + + + +   HQ  +  + F+  ++   T+SD D ++
Sbjct: 139 WAPDSSILVTVGLDRSVIVWNGLNFERLKRFDVHQSLVKGVIFDPANKYFATASD-DRTM 197

Query: 395 RIWHGQK 401
           R++   K
Sbjct: 198 RVFRYHK 204

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 59/123 (47%), Gaps = 10/123 (8%)

Query: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH----GQKENCCNCFYGHSQSIISLSWIN 422
           GH+  I C+ ++ +  LL T S  D S+ IW     G++  C +    HSQ +  + W  
Sbjct: 107 GHENEIKCVAWSHDGELLATCS-RDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQ 165

Query: 423 D-DLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKN----KFAIGSMNGQI 477
              L+ S+S D +VRIW   ++     A+++G+         +K+    +   GS +G +
Sbjct: 166 SLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTV 225

Query: 478 NVY 480
            ++
Sbjct: 226 RIW 228

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 54/280 (19%), Positives = 111/280 (39%), Gaps = 43/280 (15%)

Query: 190 NLQNERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQITALSWSPD 249
           ++ N  ++A G  D   K+++        I S ++     L     +KT  + +++W P 
Sbjct: 21  DVNNGGIMATGSTDRKIKLVD--------IRSFQIIEE--LDDTAHKKT--VRSVAWRPH 68

Query: 250 GELIITSVENGELRLWNKDG-----------RLQNVFNFHRSPIVSIKWNEDSKHFISLD 298
             ++     +  + +W KD             L  +   H + I  + W+ D +   +  
Sbjct: 69  SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCS 128

Query: 299 LDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVY--SI 356
            D    +W A    + + FE    L+ +++ +   I       L     + ++ ++    
Sbjct: 129 RDKSVWIWEADE--MGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCD 186

Query: 357 DDNKPIGKLLGHQGTISCIEF-NVNSRLLLTSSDSDYSIRIWHGQKENCCNCFY------ 409
           DD +    L GH+GT+   +F   NS + L S   D ++RIW  + +N     Y      
Sbjct: 187 DDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNG---EYEQEWIQ 243

Query: 410 ------GHSQSIISLSWINDDLVISASMDGSVRIWSVVEN 443
                  H++++ S++W     + S   DG + I+   E+
Sbjct: 244 ESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESED 283

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 62/123 (50%), Gaps = 6/123 (4%)

Query: 365 LLGHQGT-ISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIND 423
           L GH  + I+C++F  N   ++T +D D  IR++    +       GH   + +L + + 
Sbjct: 377 LRGHMTSVITCLQFEDN--YVITGAD-DKMIRVYDSINKKFLLQLSGHDGGVWALKYAHG 433

Query: 424 DLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKN-KFAI-GSMNGQINVYD 481
            +++S S D +VR+W + + C   +     + + C  I   KN K+ + GS +  ++V+ 
Sbjct: 434 GILVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVWK 493

Query: 482 IKR 484
           + +
Sbjct: 494 LPK 496

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 6/90 (6%)

Query: 352 LVYSIDDNKP--IGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFY 409
           LV+   +  P  +G L GH  ++  +  + N   ++ S   D ++ +W   +  C     
Sbjct: 511 LVFHTPEENPYFVGVLRGHMASVRTVSGHGN---IVVSGSYDNTLIVWDVAQMKCLYILS 567

Query: 410 GHSQSIISLSWIND-DLVISASMDGSVRIW 438
           GH+  I S  + ++    ISASMD ++RIW
Sbjct: 568 GHTDRIYSTIYDHERKRCISASMDTTIRIW 597

 Score = 33.1 bits (74), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 96/229 (41%), Gaps = 44/229 (19%)

Query: 250 GELIITSVENGELRLWN-KDGRLQNVFNFHRSPI--VSIKWNEDSKHFISLDLDNITILW 306
           G ++++   +  +R+W+ K G   +VF  H S +  + I   ++ K+ ++   DN   +W
Sbjct: 433 GGILVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVW 492

Query: 307 N-AINGIILQHFEPE------QKLENNTESLGV------DIEWVD-KDKLVVPG-VNGSI 351
                  +  H E           E N   +GV       +  V     +VV G  + ++
Sbjct: 493 KLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTVSGHGNIVVSGSYDNTL 552

Query: 352 LVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCN---CF 408
           +V+ +   K +  L GH   I    ++ + R    S+  D +IRIW    EN  N   C 
Sbjct: 553 IVWDVAQMKCLYILSGHTDRIYSTIYD-HERKRCISASMDTTIRIW--DLENIWNNGECS 609

Query: 409 Y-------------------GHSQSIISLSWINDDLVISASMDGSVRIW 438
           Y                   GH+ +++ L  ++D  ++SA+ DGS+R W
Sbjct: 610 YATNSASPCAKILGAMYTLQGHT-ALVGLLRLSDKFLVSAAADGSIRGW 657

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/142 (19%), Positives = 63/142 (44%), Gaps = 27/142 (19%)

Query: 367 GHQGTISCIEF--NVNSRLLLTSSDSDYSIRIW----------HGQKENCCNCFY----- 409
           GH  T+ C++     N + ++T S  D ++ +W          HG++ +    F+     
Sbjct: 461 GHNSTVRCLDIVEYKNIKYIVTGS-RDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEEN 519

Query: 410 --------GHSQSIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKI 461
                   GH  S+ ++S  + ++V+S S D ++ +W V +   + +     + I     
Sbjct: 520 PYFVGVLRGHMASVRTVSG-HGNIVVSGSYDNTLIVWDVAQMKCLYILSGHTDRIYSTIY 578

Query: 462 SHDKNKFAIGSMNGQINVYDIK 483
            H++ +    SM+  I ++D++
Sbjct: 579 DHERKRCISASMDTTIRIWDLE 600

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 68/156 (43%), Gaps = 16/156 (10%)

Query: 363 GKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIN 422
            + +GH G +  +  + NS  ++++S  D +IR+W+    +C     GH+  +  +    
Sbjct: 102 ARFVGHTGDVLSVAIDANSSKIISAS-RDKTIRVWN-TVGDCAYVLLGHTDWVTKVRVAP 159

Query: 423 DDL-----------VISASMDGSVRIWSVVENCLVGMAMVDG--NAIICGKISHDKNKFA 469
            +L            +SA MD  VR WS+ E+     A   G  N I   + S D +  A
Sbjct: 160 KNLEDGEVDDGRITFVSAGMDKIVRSWSLNEDSYRIEADFIGHNNYINVVQPSPDGSLAA 219

Query: 470 IGSMNGQINVYDIKRFVSRLLKRDKKQELVVPITIP 505
               +GQI V+++K   S  +  D K E+      P
Sbjct: 220 SAGKDGQIYVWNLKH-KSAFMNFDAKDEVFALAFSP 254

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 361 PIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW 420
           P+    GH   +  +  + +    +++S  D ++R+W+    N    F GH+  ++S++ 
Sbjct: 58  PVRSYKGHSHIVQDVVVSADGNYAVSAS-WDKTLRLWNLATGNSEARFVGHTGDVLSVAI 116

Query: 421 -INDDLVISASMDGSVRIWSVVENC 444
             N   +ISAS D ++R+W+ V +C
Sbjct: 117 DANSSKIISASRDKTIRVWNTVGDC 141

>Kwal_27.11585
          Length = 823

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 69/163 (42%), Gaps = 10/163 (6%)

Query: 278 HRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWV 337
           H   I ++  + +   F +   D    +WN  +G      E E  L N+   L  D+ + 
Sbjct: 503 HEKDINALSISPNDSVFATASYDKTCKIWNVDSG------ELEGTLANHKRGLW-DVTFC 555

Query: 338 DKDKLVVP-GVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRI 396
             DKL+     + +I V+S++    +  L GH   +    F +N    + S+ +D  I++
Sbjct: 556 QYDKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSF-INRNKQIVSTGADGLIKV 614

Query: 397 WHGQKENCCNCFYGHSQSIISLSWINDDL-VISASMDGSVRIW 438
           W      C      HS  I +LS ++D    ++A  DG  + W
Sbjct: 615 WDLSTGECIRTLDAHSNRIWALSVLSDGKEFVTADADGVFQFW 657

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 55/124 (44%), Gaps = 2/124 (1%)

Query: 353 VYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHS 412
           ++++D  +  G L  H+  +  + F    +LL T S  D +I++W  +  +      GH+
Sbjct: 530 IWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCS-GDKTIKVWSLESMSVVKTLEGHT 588

Query: 413 QSIISLSWIN-DDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIG 471
            ++   S+IN +  ++S   DG +++W +     +       N I    +  D  +F   
Sbjct: 589 NAVQRCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGKEFVTA 648

Query: 472 SMNG 475
             +G
Sbjct: 649 DADG 652

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 8/99 (8%)

Query: 342 LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFN---VNSRLLLTSSDSDYSIRIWH 398
           + + G +GS+ V  I++        GH  TIS ++F+     S   L S D+   +++W 
Sbjct: 116 VALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVWD 175

Query: 399 GQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRI 437
             + NC +    H+ ++  L     D  +S + DG + +
Sbjct: 176 LVRRNCIHTIQEHAAAVRGL-----DFRLSPADDGVLEL 209

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 50/231 (21%), Positives = 101/231 (43%), Gaps = 23/231 (9%)

Query: 226 HPFALSSITGRKTNQ-ITALSWSPDGELIITSVENGELRLWNKD-GRLQNVFNFHRSPIV 283
           H   +S  T R   + I ALS SP+  +  T+  +   ++WN D G L+     H+  + 
Sbjct: 491 HNIKVSDYTRRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLW 550

Query: 284 SIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLV 343
            + + +  K   +   D    +W+      L+     + LE +T ++     +++++K +
Sbjct: 551 DVTFCQYDKLLATCSGDKTIKVWS------LESMSVVKTLEGHTNAVQ-RCSFINRNKQI 603

Query: 344 V-PGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHG--- 399
           V  G +G I V+ +   + I  L  H   I  +    + +  +T +D+D   + W     
Sbjct: 604 VSTGADGLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGKEFVT-ADADGVFQFWKDCSE 662

Query: 400 --QKENCCN--CFYGHSQSIISL----SWINDDLVISASMDGSVRIWSVVE 442
             QKEN  N        QS+ +      W N   +++ +++  +R++ V+E
Sbjct: 663 EEQKENLENQKLMVEQEQSLQNYMAQGDWTN-AFLLAMTLNHPMRLYRVLE 712

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/243 (22%), Positives = 99/243 (40%), Gaps = 64/243 (26%)

Query: 200 GQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQITALSWSPDGELIITSVEN 259
           G +D   ++  YN  +K  +   E  HP           + I AL+  P    ++++ ++
Sbjct: 73  GSDDFKIRVFNYNTGEK--VVDFEA-HP-----------DYIRALAVHPTRSYVLSASDD 118

Query: 260 GELRLWN--KDGRLQNVFNFHRSPIVSIKWN-EDSKHFISLDLDNITILWNAINGIILQH 316
             ++LWN  K+  L+  F  H   ++S+ +N +D   F +  LD+   +W+   G    +
Sbjct: 119 LTVKLWNWEKNWALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSL--GQETSN 176

Query: 317 FEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIE 376
           F     LE                     GVN   + Y    +KP               
Sbjct: 177 FTLRAHLEK--------------------GVN--FVDYYPFQDKP--------------- 199

Query: 377 FNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSI-ISLSWINDDLVISASMDGSV 435
                  L+TSSD D ++++W  Q ++C     GH  ++  ++      ++IS S DG+V
Sbjct: 200 ------YLITSSD-DRTVKVWDYQTKSCVATLEGHLSNVSYAVYHPMLPIIISGSEDGTV 252

Query: 436 RIW 438
           +IW
Sbjct: 253 KIW 255

>Kwal_27.11126
          Length = 996

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 56/115 (48%), Gaps = 2/115 (1%)

Query: 338 DKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           DK  +    V   ++V+ ++  + +     H+G I  +  + N +   + SD D SI++W
Sbjct: 150 DKVHINAGTVMDGVIVWDLESEQNLHHFTDHEGAIFFVTASKNGKYAASCSD-DRSIKLW 208

Query: 398 HGQKENCCNCFYGHSQSIISLSWI-NDDLVISASMDGSVRIWSVVENCLVGMAMV 451
             +     +  +GH+  I +L +  ND  VIS S D + R+W + E+  +  A V
Sbjct: 209 DLKSGQLLSTAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWDISEDNTLSQASV 263

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/97 (19%), Positives = 48/97 (49%), Gaps = 9/97 (9%)

Query: 249 DGELIITSVENGELRLWN-KDGRLQNVFNFHRS--------PIVSIKWNEDSKHFISLDL 299
           DG ++ +   +G +R+++   G       + +         PI  +K++ ++K+ +    
Sbjct: 150 DGSILSSGSHDGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSANTKYLLVKSY 209

Query: 300 DNITILWNAINGIILQHFEPEQKLENNTESLGVDIEW 336
           D +  +W++++G +++ F+P  K  N T   G+D  +
Sbjct: 210 DGVVKIWDSVSGDVVRTFKPSNKKYNLTHCCGMDFMY 246

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/104 (21%), Positives = 48/104 (46%), Gaps = 9/104 (8%)

Query: 220 SSLELRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHR 279
           S  +LR    L    G     ++ + WSPDG+ I +  ++  + + ++   L +    H 
Sbjct: 42  SGYQLRETLVLEHAAG-----VSQICWSPDGKCIASCSDDFTVVVTHRQLGLLHRLVGHT 96

Query: 280 SPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQ----HFEP 319
           +P++S+ +N       +  +D    +W+ + G +++    H EP
Sbjct: 97  APVISLCYNNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHSEP 140

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 73/144 (50%), Gaps = 8/144 (5%)

Query: 365 LLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIN-D 423
           +L H   +S I ++ + + + + SD D+++ + H Q     +   GH+  +ISL + N  
Sbjct: 51  VLEHAAGVSQICWSPDGKCIASCSD-DFTVVVTHRQL-GLLHRLVGHTAPVISLCYNNKG 108

Query: 424 DLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKIS-HDKNKFAIGSMNGQINVYDI 482
           +L+ ++SMD S+++W V+   ++         ++   +S +D +  + GS +G I ++D 
Sbjct: 109 NLLFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSDNDGSILSSGSHDGLIRIFDT 168

Query: 483 KR-FVSRLLKRDK---KQELVVPI 502
                 + L  DK    +  VVPI
Sbjct: 169 ATGHCLKTLTYDKDWQSETGVVPI 192

>Scas_658.1
          Length = 442

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 4/120 (3%)

Query: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIW-HGQKENCCNCFYGHSQSIISLSWINDDL 425
           GH    + + F  NS  LL S  +D  +++W    K N    + GHS++I SL + NDD 
Sbjct: 147 GHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDF-NDDG 205

Query: 426 V--ISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIK 483
              IS+S D +++IW   +  +                  + ++F +G  N +I  YD +
Sbjct: 206 TNFISSSFDHTIKIWDTEQGKVKTKLHFKSTPNDVKFRPFNSSEFIVGFANSKIYHYDTR 265

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 77/169 (45%), Gaps = 13/169 (7%)

Query: 238 TNQITALSWSPD-GELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSKHF 294
           TN  T+L++ P+ G L+++   +  +++W+      L   +  H   I S+ +N+D  +F
Sbjct: 149 TNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDFNDDGTNF 208

Query: 295 ISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVY 354
           IS   D+   +W+   G +      + KL   +    V     +  + +V   N  I  Y
Sbjct: 209 ISSSFDHTIKIWDTEQGKV------KTKLHFKSTPNDVKFRPFNSSEFIVGFANSKIYHY 262

Query: 355 SIDDNKPIGKLL---GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQ 400
               ++  G++     H  +I  ++F  +    ++SS+ D ++RIW  Q
Sbjct: 263 DTRISENDGRVQVYDHHMSSILALKFFPDGSKFISSSE-DKTVRIWDNQ 310

>KLLA0F21406g complement(1996260..1998377) similar to sp|P47025
           Saccharomyces cerevisiae YJL112w MDV1, start by
           similarity
          Length = 705

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 63/149 (42%), Gaps = 37/149 (24%)

Query: 347 VNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK----- 401
           ++ S+ V+ +   K I  L GH  +ISC++ +  S L+    D+   +++W   K     
Sbjct: 418 LDHSVKVWDLSKKKQIATLHGHLASISCMQIDQYSTLITGGRDA--VLKLWDIDKAMADE 475

Query: 402 --------ENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDG 453
                   + C   F  H   I ++S+  D+LV S S D +VR W             D 
Sbjct: 476 ASNSSEDNDACLYTFDSHVDEITAISFDGDNLV-SGSQDRTVRQW-------------DL 521

Query: 454 NAIICGK---ISHDKNKFAIGSMNGQINV 479
           N+  C +   IS     FA G M  Q N+
Sbjct: 522 NSGKCTQTIDIS-----FATGPMRSQRNI 545

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 15/74 (20%), Positives = 36/74 (48%)

Query: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLV 426
            H   I+C++F++    + ++   D+S+++W   K+      +GH  SI  +       +
Sbjct: 395 AHDEDITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQIATLHGHLASISCMQIDQYSTL 454

Query: 427 ISASMDGSVRIWSV 440
           I+   D  +++W +
Sbjct: 455 ITGGRDAVLKLWDI 468

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 7/71 (9%)

Query: 370 GTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISA 429
           G + C +        L +   D  +R+W  +         GH+ +I SL + + +LV  A
Sbjct: 561 GALQCFD------AALATGTKDGIVRLWDLRSGKVVRMLEGHTDAITSLQFDSVNLVTGA 614

Query: 430 SMDGSVRIWSV 440
            MD S+RIW +
Sbjct: 615 -MDRSIRIWDL 624

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 49/102 (48%), Gaps = 4/102 (3%)

Query: 356 IDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCF-YGHSQS 414
           I D +P   L GH   +  I ++  ++ +L SS  DY++RIW+   E   + +   H   
Sbjct: 126 IKDIEPTKFLTGHSRKVGHILYHPTAKDVLASSSLDYTVRIWN--VETGEDIYKLKHPDM 183

Query: 415 IISLSWINDDL-VISASMDGSVRIWSVVENCLVGMAMVDGNA 455
           + S+S+  D   + + + D  +R+W+V E  +V        A
Sbjct: 184 VTSMSFSYDGTHLATVARDKKLRVWNVREEKVVSEGAAHAGA 225

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 53/99 (53%), Gaps = 4/99 (4%)

Query: 342 LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK 401
           L     + ++ ++ +   K I +L GH   +  + F+   + L+T S  D +IR+W+   
Sbjct: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFD--DQKLITGS-LDKTIRVWNYIT 403

Query: 402 ENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV 440
             C + + GH+ S++S+   +  +++S S D +V++W V
Sbjct: 404 GECISTYRGHTDSVMSVD-SHKKIIVSGSADKTVKVWHV 441

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/173 (18%), Positives = 75/173 (43%), Gaps = 16/173 (9%)

Query: 275 FNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDI 334
           F  H   ++++++N   +   +   D    +W+   G +++             S GV  
Sbjct: 330 FKGHMDGVLTLQFN--YRLLFTGSYDTTVAIWDLFTGKLIRRL--------TGHSDGVKT 379

Query: 335 EWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSI 394
            + D  KL+   ++ +I V++    + I    GH  ++  ++   + + ++ S  +D ++
Sbjct: 380 LYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD---SHKKIIVSGSADKTV 436

Query: 395 RIWHGQKENCCNCFYGHSQSIISLSWINDDL-VISASMDGSVRIWSVVEN-CL 445
           ++WH +   C     GH++ +  +          S S D ++R+W +  N CL
Sbjct: 437 KVWHVESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCL 488

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 4/80 (5%)

Query: 362 IGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWI 421
           I +  GH   +  ++FN   RLL T S  D ++ IW            GHS  + +L + 
Sbjct: 327 IQEFKGHMDGVLTLQFNY--RLLFTGS-YDTTVAIWDLFTGKLIRRLTGHSDGVKTL-YF 382

Query: 422 NDDLVISASMDGSVRIWSVV 441
           +D  +I+ S+D ++R+W+ +
Sbjct: 383 DDQKLITGSLDKTIRVWNYI 402

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 36/194 (18%), Positives = 76/194 (39%), Gaps = 13/194 (6%)

Query: 251 ELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAIN 310
           ++I++   +  +++W+ + R       H   +  +K +  S    S   D    +W+   
Sbjct: 425 KIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRT 484

Query: 311 GIILQHFEPEQKLENNTESLGVDIEWVDKDKLVV----PGVNGSILVYSIDDNKPIGKLL 366
              L+ F            L +    +D   LV     PG    I      ++ P   + 
Sbjct: 485 NTCLRVFRGHVGQVQKVIPLTI----IDAQNLVTHERKPGEEDDIASNGTGEDDPENGVN 540

Query: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLV 426
           G +     + +  +    L S   D +I++W  +   C    +GH + +  ++  ++  +
Sbjct: 541 GQRELDKKMPYPTH----LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIA-ADNFRI 595

Query: 427 ISASMDGSVRIWSV 440
           IS S DGS++IW +
Sbjct: 596 ISGSHDGSIKIWDL 609

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 52/99 (52%), Gaps = 4/99 (4%)

Query: 342 LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK 401
           L     + ++ ++       I +L GH   +  I F+   + ++T+S  D +IR+W+   
Sbjct: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD--DQKMITAS-LDKTIRVWNYIT 381

Query: 402 ENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV 440
            +C + + GH  S++S+      +++SAS D +V++W V
Sbjct: 382 GSCISTYRGHQDSVLSVDSYK-KIIVSASADKTVKVWHV 419

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 4/75 (5%)

Query: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLV 426
           GH   +  ++FN   RLL T S  D ++ IW  +  N      GH+  +  + + +D  +
Sbjct: 310 GHMDGVLSLKFN--HRLLFTGS-YDSTVAIWDTKSGNLIRRLTGHTDGVKGI-YFDDQKM 365

Query: 427 ISASMDGSVRIWSVV 441
           I+AS+D ++R+W+ +
Sbjct: 366 ITASLDKTIRVWNYI 380

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 51/240 (21%), Positives = 95/240 (39%), Gaps = 36/240 (15%)

Query: 231 SSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNED 290
           S I+  + +Q + LS     ++I+++  +  +++W+ + R       H   +  +K +  
Sbjct: 383 SCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPK 442

Query: 291 SKHFISLDLDNITILW----NAINGIILQHFEPEQKLE----NNTESLGVD--IEWVDKD 340
           S    S   D    +W    N+   +   H    QK+      +TE+L VD  IE V   
Sbjct: 443 SFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNP 502

Query: 341 KL----------------------VVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFN 378
           +L                      +   ++ +I ++ +   + I    GH   +  I  +
Sbjct: 503 ELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAAD 562

Query: 379 VNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIW 438
            N R++  S   D SI++W  Q   C   F GH   I+ +  I D   +S    G V++W
Sbjct: 563 -NFRIV--SGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVG-IGDSSFVSGDELGEVKMW 618

>Kwal_27.12667
          Length = 721

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 70/153 (45%), Gaps = 23/153 (15%)

Query: 313 ILQHFEPEQKLENNTESLGVDIEWVDKD----KLVVPG-VNGSILVYSIDDNKPIGKLLG 367
           + Q +EP  ++ +  ++    I  +D D     +   G ++ S+ ++++     IG L G
Sbjct: 386 LQQFYEPGTQISSFPKAHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPG 445

Query: 368 HQGTISCIEFNVNSRLLLTSSDSDYSIRIW--------------HGQKENCCNCFYGHSQ 413
           H  ++SC++   +S  L+T    D  +++W               G++E C + F  H  
Sbjct: 446 HLASVSCMQME-DSHSLITGG-RDALLKLWDIEKAEELYNDGATEGEEELCVHTFDAHVD 503

Query: 414 SIISLSWINDDLVISASMDGSVRIWSVVEN-CL 445
            I +L +  + LV S S D ++R W +    CL
Sbjct: 504 EITALHFEGNSLV-SGSQDRTIRQWDLTTGKCL 535

 Score = 32.7 bits (73), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 56/277 (20%), Positives = 95/277 (34%), Gaps = 73/277 (26%)

Query: 211 YNKEDKKIISSLELRHPFALSSITGR-----------KTNQITALSWS---------PDG 250
           + K     I+ L+   PF      G+           K  QI AL             D 
Sbjct: 399 FPKAHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLASVSCMQMEDS 458

Query: 251 ELIITSVENGELRLWN--------KDGRLQ-------NVFNFHRSPIVSIKWNEDSKHFI 295
             +IT   +  L+LW+         DG  +       + F+ H   I ++ +  +S   +
Sbjct: 459 HSLITGGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFDAHVDEITALHFEGNS--LV 516

Query: 296 SLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYS 355
           S   D     W+   G  LQ                +DI + ++      G +G      
Sbjct: 517 SGSQDRTIRQWDLTTGKCLQT---------------IDINFANR------GTSGGF--SK 553

Query: 356 IDDNKPIGK-LLGHQ-----GTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFY 409
           I  N P    LL H      G + C +        + +   D  +R+W  +         
Sbjct: 554 ISSNNPRSSILLTHNDPPVIGALQCYD------AAMATGTKDGLVRLWDLRSGQVIRTLE 607

Query: 410 GHSQSIISLSWINDDLVISASMDGSVRIWSVVENCLV 446
           GH+ ++  L + + +LV + S+D S+RIW +    L 
Sbjct: 608 GHTDAVTGLQFDSVNLV-TGSLDRSIRIWDLRTGLLA 643

>Scas_685.11
          Length = 384

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 73/165 (44%), Gaps = 38/165 (23%)

Query: 295 ISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVY 354
           +SLDL   T L+  I      HF+          +L V    V K  LV    +  I +Y
Sbjct: 20  LSLDLSLKTPLFTPI-----FHFQ--------AHALSVKCLDVSKRYLVSGSNDEHIRIY 66

Query: 355 SIDDNKPIGKLLGHQGTISCIEFN-----------VNSRLLLTSSDSDYSIRIWHGQKEN 403
            +   K +G LL HQG+I+ ++F+            N++ LL++S+ D  I IW  +   
Sbjct: 67  DLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASE-DNKIIIWRVKDWE 125

Query: 404 CCNCFYGHSQSIISLSWIND-------DLVISASMDGSVRIWSVV 441
                 GH      ++ IND        + IS S D S+R+W+++
Sbjct: 126 NFGTLKGH------IARINDVDIHPSNRVAISVSEDHSIRLWNLM 164

>ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH]
           complement(647933..649102) [1170 bp, 389 aa]
          Length = 388

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 55/112 (49%), Gaps = 12/112 (10%)

Query: 341 KLVVPGVNGS-ILVYSIDDNKPIGKLLGHQGTISCIEFNVNS----------RLLLTSSD 389
           + +V G N   I +Y +   K +G LL H G+I+ + F+  +          + LL++S+
Sbjct: 52  RYLVSGSNDEHIRIYDLQKRKELGTLLNHNGSITSLRFSRATTDKDGKQQGNKWLLSASE 111

Query: 390 SDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVV 441
            D++I IW  +         GH+  I  L     + V S S D S+R+W+++
Sbjct: 112 -DHTIIIWRVKDWENFGKLKGHNARINDLDIHPSNRVASVSEDHSIRLWNLM 162

>KLLA0C07513g complement(656060..657379) similar to sp|P39946
           Saccharomyces cerevisiae YOR269w PAC1 singleton, start
           by similarity
          Length = 439

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 2/77 (2%)

Query: 362 IGKLLGHQGTIS-CIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW 420
           I  L GH+ T+S C  F   + LLL +   D  ++IW      C   F  H+Q I SL  
Sbjct: 194 IKTLAGHEHTVSDCQFFERGADLLLATCSRDLYLKIWDISNGWCIKSFQPHTQWIRSLH- 252

Query: 421 INDDLVISASMDGSVRI 437
           ++ + V++ S D ++R+
Sbjct: 253 VHGEFVLTGSNDSAIRL 269

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 63/157 (40%), Gaps = 35/157 (22%)

Query: 360 KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH----------GQKENCCNCFY 409
           + IG + GH  TISC++ + N  ++ T S  D ++++W+          G      +   
Sbjct: 438 RQIGAMEGHVATISCMQVDKNYNMVATGS-KDATVKLWNANDVIGRYEEGNNSEALHTLD 496

Query: 410 GHSQSIISLSWINDDLVISASMDGSVRIWSVVENCLV----------------------- 446
            H   + SL +I+   +++AS D ++R W +     +                       
Sbjct: 497 AHLDEVSSL-YIDGANLMTASQDKTIRRWDLYSGKCIQVFDVNFPSLSAYKSSFMKSNED 555

Query: 447 GMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIK 483
            M +   N  I G I       A G+ +G I ++D++
Sbjct: 556 SMILKTVNTPIIGSIQSFDAALATGTKDGLIRLWDMR 592

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 42/82 (51%), Gaps = 3/82 (3%)

Query: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW-INDDL 425
            H   I+C++F+ +   L T+   D+ +++W   K+       GH  +I  +    N ++
Sbjct: 402 AHDDAITCLDFDPHFSTLCTAGYMDHIVKLWDYTKKRQIGAMEGHVATISCMQVDKNYNM 461

Query: 426 VISASMDGSVRIWSVVENCLVG 447
           V + S D +V++W+   N ++G
Sbjct: 462 VATGSKDATVKLWNA--NDVIG 481

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 385 LTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVVENC 444
           L +   D  IR+W  +         GH  +I SL + +   +IS S+DG++R+W +  N 
Sbjct: 577 LATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKF-DATTIISGSLDGTIRLWDLRSNN 635

Query: 445 LV 446
           L 
Sbjct: 636 LT 637

>CAGL0J01287g 120215..122047 similar to sp|P46680 Saccharomyces
           cerevisiae YMR092c AIP1, hypothetical start
          Length = 610

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/233 (19%), Positives = 96/233 (41%), Gaps = 28/233 (12%)

Query: 233 ITGRKTNQITALSWSPDGELIITSVENGELRLW--NKDGR------LQNVFNFHRSPIVS 284
            TG   N ++ + ++P G  + +  E+G++ +W  N+DG       ++  F     P+  
Sbjct: 63  FTGHGAN-VSVVRFAPVGAYMCSGDESGKVIVWSWNRDGDGGVECVVKAEFQVLAGPVTD 121

Query: 285 IKWNEDSKHFISL----DLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKD 340
           I W+ + K    +    D   + I W+  N +        +   +++    V I+     
Sbjct: 122 ISWDFEGKRLCVVGEGRDKFGVFISWDTGNSL-------GEVTAHSSRVNAVHIKQSRPM 174

Query: 341 KLVVPGVNGSILVYSIDDNKPIGKLLGHQGT---ISCIEFNVNSRLLLTSSDSDYSIRIW 397
           + +  G +G+++ Y     K +     H      +  +EF+  +     +  SD  I  +
Sbjct: 175 RCITVGDDGTVVFYQGPPFKFVSSDRTHHDKGKFVRDVEFSKGAGEFAVTVGSDRKIACF 234

Query: 398 HGQKENCCNCFYGHSQSI----ISLSWINDDLVISASMDGSVRIWSVVEN-CL 445
            G+            + I     ++SW+++   ++AS D  VR+W V E+ CL
Sbjct: 235 DGKSGEFVKYIEDADEPITGGLFAVSWLDETRFVTASADQKVRVWDVRESKCL 287

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 28/142 (19%), Positives = 63/142 (44%), Gaps = 18/142 (12%)

Query: 282 IVSIKWNEDSKHFISLDLDNITILWNAINGIILQHF---EPEQKLENNTESLGVDIEWVD 338
           + ++ W ++++ F++   D    +W+      L  +   EP     N  +   + +    
Sbjct: 256 LFAVSWLDETR-FVTASADQKVRVWDVRESKCLHSWTIGEP-----NTLQQQQIGVVAAK 309

Query: 339 KDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH 398
            D+++   ++G++    I ++KP+  + GH  +I+ +  N     L+T S   Y  RI  
Sbjct: 310 DDQIISLSLDGTLNFLKIGEDKPVRTMHGHNKSITALAVN----PLVTGS---YDGRIMQ 362

Query: 399 GQKENCCNCFY--GHSQSIISL 418
              E  C+     GH+  ++S+
Sbjct: 363 WVPEKICDSKMQTGHTNLVVSI 384

>KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomyces
           cerevisiae YLR222c, start by similarity
          Length = 814

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 3/82 (3%)

Query: 342 LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFN--VNSRLL-LTSSDSDYSIRIWH 398
           L + G +GS+ V  I++      L GH  TIS ++F+  +NS +  L S D++  I++W 
Sbjct: 116 LAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMIKVWD 175

Query: 399 GQKENCCNCFYGHSQSIISLSW 420
             K NC      H+ ++  L +
Sbjct: 176 LVKRNCQCTIQEHTTAVRGLDF 197

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 53/124 (42%), Gaps = 2/124 (1%)

Query: 353 VYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHS 412
           ++++DD +    L  H+  +  + F    +LL T S  D +I+IW  +         GH+
Sbjct: 521 IWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCS-GDKTIKIWSLESYAVVKTLEGHT 579

Query: 413 QSIISLSWIN-DDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIG 471
            ++   S+IN +  +IS   DG V IW +     V       N I    + +D   F   
Sbjct: 580 NAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALAVMNDGESFVTA 639

Query: 472 SMNG 475
             +G
Sbjct: 640 DADG 643

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 33/164 (20%), Positives = 71/164 (43%), Gaps = 10/164 (6%)

Query: 241 ITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDL 299
           I A+S SP+  L  T+  +   ++WN  DG  Q     H+  +  + + +  K   +   
Sbjct: 498 INAISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSG 557

Query: 300 DNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDK-LVVPGVNGSILVYSIDD 358
           D    +W+      L+ +   + LE +T ++     +++K+K L+  G +G ++++ +  
Sbjct: 558 DKTIKIWS------LESYAVVKTLEGHTNAVQ-RCSFINKNKQLISTGADGLVIIWDLST 610

Query: 359 NKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKE 402
            + +  L  H   I  +   +N      ++D+D     W    E
Sbjct: 611 GESVKTLDAHNNRIWALAV-MNDGESFVTADADGFFEFWRDNSE 653

>YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of the
           COPII coat of secretory pathway vesicles involved in
           endoplasmic reticulum to Golgi transport, associated
           with Sec13p, member of WD (WD-40) repeat family [3822
           bp, 1273 aa]
          Length = 1273

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 57/120 (47%), Gaps = 8/120 (6%)

Query: 386 TSSDSDYSIRIWHGQKENCC--NCFYGHSQSIISLSWINDD--LVISASMDGSVRIWSVV 441
           T SD+D SI IW  +  N        GH + I+SL W + D  L++S+  D +V +W+  
Sbjct: 229 TGSDNDPSILIWDLRNANTPLQTLNQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWNPE 288

Query: 442 ENCLVGMAMVDGNAIICGKISHD-KNKFAIGSMNGQINVYDIKRFVSRLLKRD---KKQE 497
               +      GN     K + +  + FA  S + +I V  ++   + L +++   K+QE
Sbjct: 289 SAEQLSQFPARGNWCFKTKFAPEAPDLFACASFDNKIEVQTLQNLTNTLDEQETETKQQE 348

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 71/168 (42%), Gaps = 23/168 (13%)

Query: 333 DIEWVDKDKLVVPGV-NGSILVYSIDDNK----PIGKLLGHQGTISCIEFNVNSRLLLTS 387
           D++W   +K++   + NGS+ +YS ++       + +   H  ++  ++FN     +L S
Sbjct: 67  DLDWSHNNKIIAGALDNGSLELYSTNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLAS 126

Query: 388 SDSDYSIRIWHGQK-----ENCCNCFYGHSQS----IISLSWINDDLV---ISASMDGSV 435
             ++  I IW   K      N      G S S    +ISL+W N  L     SA      
Sbjct: 127 GGNNGEIFIWDMNKCTESPSNYTPLTPGQSMSSVDEVISLAW-NQSLAHVFASAGSSNFA 185

Query: 436 RIWSV-VENCLVGMAMVDGNAIICGKIS----HDKNKFAIGSMNGQIN 478
            IW +  +  ++ ++    N+ I  ++S    H KN   + +  G  N
Sbjct: 186 SIWDLKAKKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDN 233

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 88/205 (42%), Gaps = 27/205 (13%)

Query: 259 NGELRLWNKDGRLQNVFNFHR-SP---------IVSIKWNEDSKH-FISLDLDNITILWN 307
           NGE+ +W+ +   ++  N+   +P         ++S+ WN+   H F S    N   +W+
Sbjct: 130 NGEIFIWDMNKCTESPSNYTPLTPGQSMSSVDEVISLAWNQSLAHVFASAGSSNFASIWD 189

Query: 308 --AINGII-LQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGS-----ILVYSIDD- 358
             A   +I L +  P   ++   + L V +EW  K+   V    GS     IL++ + + 
Sbjct: 190 LKAKKEVIHLSYTSPNSGIK---QQLSV-VEWHPKNSTRVATATGSDNDPSILIWDLRNA 245

Query: 359 NKPIGKL-LGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIIS 417
           N P+  L  GHQ  I  +++      LL SS  D ++ +W+ +     + F         
Sbjct: 246 NTPLQTLNQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWNPESAEQLSQFPARGNWCFK 305

Query: 418 LSWIND--DLVISASMDGSVRIWSV 440
             +  +  DL   AS D  + + ++
Sbjct: 306 TKFAPEAPDLFACASFDNKIEVQTL 330

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/248 (19%), Positives = 106/248 (42%), Gaps = 44/248 (17%)

Query: 237 KTNQITALSWSPDGELIITSVENGELRLW----------------NKDGRLQ--NVFNFH 278
           K+ ++     SPD + + T   +G++R+W                +KD  ++  +  + H
Sbjct: 16  KSYEVYTCDVSPDSQRLATGGLDGKIRIWSIPDILKFASNPNASTDKDILMKPLSTMSRH 75

Query: 279 RSPIVSIKWNEDSKHFISLDLDNITILWNAINGII----------LQHFEPEQKLENNTE 328
              + ++K++ D K+  S   D I ++W    G            ++H+   ++L  +  
Sbjct: 76  AGSVTTVKFSPDGKYLASGSDDRILLIWELEGGTTQPMFGAESTDIEHWNVRRRLVAHDN 135

Query: 329 SLGVDIEWV-DKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTS 387
            +  DI W  D   +V  G++ +I++++    + + +   HQ  +  + F+  ++   T+
Sbjct: 136 DIQ-DICWAPDSSIMVSVGLDRAIIIWNGSTFEKVKRFDVHQSHVKGVVFDPANKYFATA 194

Query: 388 SDSDYSIRIWHGQKEN---------CCNCFYGHSQSII--SLSWINDDLVISA--SMDGS 434
           SD D +I+++   K               F G   +     LSW  D   I+A  +M+G 
Sbjct: 195 SD-DRTIKMFRYHKTGETSFSVEHVITEPFKGSPLTTYFRRLSWSPDGQHIAAPNAMNGP 253

Query: 435 VRIWSVVE 442
           V   +++E
Sbjct: 254 VSTVAIIE 261

 Score = 36.2 bits (82), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 62/159 (38%), Gaps = 40/159 (25%)

Query: 314 LQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDD--------------- 358
           LQH E  +  E  T     D+   D  +L   G++G I ++SI D               
Sbjct: 9   LQHREEHKSYEVYT----CDVS-PDSQRLATGGLDGKIRIWSIPDILKFASNPNASTDKD 63

Query: 359 --NKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCF-------- 408
              KP+  +  H G+++ ++F+ + + L + SD D  + IW  +       F        
Sbjct: 64  ILMKPLSTMSRHAGSVTTVKFSPDGKYLASGSD-DRILLIWELEGGTTQPMFGAESTDIE 122

Query: 409 --------YGHSQSIISLSWIND-DLVISASMDGSVRIW 438
                     H   I  + W  D  +++S  +D ++ IW
Sbjct: 123 HWNVRRRLVAHDNDIQDICWAPDSSIMVSVGLDRAIIIW 161

 Score = 35.8 bits (81), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 44/107 (41%), Gaps = 17/107 (15%)

Query: 232 SITGRKTNQITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNF------------- 277
           S   R    +T + +SPDG+ + +  ++  L +W  + G  Q +F               
Sbjct: 70  STMSRHAGSVTTVKFSPDGKYLASGSDDRILLIWELEGGTTQPMFGAESTDIEHWNVRRR 129

Query: 278 ---HRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQ 321
              H + I  I W  DS   +S+ LD   I+WN      ++ F+  Q
Sbjct: 130 LVAHDNDIQDICWAPDSSIMVSVGLDRAIIIWNGSTFEKVKRFDVHQ 176

>Scas_721.128
          Length = 851

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 78/352 (22%), Positives = 141/352 (40%), Gaps = 69/352 (19%)

Query: 150 ADIEDISIHNDTEDSAESSFFAKTLNEVQTLDNKVVTSSWNLQN---ERLLAYGQEDSMA 206
            D+E++  H  T  SA+   F K  N +Q    K+   SWN  +   E+   Y +E    
Sbjct: 72  PDLEEVPSHVKTA-SADVDSFYKVRNRLQ----KIADPSWNFSSIDQEQFEIYLKEPEYI 126

Query: 207 KMIEYNK---EDKKIISSLELRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELR 263
           K+ + ++   E K++  + EL       ++T  K N  TA +     + I T        
Sbjct: 127 KVFKKHEDLEEFKRLFLAQEL-------NVTTTKENDPTAQNTDASNKAIWT-------- 171

Query: 264 LWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKL 323
                                +K++ D K+  +   D   +LW  I+  + + +E ++  
Sbjct: 172 ---------------------LKFSHDGKYMATGSKDGCVMLWKVISSPV-ERWELDRAE 209

Query: 324 ENNTESLGVDIEW-----VDKDKLVVPGVNG------SILVYS-IDDNKPIGKLLGHQGT 371
           E+N  ++   I        ++  L  P          S+ +Y+ I    P+     H   
Sbjct: 210 ESNLVAMAKSIRIKQNLETNEAHLNAPSRPPTDTNLESLNLYAPIFHPNPVRIYKEHSHD 269

Query: 372 ISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW--INDDLVISA 429
           I  ++++ N+ LL  S D    + +WH  +E     F  H   + S+ +   +D   +S 
Sbjct: 270 ILDLDWSKNNFLLTASMDK--LVSLWHPDRETSLKSF-PHPDFVTSVRFHPKDDRFFVSG 326

Query: 430 SMDGSVRIWSVVENCLVGMAMVDGNAIICG-KISHDKNKFA-IGSMNGQINV 479
            +D   R+WS++EN +V     D   +I    IS    +F  IG+ NG I +
Sbjct: 327 CLDHKCRMWSILENKVV--YEFDCQDLITAISISPGVGEFTIIGTFNGYITI 376

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 45/99 (45%), Gaps = 2/99 (2%)

Query: 358 DNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIIS 417
           D KP+  L GH   +  + F+  +  +L SS  DY+++IW   +E        H   + S
Sbjct: 141 DLKPVRMLSGHSRKVGHLLFHPLAENILASSSLDYTVKIWDISQEEVKFTL-KHPDMVTS 199

Query: 418 LSWIND-DLVISASMDGSVRIWSVVENCLVGMAMVDGNA 455
           +S+  D   +++ S D  +R+W V    +V        A
Sbjct: 200 MSFSYDGKHLVTVSRDKKLRVWDVRAEKIVSEGPAHSGA 238

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 399 GQKENCCNCFYGHSQSIIS--LSWINDDLVISASMDGSVRIWSVVEN 443
           G+  +    F GH+  ++    S  ND +V S S DG + IW + E+
Sbjct: 80  GKIPDQVPLFRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPED 126

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 88/193 (45%), Gaps = 14/193 (7%)

Query: 253 IITSVENGELRLWNKDGRLQNV-FNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAING 311
           II   ++  +R++N +   + V F  H   I SI  +    + +S   D    LWN  N 
Sbjct: 70  IIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENN 129

Query: 312 IIL-QHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLL-GHQ 369
             L Q FE  +        + V     D        ++ ++ V+S+  + P   L  G +
Sbjct: 130 WALEQTFEGHEHF-----VMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQE 184

Query: 370 GTISCIEFNV--NSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDL-- 425
             ++ +++    +   ++T+SD D +I+IW  Q ++C     GH  S +S +  +  L  
Sbjct: 185 RGVNYVDYYPLPDKPYMITASD-DLTIKIWDYQTKSCVATLEGH-MSNVSFAVFHPTLPI 242

Query: 426 VISASMDGSVRIW 438
           +IS S DG+++IW
Sbjct: 243 IISGSEDGTLKIW 255

>CAGL0F06853g 671942..673108 highly similar to sp|P20484
           Saccharomyces cerevisiae YKL021c MAK11 involved in cell
           growth and replication of M1 dsRNA virus, hypothetical
           start
          Length = 388

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 60/123 (48%), Gaps = 11/123 (8%)

Query: 329 SLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEF---------NV 379
           SL V    + K  LV    +  I +Y +   K +G LL HQG+I+ ++F         + 
Sbjct: 41  SLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKVSDQEPKST 100

Query: 380 NSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLS-WINDDLVISASMDGSVRIW 438
           + + LL++S+ D  I +W  +         GH+  I  +    ++ +V S S D S+R+W
Sbjct: 101 SGKWLLSASE-DNKIIVWRVKDWENFGTLKGHTARINDMDIHPSNRVVASVSEDHSIRLW 159

Query: 439 SVV 441
           +++
Sbjct: 160 NLM 162

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 63/136 (46%), Gaps = 9/136 (6%)

Query: 349 GSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCF 408
           G I   +  D  P+  L+GH+G +  +    N    + SS  D + ++WH    +     
Sbjct: 79  GGISPLATTDEDPVYMLIGHKGNVCSLSSKNN---FVISSSWDKTAKVWHNG--SAIYDL 133

Query: 409 YGHSQSIISLSWIND-DLVISASMDGSVRIWSVVENCLV-GMAMVDGNAIICGKISHDKN 466
            GHS S+    ++ + D  ++AS D ++++W    N L+   + +  + I    IS D  
Sbjct: 134 VGHSASVWDAKFLPEKDFFLTASADCTIKLWH--GNKLIKTFSGIHKDVIRHLDISPDGE 191

Query: 467 KFAIGSMNGQINVYDI 482
            FA  S +G + + D+
Sbjct: 192 TFASCSNDGTVKINDM 207

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 12/59 (20%)

Query: 410 GHSQSIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKF 468
           GH Q + S+  IND  V S S DG+VR+WS            + + +  G I+H+  KF
Sbjct: 10  GHEQDVKSVVAINDSQVASCSRDGTVRVWS------------NNDGVWNGVIAHNSEKF 56

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 45/118 (38%), Gaps = 41/118 (34%)

Query: 362 IGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK-------------------- 401
           I  L+GH  ++   +F       LT+S +D +I++WHG K                    
Sbjct: 130 IYDLVGHSASVWDAKFLPEKDFFLTAS-ADCTIKLWHGNKLIKTFSGIHKDVIRHLDISP 188

Query: 402 -----ENCCN---------------CFYGHSQSIISLSWINDDLVISASMDGSVRIWS 439
                 +C N                F GH   + S+ ++ +  ++S   D SVR+WS
Sbjct: 189 DGETFASCSNDGTVKINDMDGNILKTFTGHESFVYSVKFLPNGDLVSCGEDRSVRVWS 246

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 30/58 (51%)

Query: 230 LSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKW 287
           + + +G   + I  L  SPDGE   +   +G +++ + DG +   F  H S + S+K+
Sbjct: 170 IKTFSGIHKDVIRHLDISPDGETFASCSNDGTVKINDMDGNILKTFTGHESFVYSVKF 227

>Scas_719.30
          Length = 940

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 74/148 (50%), Gaps = 10/148 (6%)

Query: 305 LWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGK 364
           ++N  +GI+ + +   +K        G+ ++ +++ K+V  G++G +  Y  + +  +GK
Sbjct: 487 VFNMQSGILRKKYRLHKKTVT-----GIALDGMNR-KMVSCGLDGIVGFYDFNKSTFLGK 540

Query: 365 LLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDD 424
           L      I+ + ++ +S L     D D SI +     +     F+GHS  I +L +  D 
Sbjct: 541 LQ-LDAPITKMVYHRSSDLFALILD-DLSIVLIDAVTQRVVRQFWGHSNRITALDFSPDG 598

Query: 425 L-VISASMDGSVRIWSV-VENCLVGMAM 450
             ++SAS+D ++R W +    C+ G+ +
Sbjct: 599 RWIVSASLDSTIRTWDLPTGGCIDGIKL 626

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 21/29 (72%)

Query: 238 TNQITALSWSPDGELIITSVENGELRLWN 266
           +N+ITAL +SPDG  I+++  +  +R W+
Sbjct: 586 SNRITALDFSPDGRWIVSASLDSTIRTWD 614

>KLLA0B07667g 667863..673862 weakly similar to sp|P25356 Saccharomyces
            cerevisiae YCR032w BPH1g to human beige-like protein and
            mouse lysosomal trafficking regulator singleton, start by
            similarity
          Length = 1999

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 57/117 (48%), Gaps = 5/117 (4%)

Query: 238  TNQITALSWSPDGELIITSVENGELRLW--NKDG-RLQNVFNFHRSPIVSIKWNEDSKHF 294
            +++IT LS + D  LI T    G ++LW  +KDG      F  H S I SI+ +      
Sbjct: 1780 SSKITVLS-NFDQSLIATGDSIGLIKLWRTSKDGLTFLRCFCGHESSIKSIRASLQCDTI 1838

Query: 295  ISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSI 351
            ISLD    TI+W+  NG ++  F    KL   + + G  +    +  + +  +NGSI
Sbjct: 1839 ISLDTHGTTIVWDLKNGTVINKFSIMAKLVAISPTTG-SVSIAGEKGISIFDLNGSI 1894

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 76/161 (47%), Gaps = 20/161 (12%)

Query: 341 KLVVPGVNGSILVYSI--DDNKPI-GKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           K+V  G   +I ++     +NK +   L GH+  ++C+ F  +S  ++++S+ D+ ++IW
Sbjct: 28  KIVAFGAGKTIALWDPIEPNNKGVYATLKGHEAEVTCVRFVPDSDFMVSASE-DHHVKIW 86

Query: 398 HGQKEN---CCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV-VENCLVGMA---- 449
                +   C      +S++I++LS +   L+     DG++ IW   ++N   G+A    
Sbjct: 87  KFTDYSHLQCIQTIQHYSKTIVALSAL-PSLISVGCADGTISIWRQNIQNDEFGLAHEFT 145

Query: 450 ----MVDGNAIICGKISHDKNKFAIGSMNGQINVYDIKRFV 486
                     +   K+   K   AIG  N  +NV+ I  F+
Sbjct: 146 IKKGFFYPLCLSLSKVEEKKYLLAIGGTN--VNVF-IASFI 183

 Score = 33.1 bits (74), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 47/98 (47%), Gaps = 20/98 (20%)

Query: 240 QITALSWSPDGELIITS-----VENGELRLWNKDGRLQ--NVFNFHRSPIVSIKWNEDSK 292
           +IT L  SPD +LI ++     V+N  +R+++ +  L+      FH   I  +K+++D K
Sbjct: 560 EITCLDISPDQKLIASACRSNNVQNAVIRIFSTENWLEIKPALPFHSLTITRLKFSKDGK 619

Query: 293 HFISLDLDNITILWNAINGIILQHFEPEQKLENNTESL 330
             +S+  D    LW             E+ +E+NT  L
Sbjct: 620 FLLSVCRDRKWALW-------------ERNMEDNTFEL 644

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 65/162 (40%), Gaps = 43/162 (26%)

Query: 314 LQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDD--------------- 358
           L H E  +K E  T    VD+   D  +L   G++G I ++SID                
Sbjct: 9   LAHREESRKYEIYT----VDVSH-DGKRLATGGLDGKIRIWSIDSILRCMELESLTPEIP 63

Query: 359 -----NKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYG--- 410
                  P+  +  H G+I+C++F+ + + L + SD D  + IW   +E      +G   
Sbjct: 64  LPQDLQMPLCSMSRHTGSITCVKFSPDGKYLASGSD-DRILLIWALDEEQSSQPAFGSEH 122

Query: 411 -------------HSQSIISLSWIND-DLVISASMDGSVRIW 438
                        H   I  + W  D  ++++  +D SV +W
Sbjct: 123 EREHWTVRKRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVW 164

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 56/138 (40%), Gaps = 20/138 (14%)

Query: 203 DSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQITALSWSPDGELIITSVENGEL 262
           DS+ + +E      +I    +L+ P    S   R T  IT + +SPDG+ + +  ++  L
Sbjct: 47  DSILRCMELESLTPEIPLPQDLQMPLCSMS---RHTGSITCVKFSPDGKYLASGSDDRIL 103

Query: 263 RLWNKDGRLQNVFNF-----------------HRSPIVSIKWNEDSKHFISLDLDNITIL 305
            +W  D    +   F                 H + I  I W  DS   +++ LD   I+
Sbjct: 104 LIWALDEEQSSQPAFGSEHEREHWTVRKRLVAHDNDIQDICWAPDSSILVTVGLDRSVIV 163

Query: 306 WNAINGIILQHFEPEQKL 323
           WN      L+ F+  Q L
Sbjct: 164 WNGSTFEKLKRFDVHQSL 181

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 84/196 (42%), Gaps = 38/196 (19%)

Query: 240 QITALSWSPDGELIITSVENGELRLWNKDGRLQNV---------------------FNFH 278
           +I  +  S DG+ + T   +G++R+W+ D  L+ +                      + H
Sbjct: 19  EIYTVDVSHDGKRLATGGLDGKIRIWSIDSILRCMELESLTPEIPLPQDLQMPLCSMSRH 78

Query: 279 RSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGV------ 332
              I  +K++ D K+  S   D I ++W A++    Q  +P    E+  E   V      
Sbjct: 79  TGSITCVKFSPDGKYLASGSDDRILLIW-ALDE--EQSSQPAFGSEHEREHWTVRKRLVA 135

Query: 333 ------DIEWV-DKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLL 385
                 DI W  D   LV  G++ S++V++    + + +   HQ  +  + F+  ++   
Sbjct: 136 HDNDIQDICWAPDSSILVTVGLDRSVIVWNGSTFEKLKRFDVHQSLVKGVVFDPANKYFA 195

Query: 386 TSSDSDYSIRIWHGQK 401
           T+SD D +++I+   K
Sbjct: 196 TTSD-DRTMKIFRYHK 210

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 78/174 (44%), Gaps = 15/174 (8%)

Query: 275 FNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDI 334
           F  H   +       D  + +S   D    LW+   G   Q F     + + ++ + VDI
Sbjct: 61  FKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRF-----VGHKSDVMSVDI 115

Query: 335 EWVDKDKLVVPGV-NGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSR-----LLLTSS 388
           +   K  +++ G  + +I V++I   + +  LLGH   +S +    N +     + + S+
Sbjct: 116 D--KKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISA 172

Query: 389 DSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDD-LVISASMDGSVRIWSVV 441
            +D  ++ W+  +      F GH+ +I +L+   D  L+ SA  DG + +W++ 
Sbjct: 173 GNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLA 226

 Score = 36.6 bits (83), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 7/97 (7%)

Query: 357 DDNK---PIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQ 413
           DD K   P+    GH   +       +    L++S  D ++R+W          F GH  
Sbjct: 50  DDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSAS-WDKTLRLWDVATGETYQRFVGHKS 108

Query: 414 SIISLSWIND--DLVISASMDGSVRIWSVVENCLVGM 448
            ++S+  I+    ++IS S D ++++W++   CL  +
Sbjct: 109 DVMSVD-IDKKASMIISGSRDKTIKVWTIKGQCLATL 144

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 235 GRKTNQITALSWSPDGELIITSVENGELRLWN 266
           G  +N I  L+ SPDG LI ++ ++GE+ LWN
Sbjct: 194 GHNSN-INTLTASPDGTLIASAGKDGEIMLWN 224

>Kwal_33.13515
          Length = 398

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 38/72 (52%), Gaps = 3/72 (4%)

Query: 239 NQITALSWSPDGELIITSVENGELRLWNKDG---RLQNVFNFHRSPIVSIKWNEDSKHFI 295
           N++TAL WS DG+ +    E+GE+ L+  +    +L+     H   I  +K + D++  +
Sbjct: 193 NKVTALQWSHDGKWLYAGFESGEIVLFEVEMAAVKLKVRACGHTGAITCMKLDPDNRFLV 252

Query: 296 SLDLDNITILWN 307
           +  LD I   W+
Sbjct: 253 AGSLDTICSFWD 264

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 52/266 (19%), Positives = 99/266 (37%), Gaps = 57/266 (21%)

Query: 228 FALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSP------ 281
           F  S+ T  + N++ +L ++     +  S E+G L ++        V++  +        
Sbjct: 41  FGSSASTAIEPNRVLSLEFNNRANYLAYSREDGTLNVFRLKSDRSQVYSVIKGAQCSDVK 100

Query: 282 IVSIKWNEDSKHFISLDLDNIT--ILWNAINGIILQHFE-------------PEQK---- 322
           I SI W+  + +FI   +D  +   +W+A  G +++ FE             P  K    
Sbjct: 101 IRSISWHPVT-NFIMATVDRTSRISIWDASTGALIKSFETGLSSGNYKCYYSPNGKWFGA 159

Query: 323 -----------LENNTESLGVD----------------IEWVDKDKLVVPGV-NGSILVY 354
                      ++ N E   V                 ++W    K +  G  +G I+++
Sbjct: 160 LVENGEFCLFDVDKNYELCSVSQLCAGENLASLNKVTALQWSHDGKWLYAGFESGEIVLF 219

Query: 355 SIDDN--KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHS 412
            ++    K   +  GH G I+C++ + ++R L+  S  D     W      C     G  
Sbjct: 220 EVEMAAVKLKVRACGHTGAITCMKLDPDNRFLVAGS-LDTICSFWDLSSMCCERVINGFD 278

Query: 413 QSIISLSWINDDLVISASMDGSVRIW 438
            SI+ L    D + +    D   RI+
Sbjct: 279 TSILDLDLSRDGVAVGLCSDNQTRIY 304

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 68/164 (41%), Gaps = 16/164 (9%)

Query: 241 ITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDL 299
           + +LS+  DG L+ +   +    LW+ + G        H  PI ++ W+ +     +   
Sbjct: 310 VFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGG 369

Query: 300 DNITILWNAIN------GIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILV 353
           D I  +W+           IL H     ++  + E  G         KLV  G +  I V
Sbjct: 370 DGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGG--------KKLVSCGYDNLINV 421

Query: 354 YSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           YS D    +G L GH   I  ++ + NS  L+ S   D SI++W
Sbjct: 422 YSSDTWLKMGSLAGHTDKIISLDISNNSHFLV-SGGWDRSIKLW 464

>AEL250C [2256] [Homologous to ScYBR195C (MSI1) - SH]
           (168010..169263) [1254 bp, 417 aa]
          Length = 417

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 51/113 (45%), Gaps = 7/113 (6%)

Query: 333 DIEWVDKDKLVVPGVNGSILVYSIDDNKPIG----KLLGHQGTISCIEFNVNSRLLLTSS 388
           D+ W+     ++     S  +  +D   P      K   H G I+ ++FN  + +LL ++
Sbjct: 249 DVSWMVHHSSILAACGESNTIGLLDTRAPDAFKPTKASPHTGGINALQFNYANDMLLCAA 308

Query: 389 DSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISASM---DGSVRIW 438
           DS+  I +W  +  +     + H  S+ +L W  +   I A+    DG ++IW
Sbjct: 309 DSNGGIALWDCRAFSKPLSVFNHGDSVSALQWNPNLPTIVATAGQGDGLIKIW 361

>ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH]
           complement(387122..388393) [1272 bp, 423 aa]
          Length = 423

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 78/161 (48%), Gaps = 12/161 (7%)

Query: 243 ALSWSP--DGELIITSVENGELRLWNKDG--RLQNVFNFHRSPIVSIKWNE-DSKHFISL 297
            L+++P   GEL+  S ++  + LW+ +   + +++   H   +  +KW+E +S  F ++
Sbjct: 191 GLAFNPHISGELLSGS-DDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTV 249

Query: 298 DLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSID 357
             D    + +          EP +KL   +    +      ++ L   GV+  I +Y + 
Sbjct: 250 SEDKTLQVHDK-----RVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMR 304

Query: 358 D-NKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           D + P+  + GHQ +++ +EF+ ++  ++ SS SD    IW
Sbjct: 305 DMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIW 345

>Kwal_47.17465
          Length = 800

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 49/115 (42%), Gaps = 19/115 (16%)

Query: 225 RHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKD-GRLQNVFN------- 276
           + P A  S   R T  +T + +SPDG  + +  ++  L +W KD  + Q +F        
Sbjct: 12  KRPLASMS---RHTGSVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAENDKEH 68

Query: 277 --------FHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKL 323
                    H + I  I W  DS   +++ LD   I+WN      ++ F+  Q L
Sbjct: 69  WNVRRRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWNGSTFEKIKRFDVHQSL 123

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 42/100 (42%), Gaps = 17/100 (17%)

Query: 355 SIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHG---QKE--------- 402
           S D  +P+  +  H G+++ + F+ +   L + SD D  + IW     QK+         
Sbjct: 8   SEDSKRPLASMSRHTGSVTVVRFSPDGNFLASGSD-DRILLIWEKDEDQKQPIFGAENDK 66

Query: 403 ---NCCNCFYGHSQSIISLSWIND-DLVISASMDGSVRIW 438
              N       H   I  + W  D  ++++  +D SV +W
Sbjct: 67  EHWNVRRRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVW 106

>Kwal_26.7570
          Length = 218

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 44/90 (48%), Gaps = 4/90 (4%)

Query: 361 PIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW 420
           P+    GH   +       +    L++S  D ++R+W      C   F GH   ++S++ 
Sbjct: 57  PVRSFRGHSHIVQDCTVTPDGEYALSAS-WDKTVRLWELATGKCIQRFVGHKSDVLSVT- 114

Query: 421 INDDL--VISASMDGSVRIWSVVENCLVGM 448
           I+     ++SAS D +V++W+ +  C+V +
Sbjct: 115 IDRRASQIVSASRDKTVKVWNTLGECMVTL 144

 Score = 33.5 bits (75), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 32/65 (49%), Gaps = 1/65 (1%)

Query: 247 SPDGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITIL 305
           +PDGE  +++  +  +RLW    G+    F  H+S ++S+  +  +   +S   D    +
Sbjct: 74  TPDGEYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKV 133

Query: 306 WNAIN 310
           WN + 
Sbjct: 134 WNTLG 138

>CAGL0J08998g 882655..886500 highly similar to sp|P38968
           Saccharomyces cerevisiae YDL195w SEC31 component of the
           COPII coat of ER-golgi vesicles, start by similarity
          Length = 1281

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 64/131 (48%), Gaps = 23/131 (17%)

Query: 386 TSSDSDYSIRIWHGQKENCC--------NCFYGHSQSIISLSWINDD--LVISASMDGSV 435
           TS+D++  I +W  +  N          N  +GHS+ I+SL W   D  L++S++ D SV
Sbjct: 229 TSNDNEPLILVWDLRNSNTPLQTLSAANNQGHGHSKGILSLDWCQQDENLLLSSARDSSV 288

Query: 436 RIWSVVENCLVGMAMVD----GNAIICGKIS-HDKNKFAIGSMNG-QINVYDIKRFVSRL 489
            +W    N   G A+ +    GN     K +    + FA  +++G +I V  ++ + + L
Sbjct: 289 MLW----NPQSGEALTEYNTTGNWCFKSKFAPQAPDLFAFATLDGKKIEVQTLQNYETTL 344

Query: 490 ---LKRDKKQE 497
              + + K+QE
Sbjct: 345 DEEVSKTKQQE 355

>Kwal_56.24478
          Length = 1296

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 60/133 (45%), Gaps = 8/133 (6%)

Query: 365 LLGHQGTISCIEFNVN--SRLLLTS-SDSDYSIRIWHGQKENCC--NCFYGHSQSIISLS 419
           + G +  +S +E++ N  +R+   S SDSD SI +W  +  N        GH++ ++SL 
Sbjct: 199 ITGQKNQLSIVEWHPNNSTRIATASGSDSDPSILVWDLRNANVPLQTLSQGHTKGVLSLD 258

Query: 420 WINDD--LVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKIS-HDKNKFAIGSMNGQ 476
           W   D  L++S+  D S  +W+      +      GN     K +    + FA  S + +
Sbjct: 259 WCKQDETLLLSSGRDNSCVLWNPESGQNLTQFPTRGNWCFKTKFAPQAPDLFASASFDNK 318

Query: 477 INVYDIKRFVSRL 489
           I V  ++     L
Sbjct: 319 IEVQTLQNITCTL 331

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 46/117 (39%), Gaps = 12/117 (10%)

Query: 333 DIEWVDKDKLVVPGV--NGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDS 390
           D++W   D  V+ G   NG +  +S  + K I KL  H   +  + FN     +L S  S
Sbjct: 67  DLDW-SYDNSVLTGALDNGVVEFFSPSEYKSIAKLAQHSTPVKTVRFNAKQHNVLCSGGS 125

Query: 391 DYSIRIWHGQK---ENCCNCFYGHSQS----IISLSWINDD--LVISASMDGSVRIW 438
              I IW   K           G + +    I SL+W  +   +  SA   G   IW
Sbjct: 126 KGEIYIWDANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQGHVFASAGSSGFASIW 182

>Scas_701.45
          Length = 1276

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 73/321 (22%), Positives = 119/321 (37%), Gaps = 70/321 (21%)

Query: 179 TLDNKVVTSSWNLQNERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKT 238
           T D +     W+  N+ +   G  D   K+  ++KE+     SL+    F       + T
Sbjct: 62  TTDARFKDLDWSFDNKFIA--GALDDNGKIELFSKEENDTKISLKSLGKFK------KHT 113

Query: 239 NQITALSWSPDGELIITSV-ENGELRLWNKDGRLQNVFNFHRSP---------IVSIKWN 288
             +  L ++P  + ++ S   NGE+ +W+ +  L +      +P         I S+ WN
Sbjct: 114 TAVNTLRFNPKQQNVLASAGNNGEILIWDINKTLSSTDYSPSAPGIAMSTQDEIKSVSWN 173

Query: 289 EDSKHFISLDLDNITI--LWN--AINGII-LQHFEPEQKLENNTESLGVDIEWVDKDKLV 343
           +   H  +   D  T   +W+  A   +I L +  P+  L+ N   L V +EW  K    
Sbjct: 174 KSLAHVFASAGDTTTYASIWDLKAKKEVIHLNYTSPKTGLKPN---LAV-VEWHPKVTTY 229

Query: 344 VPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKEN 403
           V   +GS                                      DSD  I IW  +  N
Sbjct: 230 VATASGS--------------------------------------DSDPVILIWDLRNSN 251

Query: 404 C-CNCFYG-HSQSIISLSWINDD--LVISASMDGSVRIWSVVENCLVGMAMVDGNAIICG 459
                  G H++ I+SL W   D  L++S+  DG V +W    N +              
Sbjct: 252 MPMTTLEGPHTKGIMSLDWCTKDESLLLSSGRDGIVALWDTKANEVSTTYPTRSQWCFKT 311

Query: 460 KIS-HDKNKFAIGSMNGQINV 479
           K +  + + FA    +GQINV
Sbjct: 312 KFAPENPDIFASAGFDGQINV 332

>Scas_700.27*
          Length = 433

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 67/144 (46%), Gaps = 5/144 (3%)

Query: 342 LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIE-FNVNSRLLLTSSDSDYSIRIWHGQ 400
           +   G +  + ++ I     +  L+GH+  I+ +    V+ +++  S+D+  +IR+W   
Sbjct: 221 IATAGRDSVVRLWDIRARVAVMTLIGHKNPINKVHCLPVDPQIVSCSTDA--TIRLWDIV 278

Query: 401 KENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAII-CG 459
                     H +S+ ++++   +  +S+     +R W + E  L+     DG  II   
Sbjct: 279 AGKSMKVITHHKKSVRNIAFHPTEFSMSSCSANDIRSWKLPEGGLLTNFNSDGLGIINTL 338

Query: 460 KISHDKNKFAIGSMNGQINVYDIK 483
            I+ D   FA GS NG ++ YD K
Sbjct: 339 SINQDDVLFA-GSDNGMLSFYDYK 361

>YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member of
           the Utp21-specific WD40 associated domain containing
           family, contains seven WD domains (WD-40 repeat), which
           may mediate protein-protein interactions, has high
           similarity to uncharacterized C. albicans Orf6.6423p
           [2820 bp, 939 aa]
          Length = 939

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 79/163 (48%), Gaps = 10/163 (6%)

Query: 294 FISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILV 353
           FI     +ITI +N  +GI+ + ++  ++        G+ ++ +++ K+V  G++G +  
Sbjct: 476 FIGSSNGSITI-YNMQSGILRKKYKLHKRAVT-----GISLDGMNR-KMVSCGLDGIVGF 528

Query: 354 YSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQ 413
           Y  + +  +GKL      I+ + ++ +S L   + D D SI +     +      +GHS 
Sbjct: 529 YDFNKSTLLGKL-KLDAPITAMVYHRSSDLFALALD-DLSIVVIDAVTQRVVRQLWGHSN 586

Query: 414 SIISLSWINDDL-VISASMDGSVRIWSVVENCLVGMAMVDGNA 455
            I +  +  +   ++SAS+D ++R W +     +   +VD  A
Sbjct: 587 RITAFDFSPEGRWIVSASLDSTIRTWDLPTGGCIDGIIVDNVA 629

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 58/281 (20%), Positives = 100/281 (35%), Gaps = 67/281 (23%)

Query: 179 TLDNKVVTS-SWNLQNERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRK 237
           T+  K V S +W   ++ LLA G  DS   +   +  D +  + LE+     L+ I G +
Sbjct: 56  TVHKKAVRSVAWRPHSD-LLAAGSFDSTISIWTQSDLDLEEGAKLEME---LLAIIEGHE 111

Query: 238 TNQITALSWSPDGELIITSVENGELRLWNKDGRLQ-----NVFNFHRSPIVSIKWNEDSK 292
            N++  +SWS DG L+ T   +  + +W  D   +     +V   H   +  + W+    
Sbjct: 112 -NEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHN 170

Query: 293 HFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSIL 352
              S   D+   +W   +                                          
Sbjct: 171 LLASSSYDDTVRIWKDYD------------------------------------------ 188

Query: 353 VYSIDDNKPIGKLLGHQGTISCIEFNVNSR-LLLTSSDSDYSIRIWH-------GQKENC 404
               DD +    L GH+GTI C +F+     + L S   D ++R+W         Q+E  
Sbjct: 189 ----DDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWV 244

Query: 405 CNCFY--GHSQSIISLSWINDDLVISASMDGSVRIWSVVEN 443
           C       H   I  ++W     + S   DG + ++   +N
Sbjct: 245 CESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQN 285

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 357 DDNK---PIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQ 413
           DD K   P+    GH   +       N    L+ S  D ++R+W          F GH  
Sbjct: 50  DDQKFGVPVKSFKGHSHIVQDCTLTENGAYALSGS-WDKTLRLWDVATGETFQTFVGHKG 108

Query: 414 SIISLSWIND--DLVISASMDGSVRIWSVVENCLVGM 448
            ++S++ I+    ++IS S D S+++WS+  +CL  +
Sbjct: 109 DVMSVA-IDKKASMIISGSRDKSIKVWSIKGDCLATL 144

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query: 358 DNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIIS 417
           D KP+  L GH   +  + ++  +  +L SS  DY++++W+ +          H   + S
Sbjct: 129 DIKPVKFLTGHARKVGHVLYHPVAENVLASSSGDYTVKLWNVETGKDMITLK-HPDMVTS 187

Query: 418 LSWIND-DLVISASMDGSVRIWSVVENCLV 446
           +S+  D + + + + D  +R+W++ E  +V
Sbjct: 188 MSFSYDGNYLATVARDKKLRVWNIREEKIV 217

 Score = 29.6 bits (65), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 22/34 (64%)

Query: 233 ITGRKTNQITALSWSPDGELIITSVENGELRLWN 266
           IT +  + +T++S+S DG  + T   + +LR+WN
Sbjct: 177 ITLKHPDMVTSMSFSYDGNYLATVARDKKLRVWN 210

>Kwal_47.17555
          Length = 417

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 50/102 (49%), Gaps = 2/102 (1%)

Query: 338 DKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
           D D L   G  G I+       +    L GH   I+ ++F  +  +LL+ S +D  +++W
Sbjct: 117 DGDYLYATGDQGGIISIYDSQAEVTRTLEGHYAEITDVKFFPSGEVLLSGS-ADMQLKVW 175

Query: 398 HGQKENCCNCFYGHSQSIISLSWINDDL-VISASMDGSVRIW 438
                +      GH+ ++ +L  I+    V+S+S DGS+++W
Sbjct: 176 STLDGSNPRTLKGHTSTVTALGIIDRGRNVMSSSKDGSLKLW 217

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/79 (21%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 240 QITALSWSPDGELIITSVENGELRLWNK-DGRLQNVFNFHRSPIVSIKWNEDSKHFISLD 298
           +IT + + P GE++++   + +L++W+  DG        H S + ++   +  ++ +S  
Sbjct: 150 EITDVKFFPSGEVLLSGSADMQLKVWSTLDGSNPRTLKGHTSTVTALGIIDRGRNVMSSS 209

Query: 299 LDNITILWNAINGIILQHF 317
            D    LW   +G  +  F
Sbjct: 210 KDGSLKLWECGSGETIHSF 228

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 48/112 (42%), Gaps = 4/112 (3%)

Query: 281 PIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKD 340
           PI  +K++ + K  +   LD +  LW+ I G +++ F+          S G+D  + D +
Sbjct: 191 PISQVKFSRNGKFLLVRSLDGVVKLWDFIRGCVVRTFKDASGESRMKYSCGMDFLYPDSE 250

Query: 341 K----LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSS 388
                +VV G +G+I V++         L G       I  +    L+ T S
Sbjct: 251 AADVMVVVGGEDGNICVWNAQSKAVAQTLKGQHEDSPVIAVSCKETLVCTLS 302

 Score = 33.9 bits (76), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 42/87 (48%), Gaps = 6/87 (6%)

Query: 238 TNQITALSWSPDGELIITSVENGELRLWNKD-GRLQNVFNFHRSPIVSIKWNEDSKHFIS 296
           T  I  + WSPD   + +  E+  + + + + GRL  +   H +P++S+ +N       +
Sbjct: 55  TEPINDICWSPDSACVASGSEDFTVEITHLEYGRLHKLRG-HSAPVLSVVFNCKGNLLCT 113

Query: 297 LDLDNITILWNAINGIILQ----HFEP 319
             +D     W+ ++G +L+    H +P
Sbjct: 114 ASVDESIKQWDVLSGTLLKTMSAHSDP 140

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 41/211 (19%), Positives = 76/211 (36%), Gaps = 20/211 (9%)

Query: 247 SPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILW 306
           SPDG  +  +           DG        H  PI  I W+ DS    S   D      
Sbjct: 23  SPDGRYVAVADRTAICVYSVGDGGCARYETTHTEPINDICWSPDSACVASGSEDFT---- 78

Query: 307 NAINGIILQHFEPEQ--KLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGK 364
                + + H E  +  KL  ++  +   +     + L    V+ SI  + +     +  
Sbjct: 79  -----VEITHLEYGRLHKLRGHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGTLLKT 133

Query: 365 LLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCF-----YGHSQSIISLS 419
           +  H   +  I+       +L+S   D  IRI+  +  +C         +     ++ +S
Sbjct: 134 MSAHSDPVVSIDTPDCDATILSSGSYDGLIRIFDTESGHCLKTLTYDKDWQTDDGVVPIS 193

Query: 420 WI----NDDLVISASMDGSVRIWSVVENCLV 446
            +    N   ++  S+DG V++W  +  C+V
Sbjct: 194 QVKFSRNGKFLLVRSLDGVVKLWDFIRGCVV 224

>CAGL0K00275g complement(25300..27447) similar to sp|P36037
           Saccharomyces cerevisiae YKL213c DOA1, hypothetical
           start
          Length = 715

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 361 PIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW 420
           P+  L+GH G +  + F      LL SS  D + +IW   K         H  S+   + 
Sbjct: 94  PMYTLVGHTGNVCGLRF---QNGLLLSSSWDKTAKIWDNNKLKYD--LRNHEASVWDSTM 148

Query: 421 INDDLVISASMDGSVRIW 438
           ++DD++++AS D S+ +W
Sbjct: 149 VSDDIILTASADKSIGVW 166

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 22/30 (73%)

Query: 410 GHSQSIISLSWINDDLVISASMDGSVRIWS 439
           GHSQ +  ++ +ND+ + S S DGS+R+W+
Sbjct: 10  GHSQDVKDITAVNDNKIASVSRDGSLRVWT 39

>YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear pore
           protein required for poly(A)+ RNA export, has WD (WD-40)
           repeats, functions in the nuclear export of the small
           ribosomal subunit [1098 bp, 365 aa]
          Length = 365

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 414 SIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNA-IICGKISHDKNKFAIGS 472
           S I+ S   D +  ++S DG VRIW V      G A  + ++ ++C + S+D  K A G 
Sbjct: 40  SDIAFSPQQDFMFSASSWDGKVRIWDVQNGVPQGRAQHESSSPVLCTRWSNDGTKVASGG 99

Query: 473 MNGQINVYDI 482
            +  + +YDI
Sbjct: 100 CDNALKLYDI 109

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 41/83 (49%), Gaps = 9/83 (10%)

Query: 239 NQITALSWSPDGELIITSVE-NGELRLWN-----KDGRLQNVFNFHRSPIVSIKWNEDSK 292
           + I+ +++SP  + + ++   +G++R+W+       GR Q+      SP++  +W+ D  
Sbjct: 37  DSISDIAFSPQQDFMFSASSWDGKVRIWDVQNGVPQGRAQHE---SSSPVLCTRWSNDGT 93

Query: 293 HFISLDLDNITILWNAINGIILQ 315
              S   DN   L++  +G   Q
Sbjct: 94  KVASGGCDNALKLYDIASGQTQQ 116

>CAGL0M09845g 975007..977817 highly similar to sp|Q06078
           Saccharomyces cerevisiae YLR409c, start by similarity
          Length = 936

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 64/122 (52%), Gaps = 5/122 (4%)

Query: 331 GVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDS 390
           GV ++ +++ K+V  G++G I  Y  +++K +GKL      I+ + ++ +S L   + D 
Sbjct: 505 GVAVDGMNR-KMVSCGLDGIIGFYDFNESKYLGKLQ-MDAPITSMVYHRSSDLCAFALD- 561

Query: 391 DYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDL-VISASMDGSVRIWSV-VENCLVGM 448
           D SI +     +      +GH   I +  +  D   ++SAS+D ++R W +   +C+ G+
Sbjct: 562 DLSIVVVDTVTQKVVRQLWGHGNRITAFDFSPDGRWLVSASLDSTIRTWDLPTGSCIDGV 621

Query: 449 AM 450
            +
Sbjct: 622 KI 623

>Sklu_2423.1 YLR409C, Contig c2423 869-3703
          Length = 944

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 61/122 (50%), Gaps = 5/122 (4%)

Query: 331 GVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDS 390
           GV I+ +++ K+V  G++G I  Y    +  +GKL      ++ + ++ +S L   + D 
Sbjct: 513 GVAIDGMNR-KMVSCGLDGLIGFYDFTKSAFLGKLQ-LDAPVTSMVYHRSSDLFAVALD- 569

Query: 391 DYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDL-VISASMDGSVRIWSV-VENCLVGM 448
           D SI +     +      +GHS  + +  +  D   ++SAS+D ++R W +    C+ G+
Sbjct: 570 DLSIVVIDAVTQKVVRQLWGHSNRVTAFDFSPDGRWIVSASLDSTIRTWDLPTGGCIDGV 629

Query: 449 AM 450
            +
Sbjct: 630 RL 631

>Sklu_1710.1 YDR267C, Contig c1710 17-739
          Length = 240

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 62/142 (43%), Gaps = 19/142 (13%)

Query: 357 DDNKPIGKLLGHQGTISCIEFNVN-SRLLLTSSDSDYSIRIWHGQKENCCN--------- 406
           DD +    L GH+GT+ C +F  + S L L S   D ++RIW   ++N  +         
Sbjct: 97  DDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSV 156

Query: 407 CFYGHSQSIISLSWINDDLVISASMDGSVRI--------WSVVENCLVGMAMVDGNAIIC 458
               HS+++ S+SW    L+ S   DG + I        W ++    +   + + N +  
Sbjct: 157 LPSAHSRAVYSVSWSPTGLIASTGSDGLLAIYQEKEEGKWEIIAQHELAHGVYETNVVKW 216

Query: 459 GKISHDKNKFAIGSMNGQINVY 480
            +I   +     G  +G +N++
Sbjct: 217 TQID-GETLLVTGGDDGCVNIW 237

>CAGL0B03575g complement(357525..358784) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2, hypothetical
           start
          Length = 419

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 51/120 (42%), Gaps = 19/120 (15%)

Query: 342 LVVPGVNGSILVYSIDD-NKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQ 400
               G +  + +Y I D + P+  + GH+  ++ IEF+ N+  +L SS SD    +W  Q
Sbjct: 285 FAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ 344

Query: 401 K--------------ENCCNCFYGHSQSIISLSWINDD---LVISASMDGSVRIWSVVEN 443
           +                      GH  SI  ++ +N +   LV SA  D  V+IW    N
Sbjct: 345 EIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIA-VNPNINWLVASAEEDNIVQIWKCSSN 403

>Kwal_26.8628
          Length = 422

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 44/228 (19%), Positives = 83/228 (36%), Gaps = 33/228 (14%)

Query: 274 VFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVD 333
             N H + I    W+ DS+  +S   D   I+W+A  G                 ++ +D
Sbjct: 81  TLNGHNNKISDFAWSSDSRSILSASQDGFMIVWDASLGF-------------KKNAIPLD 127

Query: 334 IEWV-------DKDKLVVPGVNGSILVYSIDDNKPIGKLL-----GHQGTISCIEFNVNS 381
            +WV         + +   G+  S  +Y I     + + +     GH   +S +EF  N+
Sbjct: 128 SQWVLTCAINSSGNLVASAGLTNSCTIYRISQENRVQQQIVSMFKGHTCYVSQVEFFENN 187

Query: 382 RLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW------INDDLVISASMDGSV 435
            ++  S   D +  +W   K      F  H   +++L+        +  +  S   DG V
Sbjct: 188 SIITAS--GDMTCALWDIPKAKRIAEFSDHLGDVLALALPPPHAQTSSPIFASGGSDGYV 245

Query: 436 RIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIK 483
            IW            V  + I   K  ++      G+ +G   ++D++
Sbjct: 246 YIWDTRARAAAQSFFVSESDISTLKFFNNGYAIVTGADDGVARMFDMR 293

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/220 (17%), Positives = 87/220 (39%), Gaps = 18/220 (8%)

Query: 239 NQITALSWSPDGELIITSVENGELRLWNKD-GRLQNVFNFHRSPIVSIKWNEDSKHFISL 297
           N+I+  +WS D   I+++ ++G + +W+   G  +N        +++   N       S 
Sbjct: 87  NKISDFAWSSDSRSILSASQDGFMIVWDASLGFKKNAIPLDSQWVLTCAINSSGNLVASA 146

Query: 298 DLDNITILW-----NAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSIL 352
            L N   ++     N +   I+  F+      +        +E+ + + ++    + +  
Sbjct: 147 GLTNSCTIYRISQENRVQQQIVSMFKGHTCYVSQ-------VEFFENNSIITASGDMTCA 199

Query: 353 VYSIDDNKPIGKLLGHQGTISCIEFNV----NSRLLLTSSDSDYSIRIWHGQKENCCNCF 408
           ++ I   K I +   H G +  +         S  +  S  SD  + IW  +       F
Sbjct: 200 LWDIPKAKRIAEFSDHLGDVLALALPPPHAQTSSPIFASGGSDGYVYIWDTRARAAAQSF 259

Query: 409 YGHSQSIISLSWINDDL-VISASMDGSVRIWSVVENCLVG 447
           +     I +L + N+   +++ + DG  R++ +  +C V 
Sbjct: 260 FVSESDISTLKFFNNGYAIVTGADDGVARMFDMRSDCAVA 299

>Scas_680.11
          Length = 347

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 77/168 (45%), Gaps = 16/168 (9%)

Query: 246 WSPDGELIITSVENGELRLWNKDGRLQNV--FNFHRSPIVSIKWNEDSKHFISLDLDNIT 303
           WS +G+ II + + GE+  ++ D  LQ V     H++ I  ++++ D  +FI+   D+  
Sbjct: 161 WSTEGKFIIAAHKEGEVSKYDVDNGLQFVESIKLHKALITDLQFSPDRTYFITSSRDSHA 220

Query: 304 ILWNAINGIILQHFEPEQKLENNTESLGVDIEWV-------DKDKLVVPGVNGSI---LV 353
            + +     +L+ FE +  L  NT  +    E+V        +D        G       
Sbjct: 221 HIVDVETLAVLKDFEIDCPL--NTACITPLKEFVILGGGQDARDVTTTSASEGKFEARFH 278

Query: 354 YSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK 401
           + I + + IG++ GH G ++C+  +      ++  + D  +R+ H +K
Sbjct: 279 HKIFEEE-IGRVKGHFGPLNCVAVSPQGTSYVSGGE-DGLVRLHHFEK 324

 Score = 32.7 bits (73), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 25/120 (20%), Positives = 41/120 (34%), Gaps = 49/120 (40%)

Query: 278 HRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWV 337
           H  P+  +K+N +     S   DN   +W ++NG                          
Sbjct: 9   HERPLTQVKYNREGDLLFSCSKDNFASVWYSVNG-------------------------- 42

Query: 338 DKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
                                 + +G L GH GTI  I+ +  +   +T S +DYSI++W
Sbjct: 43  ----------------------ERLGTLNGHAGTIWSIDVDKFTEYCVTGS-ADYSIKMW 79

>KLLA0A08866g 776960..778231 weakly similar to sp|P53196
           Saccharomyces cerevisiae YGL004c singleton, hypothetical
           start
          Length = 423

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 81/186 (43%), Gaps = 20/186 (10%)

Query: 307 NAINGIILQHFEPEQKLENNTESLGVDIEWVD-------KDKLVVPGVNGSILVY----S 355
           +A  G +     P+++ +  ++   VD+  +D       + +LV    NG I V      
Sbjct: 81  DATAGHLASFQSPKKRFQLPSDIGAVDLTSIDITNVFDPEIRLVCGDTNGGIYVLRKNTG 140

Query: 356 IDDNKPIGKLL----GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGH 411
            + + P+ +++     H   I+  +F  N    L+SS  D  ++IW          F GH
Sbjct: 141 TNYSGPLQEVIKLPEAHASHITKTQFFPNGHGFLSSS-IDMRLKIWDASTGTELRTFIGH 199

Query: 412 SQSIISLSWINDDL-VISASMDGSVRIWSV-VENCLVGMAMVDGNAIICGKISHDKNKFA 469
           ++S+   + ++     +SAS DGS+++W      C+  +   DG  I C  +++ +   A
Sbjct: 200 TRSVNDFAMVDRGRNFVSASSDGSLKLWECSTSACVFTLNSNDG--INCISLANYQGNPA 257

Query: 470 IGSMNG 475
             S N 
Sbjct: 258 TTSYNA 263

>KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1
           Kluyveromyces lactis heterotrimeric G protein beta
           subunit, start by similarity
          Length = 436

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/224 (20%), Positives = 87/224 (38%), Gaps = 33/224 (14%)

Query: 278 HRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWV 337
           H + I  +KW++DS   +S   D   I+W+   G+                ++ +  +WV
Sbjct: 85  HNNKISDVKWSQDSASVLSSSQDGFIIIWDPFTGL-------------KKSAIPLLSQWV 131

Query: 338 -------DKDKLVVPGVNGSILVYSID-DNK----PIGKLLGHQGTISCIEFNVNSRLLL 385
                    + +   G++    VY +  DN+     I    GH   IS  EF ++ R +L
Sbjct: 132 LSSAISPSGNLVASAGLDNHCSVYRVSRDNRIQQNVISIFKGHTCYISATEF-LDERTIL 190

Query: 386 TSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDL------VISASMDGSVRIWS 439
           T+S  D +  +W   K      F  H   ++++     +        I+   DG   +W 
Sbjct: 191 TAS-GDMTCAMWDIPKSKRVTEFIDHLGDVLTMDLPPANTGRYGHNFITGGSDGYAYLWD 249

Query: 440 VVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIK 483
           V +        +  + +   K  ++   F  GS +G   ++D++
Sbjct: 250 VRQPNSAQSFFISDSDVSAIKFFNNGESFMAGSDDGSARLFDLR 293

 Score = 29.3 bits (64), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 37/219 (16%), Positives = 94/219 (42%), Gaps = 18/219 (8%)

Query: 239 NQITALSWSPDGELIITSVENGELRLWNK-DGRLQNVFNFHRSPIVSIKWNEDSKHFISL 297
           N+I+ + WS D   +++S ++G + +W+   G  ++        ++S   +       S 
Sbjct: 87  NKISDVKWSQDSASVLSSSQDGFIIIWDPFTGLKKSAIPLLSQWVLSSAISPSGNLVASA 146

Query: 298 DLDNITILW-----NAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSIL 352
            LDN   ++     N I   ++  F+      + T       E++D+  ++    + +  
Sbjct: 147 GLDNHCSVYRVSRDNRIQQNVISIFKGHTCYISAT-------EFLDERTILTASGDMTCA 199

Query: 353 VYSIDDNKPIGKLLGHQGTISCIEF-NVNSRLL---LTSSDSDYSIRIWHGQKENCCNCF 408
           ++ I  +K + + + H G +  ++    N+        +  SD    +W  ++ N    F
Sbjct: 200 MWDIPKSKRVTEFIDHLGDVLTMDLPPANTGRYGHNFITGGSDGYAYLWDVRQPNSAQSF 259

Query: 409 YGHSQSIISLSWIND-DLVISASMDGSVRIWSVVENCLV 446
           +     + ++ + N+ +  ++ S DGS R++ +  +C +
Sbjct: 260 FISDSDVSAIKFFNNGESFMAGSDDGSARLFDLRSDCQI 298

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 69/164 (42%), Gaps = 9/164 (5%)

Query: 278 HRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWV 337
           H + + S+ ++ D     +  LD I ++W+  +G  +   +   K   +       ++W 
Sbjct: 304 HSAEVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKNIMSLQGHSKPIYS-------VDWS 356

Query: 338 DKDKLVVPGV-NGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRI 396
                +  G  +G+I V+ I     +  +L H   +S ++FN  +   L SS  D  + I
Sbjct: 357 QNGYQLASGSGDGTIKVWDIRKKGNVETILAHNSIVSQVKFNKQNGGYLVSSGYDKKVNI 416

Query: 397 WHGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV 440
           ++           GH   ++S+  +  D + SA  D SV  W V
Sbjct: 417 FNDGNWIKERSLEGHLDKVMSIDIVGPD-IYSAGWDRSVNKWGV 459

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 1/76 (1%)

Query: 410 GHSQSIISLSWIND-DLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKF 468
           GHS  + SLS+ ND  LV +A +D    IW +     +         I     S +  + 
Sbjct: 303 GHSAEVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKNIMSLQGHSKPIYSVDWSQNGYQL 362

Query: 469 AIGSMNGQINVYDIKR 484
           A GS +G I V+DI++
Sbjct: 363 ASGSGDGTIKVWDIRK 378

>CAGL0A00561g complement(63710..64948) similar to sp|P53196
           Saccharomyces cerevisiae YGL004c, hypothetical start
          Length = 412

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 67/137 (48%), Gaps = 10/137 (7%)

Query: 309 INGIILQHFEPEQKLENNTESLGV----DIEWVDK--DKLVVPGVNGSILVYSIDDNKPI 362
           +NG I     P++ +  +TE LG+    D+   D   DK+V+    G I VY  +    +
Sbjct: 77  VNGKIYWFKTPKRLV--STEELGISESLDLISCDASTDKIVIGDSGGDINVYDHEWMSKL 134

Query: 363 GKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIN 422
             +  H   ++ ++   ++ +LL+ S +D  +++W  +  +      GHS  I     I 
Sbjct: 135 SLVGAHVSDVTTVKIFPSNAVLLSGS-TDMQLKVWSLEDGSNPRTLKGHSAGITDTIIIE 193

Query: 423 DDL-VISASMDGSVRIW 438
               V+S+S+DGSVR+W
Sbjct: 194 RGRNVLSSSLDGSVRLW 210

>Scas_692.25
          Length = 488

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 2/74 (2%)

Query: 365 LLGHQGTISCIE-FNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIND 423
           L+ H+  +S ++ F   + + L S   D SIRIW  +     N F+ H++ +  L  ++ 
Sbjct: 231 LMNHEHIVSEVKLFRKLNNIYLASCSRDTSIRIWTAEDGMILNSFHPHNEWVRCLD-VSG 289

Query: 424 DLVISASMDGSVRI 437
           D V+S S D S+R+
Sbjct: 290 DFVLSGSQDASLRL 303

>CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein, start by similarity
          Length = 457

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/95 (22%), Positives = 44/95 (46%), Gaps = 22/95 (23%)

Query: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKEN--------------------CCN 406
           GH G +  +++  N+R++  S+ +D S+R+W  + ++                       
Sbjct: 142 GHTGAVKAVKYISNTRIV--SAGNDRSLRLWKTKNDDGSVSNNTGDENDEENIEDGKTLA 199

Query: 407 CFYGHSQSIISLSWINDDLVISASMDGSVRIWSVV 441
              GH   ++SL   ++  ++SAS D +V +WS +
Sbjct: 200 ILEGHKAPVVSLDVASNSRILSASYDNTVALWSTI 234

 Score = 35.8 bits (81), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 65/159 (40%), Gaps = 35/159 (22%)

Query: 241 ITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLD 300
           ++AL  S D   I +   +G +R WN  G+++  ++ H   + ++K+  +++  +S   D
Sbjct: 106 VSALDVSDDFRHIYSGSYDGVVRTWNMSGKVEKQYSGHTGAVKAVKYISNTR-IVSAGND 164

Query: 301 NITILWNAIN--GIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDD 358
               LW   N  G +  +   E   EN                              I+D
Sbjct: 165 RSLRLWKTKNDDGSVSNNTGDENDEEN------------------------------IED 194

Query: 359 NKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
            K +  L GH+  +  ++   NSR+L  S D+  ++ +W
Sbjct: 195 GKTLAILEGHKAPVVSLDVASNSRILSASYDN--TVALW 231

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 44/223 (19%), Positives = 77/223 (34%), Gaps = 62/223 (27%)

Query: 267 KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAI--NGIILQHFEPEQKLE 324
           +DG+   +   H++P+VS+    +S+  +S   DN   LW+ I      + H E  Q   
Sbjct: 193 EDGKTLAILEGHKAPVVSLDVASNSR-ILSASYDNTVALWSTIYKEMTAIDHLEEIQNPN 251

Query: 325 NNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLL 384
           N        I    K +  +   +G+I   +     P+  L  H G +  + F+     +
Sbjct: 252 NK-------ISTAAKKRRKLTLKDGTIRRRA-----PLSLLESHTGPVEQVIFDHGDNTV 299

Query: 385 LTSSDSDYSIRIWHGQKENCCNC------------------------------------- 407
             S   D++I+ W      C +                                      
Sbjct: 300 GYSVSQDHTIKTWDLVTARCIDTKTTSYPLLSIAQMPTLNLLACGSSVRHITLHDPRVSS 359

Query: 408 --------FYGHSQSIISLSWI--NDDLVISASMDGSVRIWSV 440
                     GH   ++ L     N+ L+ SAS DG+V++W V
Sbjct: 360 SAKITQKQLVGHKNFVVGLDTCSENEYLLCSASHDGTVKVWDV 402

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 59/267 (22%), Positives = 107/267 (40%), Gaps = 67/267 (25%)

Query: 177 VQTLDNKVVTSSWNLQNERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGR 236
           +Q  D  V    + +  +  +  G +D+  ++  YN  +K  ++   + HP         
Sbjct: 51  IQVTDTPVRAGKF-ITRKNWIVVGSDDNKVRVFNYNTGEK--VADF-VAHP--------- 97

Query: 237 KTNQITALSWSPDGELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWN-EDSKH 293
             + I +++  P    I+T  ++  ++LWN   D  L+  F  H   ++ + +N +D   
Sbjct: 98  --DYIRSIAVHPSKPYILTGSDDLTVKLWNWENDWSLEQTFKGHEHFVMCVAFNPKDPNV 155

Query: 294 FISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILV 353
           F S  LD+   +W+      L    P   L    E                 GVN  +  
Sbjct: 156 FASGCLDHKVKVWS------LGQSTPNFTLHTGQEK----------------GVN-YVDY 192

Query: 354 YSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQ 413
           Y + D KP                      ++TSSD D +++I+  Q ++C     GH  
Sbjct: 193 YPLPD-KP---------------------YMITSSD-DTTVKIFDYQTKSCVATLEGH-M 228

Query: 414 SIISLSWINDDL--VISASMDGSVRIW 438
           S +S +  +  L  +IS S DG+V++W
Sbjct: 229 SNVSFAVFHPTLPIIISGSEDGTVKLW 255

>KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces
           cerevisiae YDL195w SEC31 component of the COPII coat of
           ER-golgi vesicles, start by similarity
          Length = 1231

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 45/107 (42%), Gaps = 12/107 (11%)

Query: 222 LELRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELR-------LWNKDGRLQNV 274
           L L H    SS TG K   +T + W P    II +  + +         L N    L+ +
Sbjct: 191 LHLNH---SSSTTGIKV-PLTVVDWHPTSSTIIATASSSDTEPLVLTWDLRNAHVPLKVL 246

Query: 275 FNFHRSPIVSIKW-NEDSKHFISLDLDNITILWNAINGIILQHFEPE 320
              H   ++S+ W  +D    +S   DN ++LWN   G IL  F P 
Sbjct: 247 SQGHSKGVLSLDWCKQDENLLLSSGRDNTSVLWNPQEGSILTQFAPR 293

 Score = 35.8 bits (81), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 333 DIEWVDKDKLVVPGV-NGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSD 391
           D++W   DK++   + NG +  +     K + K+  HQG +  ++FN     +L S  + 
Sbjct: 67  DLDWSGDDKIIAGALENGVVEFFDPKALKSVAKIHKHQGPVKTLKFNAKQNNVLVSGGTQ 126

Query: 392 YSIRIWHGQK 401
             I +W   K
Sbjct: 127 GEIFVWDSNK 136

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 3/83 (3%)

Query: 410 GHSQSIISLSWINDD--LVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHD-KN 466
           GHS+ ++SL W   D  L++S+  D +  +W+  E  ++      GN +   K + +  +
Sbjct: 249 GHSKGVLSLDWCKQDENLLLSSGRDNTSVLWNPQEGSILTQFAPRGNWVFKSKFAPEAPD 308

Query: 467 KFAIGSMNGQINVYDIKRFVSRL 489
            FA  S + +I V  ++   + L
Sbjct: 309 LFASASFDSKIVVQTLQNLSNTL 331

>YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containing
           three WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has moderate similarity to
           uncharacterized S. cerevisiae Ymr102p [2559 bp, 852 aa]
          Length = 852

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 54/272 (19%), Positives = 109/272 (40%), Gaps = 49/272 (18%)

Query: 239 NQITALSWSPDGELIITSVENGELRLW---------NKDGRLQNVFNFHRSPIVSIKWNE 289
           N I   ++S DG+ ++   ++G L LW         ++ GR +   +  R+  + I+   
Sbjct: 174 NSICCCTFSHDGKYMVIGCKDGSLHLWKVINSPVKRSEMGRSEKSVSASRANSLKIQ--- 230

Query: 290 DSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNG 349
             +H  S+   N +I  N +        +P  + E  ++ L +       D   V     
Sbjct: 231 --RHLASISSHNGSISSNDL--------KPSDQFEGPSKQLHLYAPVFYSDVFRV----- 275

Query: 350 SILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFY 409
             + +++D                 ++ N +    L ++  D + ++WH +++     F 
Sbjct: 276 -FMEHALD----------------ILDANWSKNGFLITASMDKTAKLWHPERKYSLKTFV 318

Query: 410 GHSQSIISLSWINDD-LVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKF 468
                  ++ + NDD  +I+  +D   R+WS+++N  V  A    + I    +S    ++
Sbjct: 319 HPDFVTSAIFFPNDDRFIITGCLDHRCRLWSILDN-EVSYAFDCKDLITSLTLSPPGGEY 377

Query: 469 A-IGSMNGQINVYDIK--RFVSRLLKRDKKQE 497
             IG+ NG I V      +FVS     DK  +
Sbjct: 378 TIIGTFNGYIYVLLTHGLKFVSSFHVSDKSTQ 409

>Sklu_2430.9 YMR102C, Contig c2430 15497-18397
          Length = 966

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 408 FYGHSQSIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNK 467
           F GH+Q I+ + W  ++ V++ SMD +V++W      L+       + + C K   + ++
Sbjct: 392 FLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLL-KNFPHPDFVTCVKFHPNDDR 450

Query: 468 FAI-GSMNGQINVYDI 482
           F I G ++ +  ++ I
Sbjct: 451 FFISGCLDHKARLWSI 466

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/66 (21%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 332 VDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSD 391
           +DI+W   + ++   ++ ++ ++  D  K + K   H   ++C++F+ N      S   D
Sbjct: 400 LDIDWSKNNFVLTGSMDKTVKLWHCD-RKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLD 458

Query: 392 YSIRIW 397
           +  R+W
Sbjct: 459 HKARLW 464

>Sklu_2364.5 YAR003W, Contig c2364 9220-10515 reverse complement
          Length = 431

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 5/62 (8%)

Query: 340 DKLVVPGVNGSILVYSIDDNKPIGKL----LGHQGTISCIEFNVNSRLLLTSSDSDYSIR 395
           D L +   NG+++VY +D +KPI  L     GH   I  I ++   R +LT+S  D+ I+
Sbjct: 40  DYLAMGCSNGAVVVYDMDTSKPICMLGNKGGGHVRAIQSIAWSYCGRYVLTTS-RDWYIK 98

Query: 396 IW 397
           +W
Sbjct: 99  LW 100

>KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces
           cerevisiae YKL213c DOA1 involved in ubiquitin-dependent
           proteolysis, start by similarity
          Length = 706

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 360 KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLS 419
           +P+  L+GH+G I  +  +  S   L SS  D + ++W            GHS S+    
Sbjct: 91  EPVYTLVGHEGNICSLSGDFES---LVSSSWDKTAKVWTNGIVKWE--LKGHSASVWDAK 145

Query: 420 WINDDLVISASMDGSVRIW 438
            +ND  V++AS D +V++W
Sbjct: 146 LLNDGSVLTASADTTVKLW 164

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%)

Query: 410 GHSQSIISLSWINDDLVISASMDGSVRIWSV 440
           GH+Q + S+  ++   V SAS DG+VRIW++
Sbjct: 10  GHTQDVRSVVSLSTTQVASASRDGTVRIWNL 40

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 253 IITSVENGELRLWNKDGRLQNVFN-FHRSPIVSIKWNEDSKHFISLDLDNITILWNAING 311
           ++T+  +  ++LW K+G L   F+  H   + +I   +D KHF+S   D    L N + G
Sbjct: 152 VLTASADTTVKLW-KNGTLAKTFDKLHSDVVRNICILDDGKHFVSCSNDGTLKLSN-LEG 209

Query: 312 IILQHF 317
            IL  F
Sbjct: 210 GILHEF 215

>CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces
           cerevisiae YOR269w PAC1, hypothetical start
          Length = 467

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 53/109 (48%), Gaps = 7/109 (6%)

Query: 335 EWVDKDKLV-VPGVNGSILVYSIDDN----KPIGKLLGHQGTISCIE-FNVNSRLLLTSS 388
           E++D   LV     +  I VY    N    K I     H  T+S  + +  ++ +LL SS
Sbjct: 182 EFIDSTTLVSTTSKDAQINVYDHSSNTGELKLIRSFNAHDSTVSSQKTWQKDNDVLLASS 241

Query: 389 DSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRI 437
             D ++++W      C   F  HS+ + S+  + D+ ++S S+D ++R+
Sbjct: 242 SRDATVKVWRVNDSRCLQSFSPHSEWVKSID-VLDEYILSGSLDSTLRL 289

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 52/250 (20%), Positives = 98/250 (39%), Gaps = 27/250 (10%)

Query: 250 GELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWN 307
           G L ++   +G L++W+   +  L   +  HR  I +  ++ D+  F S   D    +W+
Sbjct: 187 GHLFLSGGNDGVLKIWDMYHERLLLRDYCGHRKAISATSFSHDNVQFASSSYDKTVKIWD 246

Query: 308 AINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLL- 366
              G I+       +L        +     +K++L+V   +  I  + +  +K  G +  
Sbjct: 247 TETGDII------NRLSFKATPNCMTFHPQNKEQLLVGFSDSKIRHFDLRVDKKDGVIQI 300

Query: 367 --GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIN-- 422
              H   I+ + +  +    ++SSD D SIRIW  Q            Q      WI   
Sbjct: 301 YDHHLAAINALRYFPDGSKFISSSD-DKSIRIWENQINIPIKQISDTDQ--YPAPWIQLH 357

Query: 423 --DDLVISASMDGSVRIWSV-------VENCLVGMAMVDGNAIICGKISHDKNKFAIGSM 473
              +   + SMD S+ ++S+             G      N++    I+ D    A G  
Sbjct: 358 PEHNQFAAQSMDNSIYVYSMKPKYKRHPRKAFRGHKSAGYNSMF--DIAPDGRYVAAGDT 415

Query: 474 NGQINVYDIK 483
           +G++ ++D K
Sbjct: 416 SGRLFIWDWK 425

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 52/119 (43%), Gaps = 2/119 (1%)

Query: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKEN-CCNCFYGHSQSIISLSWINDDL 425
           GH    + +EF   +  L  S  +D  ++IW    E      + GH ++I + S+ +D++
Sbjct: 172 GHDRGTTALEFLRKTGHLFLSGGNDGVLKIWDMYHERLLLRDYCGHRKAISATSFSHDNV 231

Query: 426 -VISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIK 483
              S+S D +V+IW      ++                 +K +  +G  + +I  +D++
Sbjct: 232 QFASSSYDKTVKIWDTETGDIINRLSFKATPNCMTFHPQNKEQLLVGFSDSKIRHFDLR 290

>AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH]
           (424004..425659) [1656 bp, 551 aa]
          Length = 551

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 70/165 (42%), Gaps = 16/165 (9%)

Query: 239 NQITALSWSPDGELIITSVENGELRLWNK-DGRLQNVFNFHRSPIVSIKWNEDSKHFISL 297
           ++ T+LSW   G  +   + NG + L +    +     + H   +  + WN+   H +S 
Sbjct: 288 DEYTSLSWVNSGSHLAVGLGNGLVELHDVVKQKCIRTLSGHLDRVACLSWNQ---HILSS 344

Query: 298 DLDNITILWNAINGIILQHFEPEQKLEN-NTESLGV-DIEW-VDKDKLVVPGVNGSILVY 354
              +  IL   +         PE   E  NT S  V  ++W VD+++L   G +  + VY
Sbjct: 345 GSKDHKILHRDVR-------MPEHYFETANTHSQEVCGLKWNVDENRLASGGNDNVVYVY 397

Query: 355 SIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSD--SDYSIRIW 397
                KP+ K   H   +  + ++ + R  L +    +D  ++IW
Sbjct: 398 DGPSKKPVLKFTEHNAAVKAMAWSPHRRATLATGGGTADRRLKIW 442

>KLLA0A01650g complement(146030..147235) similar to sp|Q02793
           Saccharomyces cerevisiae YGL213c SKI8 antiviral protein
           of the beta-transducin (WD-40) repeat family singleton,
           start by similarity
          Length = 401

 Score = 37.4 bits (85), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 63/291 (21%), Positives = 113/291 (38%), Gaps = 69/291 (23%)

Query: 202 EDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQITALSWSPDGELIITSVENGE 261
           ED +AK    +   K+ ++ + L H  A  S+       I   + S DG++    ++  E
Sbjct: 47  EDQLAK----DHVIKEFVTPMGLHHVSAFESVESNGETVIILSAISFDGKIYFYQIDLKE 102

Query: 262 -----LRLWNKDGRLQNVFNFHRSPIVSIKW----NEDSKH-FISLDLDNITILWNAI-- 309
                L L N D    + +        + +W    N  + H FI+  +   T +WN I  
Sbjct: 103 GKLVKLSLLNADDSKHSYW--------ACQWYISTNPKNPHKFIATTVQGTTKVWNFIIF 154

Query: 310 --------------NGIILQ-HFEPEQKLENNTESLGVDIEWVDKDKLVVPGV-NGSILV 353
                         N ++ + HF  + K+ + T      ++ V   +L+  G  +GS++V
Sbjct: 155 QEPELDTETGEPLSNSLVYEPHFNFQGKINSQTPRFATAVD-VSSTQLIATGFSDGSVVV 213

Query: 354 YSIDDNKPIGKLLGH--------QGTISCIEFNVNSRLLLTSSDS-----------DYSI 394
             +   +P+    G           TI  I+F+    LL  + DS           ++  
Sbjct: 214 SQLSTLRPVYNFEGFGLKGVEESSSTIRDIKFSPAGSLLAVAHDSGSYGCVSLYETEFGE 273

Query: 395 RIW------HGQKENCCNCFYGHSQSIISLSW-INDDLVISASMDGSVRIW 438
           RI       HG +    +  Y H+  + S+S+    + + SA  DG +RIW
Sbjct: 274 RIGNFTVPTHGNQTTIAS--YAHNGWVFSVSFNSTGEYLASAGYDGKIRIW 322

>KLLA0C07425g complement(647673..649007) highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein singleton, start by
           similarity
          Length = 444

 Score = 37.4 bits (85), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 46/252 (18%), Positives = 90/252 (35%), Gaps = 76/252 (30%)

Query: 253 IITSVENGELRLWN--------------KDGRLQNVFNFHRSPIVSIKWNEDSKHFISLD 298
           ++++  +  LRLW               +DG+   +   H++P+VSI  ++D    +S  
Sbjct: 156 LVSAGNDRTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKAPVVSIDVSKD--RILSAS 213

Query: 299 LDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDD 358
            DN   LW+        +++ E  + +  E LG ++    K +  +   +G     SI  
Sbjct: 214 CDNTVSLWST-------NYK-EMTVIDPMEDLGGNVSTAAKKRRKLTLKDG-----SIRR 260

Query: 359 NKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNC----------- 407
             P+     H   +  + F+ +   +  S   D++I+ W      C +            
Sbjct: 261 RAPLALFESHSAPVEAVIFDKSDDTVGYSVSQDHTIKTWDLITAKCVDTKTTSYSLLSVA 320

Query: 408 ----------------------------------FYGHSQSIISLSWI--NDDLVISASM 431
                                               GH   +++L     N+ ++ SAS 
Sbjct: 321 QLPKLNLLACGSSARHITLHDPRVNSSSKITQQQLVGHKNFVVALDTCPENEYMICSASH 380

Query: 432 DGSVRIWSVVEN 443
           DG+V++W V  N
Sbjct: 381 DGTVKVWDVRSN 392

 Score = 37.0 bits (84), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 43/87 (49%), Gaps = 16/87 (18%)

Query: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKEN-------------CCNCFYGHSQ 413
           GH G I  + +  ++RL+  S+ +D ++R+W  + ++                   GH  
Sbjct: 140 GHSGPIRAVHYISSTRLV--SAGNDRTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKA 197

Query: 414 SIISLSWINDDLVISASMDGSVRIWSV 440
            ++S+  ++ D ++SAS D +V +WS 
Sbjct: 198 PVVSID-VSKDRILSASCDNTVSLWST 223

>KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces
           cerevisiae YMR146c TIF34 translation initiation factor
           eIF3, p39 subunit singleton, start by similarity
          Length = 347

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 74/175 (42%), Gaps = 13/175 (7%)

Query: 237 KTNQITALSWSPDGELIITSVENGELR-LWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFI 295
           +  ++   SWS +G+ II   E+G++   + ++G        H   I  I+++ D  +FI
Sbjct: 151 QATKVFVASWSYNGKYIIAGHEDGQISAYYGENGEFVQAKKIHEKSIKDIQFSPDRTYFI 210

Query: 296 SLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWV-------DKDKLVVPGVN 348
           +   D++  L +     +L+ ++ +  L  N+ S+    E+V        KD        
Sbjct: 211 TSSRDSVASLVDVDTFEVLKTYKADCPL--NSASITPLKEFVILGGGQDAKDVTTTSARE 268

Query: 349 GSI--LVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK 401
           G     +Y       IG++ GH G ++ +  +       +  +  Y IR+ H  K
Sbjct: 269 GKFEARIYHKVFQDEIGRVKGHFGPLNYVAVSPTGTSYASGGEDGY-IRLHHFDK 322

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 48/237 (20%), Positives = 84/237 (35%), Gaps = 40/237 (16%)

Query: 274 VFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKL-------ENN 326
           V   H  P+  +K+N D     +   D++  +W AING  L   +            E+ 
Sbjct: 5   VLKGHERPLTQVKFNRDGDLVFACSKDSVASIWYAINGERLGTLDDHSGTIWSIDVDEST 64

Query: 327 TESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGK----------------LLGHQG 370
           T +L    ++  K   V  GV     V+S+    P+ +                ++GH G
Sbjct: 65  TYALTGGADFCFKIWKVATGV----AVHSVSTRSPVLRVEFSPDGSKLLIVLDAVMGHIG 120

Query: 371 TISCIEF--NVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVIS 428
           +I       N N  ++    + DY I       E     F      + S S+ N   +I+
Sbjct: 121 SIVVYSLIRNENGEIVNVKEEPDYEITTI----EQATKVF------VASWSY-NGKYIIA 169

Query: 429 ASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIKRF 485
              DG +  +       V    +   +I   + S D+  F   S +   ++ D+  F
Sbjct: 170 GHEDGQISAYYGENGEFVQAKKIHEKSIKDIQFSPDRTYFITSSRDSVASLVDVDTF 226

>Kwal_47.17567
          Length = 590

 Score = 37.4 bits (85), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 60/288 (20%), Positives = 120/288 (41%), Gaps = 55/288 (19%)

Query: 174 LNEVQTLDNKVVTSSWNLQNERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSI 233
           + ++ T DN+  + SW +     LA GQ + +  +  ++ E KK I +           I
Sbjct: 319 VTQLSTTDNEYTSLSW-VGAGSHLAVGQTNGLVNI--FDVEKKKCIRT-----------I 364

Query: 234 TGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRL-QNVF---NFHRSPIVSIKWNE 289
            G   +++  LSW+     I+TS    + R+ ++D R  Q+ F     H   +  +KWN 
Sbjct: 365 PGH-IDRVACLSWN---NHILTSGSR-DRRILHRDVRTPQSSFEEIRTHNQEVCGLKWNV 419

Query: 290 DSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEW------------- 336
           +     S   DN   +++  + +      P  KLE +T ++   + W             
Sbjct: 420 EDNKLASGGNDNAVFVYDGTSRL------PFLKLEEHTAAVKA-MAWSPHRRGILATGGG 472

Query: 337 -VDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIR 395
             DK +L +  V  S+ ++ +D    +  ++  + T         + ++ +   S Y++ 
Sbjct: 473 TADK-RLKIWNVKTSVKLHDVDTASQVCNMIWSKNT---------NEIITSHGYSKYNLT 522

Query: 396 IWHGQKENCCNCFYGHSQSIISLSWIND-DLVISASMDGSVRIWSVVE 442
           +W G          GHS  ++ ++   D   V+S + D ++R W + E
Sbjct: 523 LWDGNTLEPMAILKGHSFRVLHMTLSTDGTTVVSGAGDETLRYWKLFE 570

>Scas_717.68
          Length = 908

 Score = 37.7 bits (86), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 48/99 (48%), Gaps = 5/99 (5%)

Query: 384 LLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW--INDDLVISASMDGSVRIWSVV 441
            L +S  D ++++WH +++     F  H   +  + +   +D   IS  +D  VR+WS++
Sbjct: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399

Query: 442 ENCLVGMAMVDGNAIICGKISHDKNKFAI-GSMNGQINV 479
           EN  +       + I    +S    K+ I G+ NG ++V
Sbjct: 400 EN-EITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHV 437

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 17/81 (20%), Positives = 41/81 (50%), Gaps = 2/81 (2%)

Query: 403 NCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKIS 462
           +C   F  H+  ++ L W  ++ +I++SMD +V++W  +E           + + C +  
Sbjct: 319 SCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWH-LERQTSLKTFQHQDFVTCVRFH 377

Query: 463 HDKNKFAI-GSMNGQINVYDI 482
              ++F I G ++ ++ ++ I
Sbjct: 378 PTDDRFFISGCLDHKVRLWSI 398

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/66 (18%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 332 VDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSD 391
           +D++W   + L+   ++ ++ ++ ++    + K   HQ  ++C+ F+        S   D
Sbjct: 332 LDLDWSKNNFLITSSMDRTVKLWHLERQTSL-KTFQHQDFVTCVRFHPTDDRFFISGCLD 390

Query: 392 YSIRIW 397
           + +R+W
Sbjct: 391 HKVRLW 396

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 98/229 (42%), Gaps = 34/229 (14%)

Query: 238 TNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNF-HRSPIVSIKWNE-DSKHFI 295
           T  +  L WS +  LI +S++   ++LW+ + R  ++  F H+  +  ++++  D + FI
Sbjct: 328 TADVLDLDWSKNNFLITSSMDR-TVKLWHLE-RQTSLKTFQHQDFVTCVRFHPTDDRFFI 385

Query: 296 SLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILV-- 353
           S  LD+   LW+ +   I   F+ +  + + T S G      D    +V   NG + V  
Sbjct: 386 SGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPG------DGKYTIVGTFNGYVHVLL 439

Query: 354 ----------YSIDDN---KPIGKLLGHQGT----ISCIEFNVNSRLLLTSSDSDYSIRI 396
                     + +D N   +       H G     + C ++  ++ L +  + SD  IRI
Sbjct: 440 TKGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRI 499

Query: 397 WHGQKENCCNCFYGH----SQSIISLSWIN-DDLVISASMDGSVRIWSV 440
           +  +K+       G     SQ    L+ +    +V+S+S D  V  W +
Sbjct: 500 FDLEKKKLLEYLKGFQSGASQHKACLATVKGQQVVLSSSDDHWVHGWKL 548

>CAGL0G03399g complement(325879..326988) highly similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2, start by
           similarity
          Length = 369

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 1/70 (1%)

Query: 414 SIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNA-IICGKISHDKNKFAIGS 472
           S I+ S  +D L   +S DG VRIW        G A  + N  ++C + S D  + A G 
Sbjct: 39  SDIAFSPQHDFLFSVSSWDGKVRIWDAQNGVPQGKAQYEHNGPVLCTRWSLDGARIASGG 98

Query: 473 MNGQINVYDI 482
            +  + +YD+
Sbjct: 99  CDNTVKLYDV 108

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 40/74 (54%), Gaps = 3/74 (4%)

Query: 241 ITALSWSPDGELIIT-SVENGELRLWN-KDGRLQNVFNF-HRSPIVSIKWNEDSKHFISL 297
           I+ +++SP  + + + S  +G++R+W+ ++G  Q    + H  P++  +W+ D     S 
Sbjct: 38  ISDIAFSPQHDFLFSVSSWDGKVRIWDAQNGVPQGKAQYEHNGPVLCTRWSLDGARIASG 97

Query: 298 DLDNITILWNAING 311
             DN   L++  +G
Sbjct: 98  GCDNTVKLYDVASG 111

>CAGL0G00704g 65805..67127 similar to sp|P39706 Saccharomyces
           cerevisiae YAR003w, hypothetical start
          Length = 440

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 36/62 (58%), Gaps = 5/62 (8%)

Query: 340 DKLVVPGVNGSILVYSIDDNKPI----GKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIR 395
           D L +   NG++++Y +D  KPI     KL GH   ++ + ++   R L+T+S  D+ I+
Sbjct: 39  DYLALGCSNGAVIIYDMDTLKPITMLGSKLGGHVQAVNSVSWSGCGRYLITTS-RDWFIK 97

Query: 396 IW 397
           +W
Sbjct: 98  LW 99

>Scas_442.2*
          Length = 795

 Score = 37.0 bits (84), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 74/164 (45%), Gaps = 27/164 (16%)

Query: 339 KDKLVVPGVNGSILVYS-IDDNKP--IGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIR 395
           K  +V  G   +I +++ +D+N       L GH+  ++C++F  ++  +++ S+ D+ ++
Sbjct: 26  KTHIVAFGAGQTIALWNPLDENSQGVFATLKGHEAEVTCVKFITDTPYMVSCSE-DHHVK 84

Query: 396 IWHGQKEN-----------CCNCFYGHSQSIISLSWINDDLVISASMDGSVRIW--SVVE 442
           IW   K+N           C      +S ++++L+ +   L+     DG V +W   + E
Sbjct: 85  IW---KQNPGVAREVDGWTCVQTLDHYSHTVVALA-VLPGLIAVGCADGKVSLWVQKMKE 140

Query: 443 NCLV------GMAMVDGNAIICGKISHDKNKFAIGSMNGQINVY 480
           +  +          V   A+   K+  DK   A+G  N  + V+
Sbjct: 141 DVFILGEEFEVQKGVLPLALAFSKVIDDKYLLAVGGTNVNVFVF 184

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 40/74 (54%), Gaps = 7/74 (9%)

Query: 240 QITALSWSPDGELIITSV-----ENGELRLWNKDGRLQ--NVFNFHRSPIVSIKWNEDSK 292
           +IT L  SPDG+ I ++      ++  +R++N D  L+      FH   +  ++++ DSK
Sbjct: 570 EITCLDVSPDGKFIASACRSNTPQHAVVRIFNTDNWLEVKPPLAFHTLTVTKLRFSPDSK 629

Query: 293 HFISLDLDNITILW 306
           + +S+  D   ++W
Sbjct: 630 YLLSVCRDRQWVVW 643

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 85/201 (42%), Gaps = 38/201 (18%)

Query: 222 LELRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRS- 280
           LE++ P A  ++T      +T L +SPD + +++   + +  +W +D         +++ 
Sbjct: 606 LEVKPPLAFHTLT------VTKLRFSPDSKYLLSVCRDRQWVVWERDPETDKFTLKYKTA 659

Query: 281 -PIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQK---LENN------TESL 330
            P   I W+ D   +  L+  N+ +  +    I L  F+  +    LEN+        +L
Sbjct: 660 KPHTRIIWDGD---WAPLEFGNVFVTGSRDRTIKLWKFDENKSNFDLENSLNMTSLVTAL 716

Query: 331 GVDIEWVDKDKLVVPGV-NGSILVYSIDDNK-------------PIGKLLGHQGTISCIE 376
            V    +D   L+  G+ +GSI +Y  D                P  KL   + + S   
Sbjct: 717 SVXDSVLDGRLLIAXGLEDGSIYIYKYDSTSGFDVVEVLNDLITPAEKLTRLRWSRS--- 773

Query: 377 FNVNSRLLLTSSDSDYSIRIW 397
              N++L L ++ SD S RI+
Sbjct: 774 -QRNNKLWLAAASSDTSTRIY 793

 Score = 32.7 bits (73), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query: 233 ITGRKTNQITALSWSPDGELIITSVENGELRL-----WNKDGRLQNVFNFH 278
           ITG  T Q+T ++WSP GE ++++  +   RL     +N DG  +N   +H
Sbjct: 392 ITG-ATKQVTDIAWSPKGEYLLSTSLDQTTRLFAPWIYNNDGTKRNTATWH 441

>Scas_510.5
          Length = 362

 Score = 36.6 bits (83), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 42/76 (55%), Gaps = 3/76 (3%)

Query: 239 NQITALSWSPDGELIIT-SVENGELRLWN-KDGRLQNVFNF-HRSPIVSIKWNEDSKHFI 295
           + I+ +++SP  + I + S  +G++R+W+ + G  Q    + H  P++S +W+ D     
Sbjct: 35  DSISDIAFSPQQDFIFSVSSWDGKVRIWDVQGGVAQGRSQYEHAGPVLSTRWSNDGSKVA 94

Query: 296 SLDLDNITILWNAING 311
           S   DNI  L++  +G
Sbjct: 95  SGGCDNIVKLFDVASG 110

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 1/70 (1%)

Query: 414 SIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVD-GNAIICGKISHDKNKFAIGS 472
           S I+ S   D +   +S DG VRIW V      G +  +    ++  + S+D +K A G 
Sbjct: 38  SDIAFSPQQDFIFSVSSWDGKVRIWDVQGGVAQGRSQYEHAGPVLSTRWSNDGSKVASGG 97

Query: 473 MNGQINVYDI 482
            +  + ++D+
Sbjct: 98  CDNIVKLFDV 107

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 36.6 bits (83), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 66/319 (20%), Positives = 125/319 (39%), Gaps = 32/319 (10%)

Query: 227 PFALSSITGRKTNQITALSWSP-DGELIITSVENGELRLWN-KDGRLQNVFNFHRSPIVS 284
           P+ LS +    T  +  +   P D E   T   +  +++W+   G+L+     H   +  
Sbjct: 111 PWKLSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMSVRD 170

Query: 285 IKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVV 344
           I  ++   +  S   D +   W+      ++ F       +      VD+     D +  
Sbjct: 171 IAISKRHPYMFSASEDKLVKCWDLERNTAIRDFHGHLSGVHT-----VDVH-PSLDIIAT 224

Query: 345 PGVNGSILVYSIDDNKPIGKLLGHQGTISCIE-FNVNSRLLLTSSDSDYSIRIWHGQKEN 403
            G +  + ++ I     I  L GH+  I+ ++   V+ +++  S D+  ++R+W      
Sbjct: 225 AGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKCLPVDPQIISCSGDA--TVRLWDIIAGK 282

Query: 404 CCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAII-CGKIS 462
                  HS++I  L+    +   ++     VR W + E  L+         I+    I+
Sbjct: 283 ASKVLTHHSRNIRDLTLHPAEFSFASVSTNDVRSWKLPEGQLLTNFQSQNTGILNTVSIN 342

Query: 463 HDKNKFAIGSMNGQINVYDIKRFVSRLLKRDKKQELVVPITIPLYGSYQNEKIDDC-IFD 521
           HD N    G  +G +  YD K          K Q +   +T  + GS ++E+   C  FD
Sbjct: 343 HD-NVLLAGGDDGTLCFYDYK-------TGHKYQSM---MTTEVAGSLESERSILCSTFD 391

Query: 522 ISWNKSNDLITVANSIGEG 540
           ++  +   LIT     GEG
Sbjct: 392 VTGTR---LIT-----GEG 402

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 44/102 (43%), Gaps = 2/102 (1%)

Query: 211 YNKEDKKIISSLELRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNKDGR 270
           ++  + K++   +L    A+    G  +  +  +   P  ++I T+  +  +RLW+   R
Sbjct: 181 FSASEDKLVKCWDLERNTAIRDFHGHLSG-VHTVDVHPSLDIIATAGRDAVVRLWDIRSR 239

Query: 271 LQ-NVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAING 311
            +  V   H+SPI  +K        IS   D    LW+ I G
Sbjct: 240 SEIMVLPGHKSPINKVKCLPVDPQIISCSGDATVRLWDIIAG 281

>YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associated
           protein essential for the G1/S transition, member of WD
           (WD-40) repeat family [1383 bp, 460 aa]
          Length = 460

 Score = 36.6 bits (83), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 64/145 (44%), Gaps = 28/145 (19%)

Query: 253 IITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGI 312
           II+   +G +R W+  G +Q  ++ H  PI ++K+  +++  +S   D    LW   N  
Sbjct: 118 IISGSYDGIVRTWDLSGNVQKQYSGHSGPIRAVKYISNTR-LVSAGNDRTLRLWKTKND- 175

Query: 313 ILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTI 372
                  + KL +  ++   D + V+                 I+D K +  L GH+  +
Sbjct: 176 -------DLKLTSQQQAQEDDDDEVN-----------------IEDGKTLAILEGHKAPV 211

Query: 373 SCIEFNVNSRLLLTSSDSDYSIRIW 397
             I+ + NSR+L  S+  D SI  W
Sbjct: 212 VSIDVSDNSRIL--SASYDNSIGFW 234

 Score = 35.8 bits (81), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 21/98 (21%), Positives = 43/98 (43%), Gaps = 25/98 (25%)

Query: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKEN----------------------- 403
           GH G I  +++  N+RL+  S+ +D ++R+W  + ++                       
Sbjct: 142 GHSGPIRAVKYISNTRLV--SAGNDRTLRLWKTKNDDLKLTSQQQAQEDDDDEVNIEDGK 199

Query: 404 CCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVV 441
                 GH   ++S+   ++  ++SAS D S+  WS +
Sbjct: 200 TLAILEGHKAPVVSIDVSDNSRILSASYDNSIGFWSTI 237

>AFL006C [3187] [Homologous to ScYAR003W (SWD1) - SH]
           (425925..427226) [1302 bp, 433 aa]
          Length = 433

 Score = 36.6 bits (83), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 5/62 (8%)

Query: 340 DKLVVPGVNGSILVYSIDDNKPIGKLLGHQG----TISCIEFNVNSRLLLTSSDSDYSIR 395
           D L V   NGS+++Y +D  KPI  L  H G     +  + ++   R L +SS  D+ ++
Sbjct: 40  DYLAVGCSNGSLVIYDMDTKKPISVLGNHGGGHVRAVQSVAWSQCGRYLWSSS-RDWRVK 98

Query: 396 IW 397
           +W
Sbjct: 99  MW 100

>Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement
          Length = 587

 Score = 36.6 bits (83), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 393 SIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVIS-ASMDGSVRIWSVVENCLVGMAMV 451
           S+ +W+G+  +        +++I S++W +DD  +S    DG+  IW V    LV   M 
Sbjct: 272 SLYLWNGESGDVTLLTEFEAETISSVTWSDDDCHVSIGKSDGNTEIWDVETMSLV-RTMR 330

Query: 452 DGNAIICGKISHDKNKFAIGSMNGQINVYDIK 483
            G  +  G  S      A G+ +G+I + D++
Sbjct: 331 SGLGVRIGSQSWLDTLVACGTKSGEIQINDVR 362

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 56/248 (22%), Positives = 100/248 (40%), Gaps = 37/248 (14%)

Query: 188 SWNLQNERLLAYGQEDS------MAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQI 241
           +++L N     YG +        +AK+ + N   ++I+ +   +  F L+          
Sbjct: 206 AYSLGNRAHYYYGSQTGERKPWEVAKLRKINTNPERILDAPGFQDDFYLN---------- 255

Query: 242 TALSWSPDGELIITSVENGELRLWNKD-GRLQNVFNFHRSPIVSIKWNEDSKHFISLDLD 300
             LSWS    L I ++E+  L LWN + G +  +  F    I S+ W++D  H      D
Sbjct: 256 -LLSWSKKNCLAI-ALES-SLYLWNGESGDVTLLTEFEAETISSVTWSDDDCHVSIGKSD 312

Query: 301 NITILWNAINGIILQHFEPEQKLENNTESLGVDI---EWVDKDKLVVPGV-NGSILVYSI 356
             T +W+     +++              LGV I    W+  D LV  G  +G I +  +
Sbjct: 313 GNTEIWDVETMSLVRTMR---------SGLGVRIGSQSWL--DTLVACGTKSGEIQINDV 361

Query: 357 D-DNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSI 415
              N  +     H G +  + +  +  L L S  +D S+ IW  +          H+ ++
Sbjct: 362 RIKNHIVSAWQEHSGEVCGLSYRKDG-LQLASGSNDNSVMIWDTRTSMPQFVKRNHTAAV 420

Query: 416 ISLSWIND 423
            ++SW  D
Sbjct: 421 KAISWCPD 428

>AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH]
           complement(1256750..1258087) [1338 bp, 445 aa]
          Length = 445

 Score = 36.2 bits (82), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 42/88 (47%), Gaps = 17/88 (19%)

Query: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNC--------------FYGHS 412
           GH G +  ++F  ++RL+  S  +D ++R+W  + ++  +                 GH 
Sbjct: 140 GHTGAVRAVKFISSTRLV--SGGNDRTLRLWKTKNDDVKHVDELEGTEEAHTLAILEGHQ 197

Query: 413 QSIISLSWINDDLVISASMDGSVRIWSV 440
             ++S+  +  D ++SAS D S+  WS 
Sbjct: 198 APVVSVD-VQGDRILSASYDNSIGFWST 224

>Kwal_27.12239
          Length = 316

 Score = 36.2 bits (82), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 52/107 (48%), Gaps = 9/107 (8%)

Query: 218 IISSLELRHPFALSSITGRKTNQITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFN 276
           ++ +LE +     S++  R    ++ L WSPD + I T+ ++  + + +   G L  +  
Sbjct: 41  VVFNLEDQSSTTFSTLHSRP---LSDLCWSPDSQCIATASDDFTIIITHIVFGELHRLVG 97

Query: 277 FHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQ----HFEP 319
            H +P+ S+K+        S  +D    +W+ ++G +L+    H EP
Sbjct: 98  -HTAPVTSVKYTMKGNLLCSCSMDESIKIWDILSGTLLRTLSAHSEP 143

>Scas_660.7*
          Length = 603

 Score = 36.6 bits (83), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 65/343 (18%), Positives = 134/343 (39%), Gaps = 38/343 (11%)

Query: 203 DSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQITALSWSP--DGELIITSVENG 260
           D     + Y       I  L    P  +   TG  T  +T + +SP    + + +  E+G
Sbjct: 18  DETTNAVAYPCGKSAFIRPLGDSQP--VIQFTGHGTANVTVVRFSPIKGSQYLCSGDESG 75

Query: 261 ELRLWN----KDGRLQNV----FNFHRSPIVSIKWNEDSKHFISL----DLDNITILWNA 308
           ++ +W     KDG ++      F+     +  I W+ + K    +    D   + I W++
Sbjct: 76  KVIVWGWSQEKDGSIETTIKSEFHVLAGSVRDISWDFEGKRLCVVGDGRDKLGVFISWDS 135

Query: 309 INGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIG--KLL 366
            N   L       ++ N         +     + +  G +G+++ Y     K     ++ 
Sbjct: 136 GNS--LGEISGHSQIVN-----ACHFKQSRPMRCITVGDDGAMVFYQGPPFKFTSSDRIH 188

Query: 367 GHQGT-ISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQ----SIISLSWI 421
             QG  I  +EF         +  SD  I  +  +           S+     I +LSWI
Sbjct: 189 HDQGKFIRDVEFAPGQGSFAITVGSDRKINCFDSKTGEFVKSIVDESEPIQGGIFALSWI 248

Query: 422 NDDLVISASMDGSVRIWSVVENCLVGMAMV----DGNAII---CGKISHDKNKFAIGSMN 474
           +++  ++AS D ++R+W V  +  V   +V    D N +     G ++  + +    S++
Sbjct: 249 DENKFVTASADATIRVWDVNSSKCVQKWVVTSSSDDNVLRDQQVGVVASQEGRIVSLSLD 308

Query: 475 GQINVYDIKR-FVSRLLKRDKKQELVVPITIPLYGSYQNEKID 516
           G +N++ +++  +   +K   K    + +   + GSY  + +D
Sbjct: 309 GTLNIFQLEQDNIITSIKGHSKGITALAVNPLITGSYDGKIMD 351

>Sklu_2435.13 YPR137W, Contig c2435 18346-20073
          Length = 575

 Score = 36.2 bits (82), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 61/137 (44%), Gaps = 10/137 (7%)

Query: 315 QHFEPE--QKLENNTESLGVDIEWV----DKDKLVVPGVNGSILVYSIDDNKPIGKLL-- 366
           + F PE   + EN TE    +I  V    D   +V  G +  ++V+S +   P+  +   
Sbjct: 220 RRFNPETTNEYENTTEGHYDEILTVAASPDGKYVVTGGRDRKLIVWSTESLSPVKVIPTK 279

Query: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIN-DDL 425
             +G +  + F  NS  L  S  +DY +R +   + +     YGH   ++ +S ++ +  
Sbjct: 280 DRRGEVLSLAFRKNSDQLFASC-ADYKVRTYAINQFSQLEVLYGHQDLVVDISALSMERC 338

Query: 426 VISASMDGSVRIWSVVE 442
           V   S D +  +W + +
Sbjct: 339 VTVGSRDRTAMLWKIAD 355

>Scas_721.115*
          Length = 318

 Score = 35.8 bits (81), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 36/174 (20%), Positives = 78/174 (44%), Gaps = 14/174 (8%)

Query: 275 FNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDI 334
           F  H   +      +D  + +S   D    LW+   G   Q F     + + ++ + V I
Sbjct: 61  FKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRF-----VGHKSDVMSVAI 115

Query: 335 EWVDKDKLVVPGV-NGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSR----LLLTSSD 389
           +   K  +++ G  + +I V++I   + +  LLGH   +S +      +    + + S+ 
Sbjct: 116 D--RKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAG 172

Query: 390 SDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDD-LVISASMDGSVRIWSVVE 442
           +D  ++ W+  +      F GH+ ++ +++   D  L+ SA  DG + +W++ E
Sbjct: 173 NDKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAE 226

 Score = 35.4 bits (80), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 357 DDNK---PIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQ 413
           DD K   P+    GH   +       +    L++S  D ++R+W          F GH  
Sbjct: 50  DDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSAS-WDKTLRLWDVATGETYQRFVGHKS 108

Query: 414 SIISLSWIN--DDLVISASMDGSVRIWSVVENCLVGM 448
            ++S++ I+    ++IS S D ++++W++   CL  +
Sbjct: 109 DVMSVA-IDRKASMIISGSRDKTIKVWTIKGQCLATL 144

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 3/28 (10%)

Query: 239 NQITALSWSPDGELIITSVENGELRLWN 266
           N +TA   SPDG LI ++ ++GE+ LWN
Sbjct: 199 NTVTA---SPDGTLIASAGKDGEIMLWN 223

>Scas_592.4*
          Length = 318

 Score = 35.8 bits (81), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 36/174 (20%), Positives = 78/174 (44%), Gaps = 14/174 (8%)

Query: 275 FNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDI 334
           F  H   +      +D  + +S   D    LW+   G   Q F     + + ++ + V I
Sbjct: 61  FKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRF-----VGHKSDVMSVAI 115

Query: 335 EWVDKDKLVVPGV-NGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSR----LLLTSSD 389
           +   K  +++ G  + +I V++I   + +  LLGH   +S +      +    + + S+ 
Sbjct: 116 D--RKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAG 172

Query: 390 SDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDD-LVISASMDGSVRIWSVVE 442
           +D  ++ W+  +      F GH+ ++ +++   D  L+ SA  DG + +W++ E
Sbjct: 173 NDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAE 226

 Score = 35.4 bits (80), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 357 DDNK---PIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQ 413
           DD K   P+    GH   +       +    L++S  D ++R+W          F GH  
Sbjct: 50  DDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSAS-WDKTLRLWDVATGETYQRFVGHKS 108

Query: 414 SIISLSWIN--DDLVISASMDGSVRIWSVVENCLVGM 448
            ++S++ I+    ++IS S D ++++W++   CL  +
Sbjct: 109 DVMSVA-IDRKASMIISGSRDKTIKVWTIKGQCLATL 144

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 20/26 (76%)

Query: 241 ITALSWSPDGELIITSVENGELRLWN 266
           + A++ SPDG LI ++ ++GE+ LWN
Sbjct: 198 VNAVTASPDGTLIASAGKDGEIMLWN 223

>YBL106C (SRO77) [97] chr2 complement(10847..13879) Protein that
           functions together with Sec9p in exocytosis downstream
           of the Rho3p GTPase [3033 bp, 1010 aa]
          Length = 1010

 Score = 36.2 bits (82), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 46/91 (50%), Gaps = 12/91 (13%)

Query: 239 NQITALSWSPDGELIITSVENGELRLWNKDGRLQN---VFNFHRS---------PIVSIK 286
           N IT     P  + ++  +E+G + +++ D    +   + NF +S         P++SI+
Sbjct: 125 NSITCFETDPPLDWMLIGLESGSILIYDVDRNQMSKLKIENFQKSVFLPKERLSPVISIQ 184

Query: 287 WNEDSKHFISLDLDNITILWNAINGIILQHF 317
           WN      I +  ++IT++++ I+  + QHF
Sbjct: 185 WNPRDIGTILISYEHITVIYSFIDYKVKQHF 215

>AGR367C [4678] [Homologous to ScYDR324C - SH] (1408366..1410681)
           [2316 bp, 771 aa]
          Length = 771

 Score = 36.2 bits (82), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (68%)

Query: 415 IISLSWINDDLVISASMDGSVRIWSVVEN 443
           +++L+W+ DD V+    DG +RIW V E+
Sbjct: 198 VLALTWVGDDAVVGGCSDGRIRIWCVKED 226

>Scas_571.4
          Length = 601

 Score = 36.2 bits (82), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 52/106 (49%), Gaps = 7/106 (6%)

Query: 347 VNGSILVYSIDDNKPI----GKLL-GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK 401
           +N S+  Y   +NKP+     K+L GH   +  + F+   R +L SS  D++++IW+ +K
Sbjct: 121 MNYSMRTYRDSENKPMDIRPSKILSGHTRKVGHVLFHPRIRNVLASSSLDFTVKIWNIKK 180

Query: 402 ENCCNCFYGHSQSIISLSWINDDLVISA-SMDGSVRIWSVVENCLV 446
                    HS  + ++++  D   ++  + +  + IW +    +V
Sbjct: 181 GKVIGTLQ-HSDMVTAMAFDPDGAYLATITRNKKLTIWDIASKQIV 225

>YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of
           the WD (WD-40) repeat family that binds to substrates
           (CLB2, CLB3, CDC5, HSL1) of the anaphase promoting
           complex (APC) and targets them for degradation [1701 bp,
           566 aa]
          Length = 566

 Score = 36.2 bits (82), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 55/119 (46%), Gaps = 12/119 (10%)

Query: 326 NTESLGVDIEWVDK-DKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLL 384
           +TE+    + W+     L V   NG + +Y +   K I  L GH   ++C+ +N +   +
Sbjct: 300 DTENEYTSLSWIGAGSHLAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNH---V 356

Query: 385 LTSSDSDYSIRIWHGQKENCCNCFY----GHSQSIISLSW-INDDLVISASMDGSVRIW 438
           LTS   D+  RI H +     + F+     H+Q +  L W + D+ + S   D  V ++
Sbjct: 357 LTSGSRDH--RILH-RDVRMPDPFFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVY 412

 Score = 32.7 bits (73), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 47/231 (20%), Positives = 94/231 (40%), Gaps = 29/231 (12%)

Query: 239 NQITALSWSPDGELIITSVENGELRLWNKDGRLQNVF----NFHRSPIVSIKWNEDSKHF 294
           +++  LSW+     ++TS    + R+ ++D R+ + F      H   +  +KWN      
Sbjct: 345 DRVACLSWN---NHVLTSGSR-DHRILHRDVRMPDPFFETIESHTQEVCGLKWNVADNKL 400

Query: 295 ISLDLDNITILWNAINGIILQHFEPEQKL-------ENNTESLGVDIEWVDKDKLVVPGV 347
            S   DN+  ++   +   +  F+  +          +    L       D+ +L +  V
Sbjct: 401 ASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADR-RLKIWNV 459

Query: 348 NGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNC 407
           N SI +  ID    I  ++  + T         + L+ +   S Y++ +W     +    
Sbjct: 460 NTSIKMSDIDSGSQICNMVWSKNT---------NELVTSHGYSKYNLTLWDCNSMDPIAI 510

Query: 408 FYGHSQSIISLSWIND-DLVISASMDGSVRIWSVVENCLVGMAMVDGNAII 457
             GHS  ++ L+  ND   V+S + D ++R W + +      A V  N++I
Sbjct: 511 LKGHSFRVLHLTLSNDGTTVVSGAGDETLRYWKLFDK---PKAKVQPNSLI 558

>AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH]
           complement(1497416..1499560) [2145 bp, 714 aa]
          Length = 714

 Score = 35.8 bits (81), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 62/130 (47%), Gaps = 11/130 (8%)

Query: 238 TNQITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISL 297
           T+ +  L+ +PDG    +   +G +++   DG+    F+ H S +  +K+  D    +S 
Sbjct: 185 TDVVRHLALAPDGHHFASCSNDGSVKVHTLDGKTVRTFDGHESFVYCVKYLPDGG-LVSC 243

Query: 298 DLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSID 357
             D    +W+ ++G + Q     +    +  SL V    +    +VV G +G IL++++D
Sbjct: 244 GEDKTVRVWD-MSGHVRQVI---RLCATSLWSLDV----LPNGDIVVGGSDGKILIFTVD 295

Query: 358 DNK--PIGKL 365
             +  P+ +L
Sbjct: 296 PARVAPVEEL 305

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 54/119 (45%), Gaps = 9/119 (7%)

Query: 365 LLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH-GQKENCCNCFYGHSQSIISLSWIND 423
           L GH G +  +E        L SS  D + R+W  G +E   +   GH+ ++     +  
Sbjct: 104 LAGHSGNVCALEARDGQ---LVSSSWDQTARVWREGTEERALS---GHNATVWHALALGY 157

Query: 424 DLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDI 482
           D  ++AS D ++++W    +  +    V  + +    ++ D + FA  S +G + V+ +
Sbjct: 158 DRFLTASADKTIKLWDGARD--LATYNVHTDVVRHLALAPDGHHFASCSNDGSVKVHTL 214

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 410 GHSQSIISLSWINDDLVISASMDGSVRIWS 439
           GHS  + S+  I+D  + S S DG+VR+W+
Sbjct: 16  GHSMDVKSVVAISDTQIASGSRDGTVRVWT 45

>Scas_720.45
          Length = 755

 Score = 35.8 bits (81), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 4/57 (7%)

Query: 384 LLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDL--VISASMDGSVRIW 438
           L+TSSD D + ++W  Q ++C     GH  + +S +  +  L  +IS S DG+++IW
Sbjct: 58  LITSSD-DLTCKVWDYQTKSCVATLEGHMAN-VSFAVFHPTLPIIISGSEDGTLKIW 112

>YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anaphase
           promoting complex (APC), required for microtubule
           function at mitosis and for exit from anaphase, contains
           WD (WD-40) repeats [1833 bp, 610 aa]
          Length = 610

 Score = 35.8 bits (81), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 414 SIISLSWINDDLVIS-ASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGS 472
           +I S++W +DD  IS    DG+  IW V    L+   M  G  +  G +S      A GS
Sbjct: 303 TICSVTWSDDDCHISIGKEDGNTEIWDVETMSLI-RTMRSGLGVRIGSLSWLDTLIATGS 361

Query: 473 MNGQINVYDIK 483
            +G+I + D++
Sbjct: 362 RSGEIQINDVR 372

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 65/282 (23%), Positives = 111/282 (39%), Gaps = 41/282 (14%)

Query: 193 NERLLAYGQEDS-----------MAKMIEYN-KEDKKIISSLELR----HPFALSSITGR 236
           N+R+L Y  E             M K   Y+ ++++KI   ++LR    +P  +    G 
Sbjct: 199 NKRILQYMPEPPKCSSLRQKSYIMKKRTHYSYQQEQKIPDLIKLRKINTNPERILDAPGF 258

Query: 237 KTN-QITALSWSPDGELIITSVENGELRLWNKD-GRLQNVFNFHRSPIVSIKWNEDSKHF 294
           + +  +  LSWS    L I    +  L LWN   G +  + +F  + I S+ W++D  H 
Sbjct: 259 QDDFYLNLLSWSKKNVLAI--ALDTALYLWNATTGDVSLLTDFENTTICSVTWSDDDCHI 316

Query: 295 ISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDI---EWVDKDKLVVPGV-NGS 350
                D  T +W+          E    +      LGV I    W+  D L+  G  +G 
Sbjct: 317 SIGKEDGNTEIWD---------VETMSLIRTMRSGLGVRIGSLSWL--DTLIATGSRSGE 365

Query: 351 ILVYSIDDNKPIGKLLG-HQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFY 409
           I +  +   + I      H G +  + +  +  L L S  +D ++ IW  +         
Sbjct: 366 IQINDVRIKQHIVSTWAEHTGEVCGLSYKSDG-LQLASGGNDNTVMIWDTRTSLPQFSKK 424

Query: 410 GHSQSIISLSWINDDLVISASMDGS----VRIWSVVENCLVG 447
            H+ ++ +LSW      I AS  G     +  W+ +    VG
Sbjct: 425 THTAAVKALSWCPYSPNILASGGGQTDKHIHFWNSITGARVG 466

>Kwal_26.7655
          Length = 743

 Score = 35.8 bits (81), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 8/76 (10%)

Query: 411 HSQSIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAM---VDGNAIICGKISHDKNK 467
           H+Q I+ L W  +  +++ SMD + R+W    +C    A+      + + C K   + ++
Sbjct: 271 HTQDILDLDWSKNGFILTTSMDKTARLW----HCDRPKALKVFTHPDFVTCAKFHPNDDR 326

Query: 468 FAI-GSMNGQINVYDI 482
           F I G ++  + ++ I
Sbjct: 327 FFISGCLDHTLRLWSI 342

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/82 (19%), Positives = 41/82 (50%), Gaps = 2/82 (2%)

Query: 316 HFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCI 375
           H  P +  + +T+ + +D++W     ++   ++ +  ++  D  K + K+  H   ++C 
Sbjct: 261 HPLPFRIYQEHTQDI-LDLDWSKNGFILTTSMDKTARLWHCDRPKAL-KVFTHPDFVTCA 318

Query: 376 EFNVNSRLLLTSSDSDYSIRIW 397
           +F+ N      S   D+++R+W
Sbjct: 319 KFHPNDDRFFISGCLDHTLRLW 340

>Scas_719.52
          Length = 628

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/97 (21%), Positives = 43/97 (44%), Gaps = 2/97 (2%)

Query: 360 KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLS 419
           KP+  L GH   +  + F+  +  +L SS  DY++++W+ +          H   + S+S
Sbjct: 131 KPVKFLSGHSRKVGHVLFHPVAENVLASSSLDYTVKLWNIETGEAVITLK-HPDMVTSMS 189

Query: 420 W-INDDLVISASMDGSVRIWSVVENCLVGMAMVDGNA 455
           +    + + +   D  +R+W + E  +V        A
Sbjct: 190 FSYGGNHLATVCRDKKLRVWDIREGKIVSEGPAHAGA 226

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/135 (19%), Positives = 60/135 (44%), Gaps = 19/135 (14%)

Query: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH--------------GQKENCCNCFY--G 410
           GH   +   +F+  +  ++ SS  D  I IW               G+ +N     +  G
Sbjct: 79  GHTAQVLDTDFDPFNDHIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNIKPVKFLSG 138

Query: 411 HSQSI--ISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKF 468
           HS+ +  +    + ++++ S+S+D +V++W+ +E     + +   + +     S+  N  
Sbjct: 139 HSRKVGHVLFHPVAENVLASSSLDYTVKLWN-IETGEAVITLKHPDMVTSMSFSYGGNHL 197

Query: 469 AIGSMNGQINVYDIK 483
           A    + ++ V+DI+
Sbjct: 198 ATVCRDKKLRVWDIR 212

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/91 (20%), Positives = 44/91 (48%), Gaps = 2/91 (2%)

Query: 361 PIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW 420
           P+  L GHQ  +  + ++  ++ +L SS  D+++R+W+ + +        H   + S+S+
Sbjct: 132 PVKFLTGHQRKVGHVLYHPTAQGVLASSSLDHTVRLWNVE-QGTNPIVLTHPDMVTSMSF 190

Query: 421 -INDDLVISASMDGSVRIWSVVENCLVGMAM 450
                 + +   D  +R+W + +  +V   M
Sbjct: 191 SYGGTYLATVCRDKMLRVWDIRKGEVVSEGM 221

>Scas_693.22
          Length = 1145

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/178 (20%), Positives = 76/178 (42%), Gaps = 21/178 (11%)

Query: 240 QITALSWSPDG--ELIITSVENGELRLWN----KDGRLQNVFNFHRSPIVSIKWNEDSKH 293
           Q+  + WSP       + S  N +  +WN        + +V + H   I  I +N ++  
Sbjct: 72  QVADVQWSPHPAKPYWVVSTSNQKALIWNLARTSSDAIDHVLHGHSRAITDINFNPENPD 131

Query: 294 FI-SLDLDNITILWNAINGIILQHFEPEQKLENNT--ESLGVDIEWVDKDKLVVPGVNGS 350
            + +  +D     W+  +        P +     +   S    ++W  KD  ++   + +
Sbjct: 132 ILATCSVDTYVHAWDMRS--------PHRPFYTTSAWRSGASQVKWNYKDSNILASAHSN 183

Query: 351 -ILVYSID-DNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK--ENC 404
            I ++ +   + P+ KL+GH  +++ I+FN      + SS +D +++ W   K  +NC
Sbjct: 184 DIYIWDLRMGSTPLHKLVGHDSSVNSIDFNRFKSSEIMSSSNDGTVKFWDISKGSDNC 241

>CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces
           cerevisiae YGR200c subunit of elongating RNA polymerase
           II holoenzyme, start by similarity
          Length = 793

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 43/81 (53%), Gaps = 7/81 (8%)

Query: 363 GKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW-----HGQKENCCNCFYGHSQSIIS 417
             L GH+  ++C++F   + +L+++S+ D+ +++W       ++  C      +S +I+S
Sbjct: 52  ATLKGHEAEVTCVKFMPGTDILVSASE-DHHVKLWKYKAPESEELECIQTITHYSHTIVS 110

Query: 418 LSWINDDLVISASMDGSVRIW 438
           +  +   L++  S  G V IW
Sbjct: 111 IETLA-GLIVIGSAGGLVSIW 130

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 39/183 (21%), Positives = 78/183 (42%), Gaps = 32/183 (17%)

Query: 370 GTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCN---CFYGHSQSIISLSWIN-DDL 425
           G  SC+ F  N    + ++    S RIW  + E  C       G  + +  ++W      
Sbjct: 342 GFWSCLWFEENGADYILTNGKTGSWRIWEAKDEIMCEQRVGITGAVRPVTDVAWAPCGKY 401

Query: 426 VISASMDGSVRI---WSVVENCLV---------GMAMVDGNAIICGKISHDKNKFAIGSM 473
           ++S S+D + R+   W   EN  +             + G  +IC +  +D+ +F  G  
Sbjct: 402 LLSTSLDQTTRLFAPWIYNENNELRSRKTWHEFSRPQIHGYDMICVEPVNDE-RFISGGD 460

Query: 474 NGQINVYDIKRFVSRLLKR-------DKKQELVVPITIPLYGSYQNEKIDDCIFDISWNK 526
              +  +D+ + V+ LLK+       ++++E     ++P+ G   N+ +++       N+
Sbjct: 461 EKILRSFDLPKGVAHLLKKFVGLRFTNEEEERPEAASVPVLG-LSNKAVEE-------NE 512

Query: 527 SND 529
           SND
Sbjct: 513 SND 515

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 42/74 (56%), Gaps = 7/74 (9%)

Query: 240 QITALSWSPDGELIITS-----VENGELRLWNKDGRLQNVFN--FHRSPIVSIKWNEDSK 292
           +IT++  SPD +L++++      ++  +R+++ D  L+   N  FH   I  ++++ DSK
Sbjct: 565 EITSVDVSPDQKLVVSACRSNNAQHAVIRIFDLDTWLEVKPNLSFHSLTITRLRFSPDSK 624

Query: 293 HFISLDLDNITILW 306
           + +S+  D    +W
Sbjct: 625 YLLSVCRDRKWAVW 638

>Kwal_33.15591
          Length = 714

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 26/42 (61%)

Query: 410 GHSQSIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMV 451
           GH Q + S++ +N+D V + S DGSVR+W    N L   A+V
Sbjct: 14  GHEQDVKSVAVLNNDTVATCSRDGSVRLWKKGHNNLWQDAVV 55

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 86/213 (40%), Gaps = 22/213 (10%)

Query: 244 LSWSPDGELIITSVENGELRLWNKD-GRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNI 302
           LSWS    L I    +  + LWN + G +  +  F    I S+ W+ D  H      D  
Sbjct: 229 LSWSKKNVLAI--ALDQSIYLWNGETGEVSLLTEFETETITSVVWSNDDCHISIGKDDGN 286

Query: 303 TILWNAINGIILQHFEPEQKLENNTESLGVDI---EWVDKDKLVVPGVNGSILVYSID-D 358
           T +W+          E    +     SLGV I   +W+D   + +   +G I V  +   
Sbjct: 287 TEIWD---------VETMSHVRTMRSSLGVRICSQDWLDT-VVCIGAKSGEIQVNDVRVK 336

Query: 359 NKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISL 418
           +  +     H   +  I+F  +  L L S  +D ++ IW  +++        H+ ++ ++
Sbjct: 337 DHIVSTWEKHTSEVCGIKFRQDG-LQLASGGNDNTVMIWDTRQDEPLWVKRNHNAAVKAI 395

Query: 419 SWINDDLVISA----SMDGSVRIWSVVENCLVG 447
           +W  D + + A    S+D  +  W+      +G
Sbjct: 396 TWHPDVVNLLATGGGSLDRHIHFWNTTTGARIG 428

>Kwal_56.24163
          Length = 729

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 4/57 (7%)

Query: 384 LLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDL--VISASMDGSVRIW 438
           L+TSSD D +++IW  Q ++C     GH  + +S +  +  L  ++S S DG++++W
Sbjct: 58  LITSSD-DRTVKIWDYQTKSCVATLEGHMAN-VSYAVFHPSLPIILSGSEDGTLKVW 112

>Kwal_55.21450
          Length = 503

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 56/265 (21%), Positives = 108/265 (40%), Gaps = 39/265 (14%)

Query: 181 DNKVVTSSWNLQNER--LLAYGQEDSMAKMIEYNKEDKKIIS-------------SLELR 225
           DN+V    W+L  +R  L  Y       + I +N E  + +S             + ++R
Sbjct: 232 DNQVKI--WDLYRDRELLRDYRGHSKAVRGISFNSEGSEFLSVSFDQQIKIWDTETGKVR 289

Query: 226 HPFALSSITGRKTNQITALSWSPDGELII----TSVENGELRLWNKDGRLQNVFNFHRSP 281
           H ++ S I             S   E I+    + + + +LR  +K+G +Q V++ H S 
Sbjct: 290 HQYSYSCIP-----NCAEFRPSNSNEFIVGLSNSEIRHYDLRTSHKNGLVQ-VYDHHLSS 343

Query: 282 IVSIKWNEDSKHFISLDLDNITILW-NAINGIILQHFEPEQKLENNTESLGVDIEWVDKD 340
           I+++K+  D   F+S   D    +W N IN  I Q  +  Q    +   +G+  E   ++
Sbjct: 344 IIALKYFPDGSKFVSSSEDKSMRIWENQINIPIKQISDTSQY---SMPYIGIHPE---QN 397

Query: 341 KLVVPGVNGSILVYSIDD---NKPIGKLLGHQGTISCIEFNVNS-RLLLTSSDSDYSIRI 396
                 ++ +I  +S+       P     GH+     I F  +     + S D+   + I
Sbjct: 398 YFAAQSMDNAIYAFSMKPKYKRHPKKHFSGHKCAGFGIGFGFSPDGQYIASGDTRGRVYI 457

Query: 397 WHGQKENCCNCF-YGHSQSIISLSW 420
           W  +  +    F     ++I++++W
Sbjct: 458 WDWKTTHLLKHFDVPDKKTIVTVAW 482

 Score = 30.4 bits (67), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 56/127 (44%), Gaps = 4/127 (3%)

Query: 360 KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKEN-CCNCFYGHSQSIISL 418
           K I    GH+   + I     S  L  S+ +D  ++IW   ++      + GHS+++  +
Sbjct: 201 KLIHTYPGHKNGTNSILLLPKSGHLCLSAGNDNQVKIWDLYRDRELLRDYRGHSKAVRGI 260

Query: 419 SWINDDL-VISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKI-SHDKNKFAIGSMNGQ 476
           S+ ++    +S S D  ++IW   E   V           C +    + N+F +G  N +
Sbjct: 261 SFNSEGSEFLSVSFDQQIKIWDT-ETGKVRHQYSYSCIPNCAEFRPSNSNEFIVGLSNSE 319

Query: 477 INVYDIK 483
           I  YD++
Sbjct: 320 IRHYDLR 326

>ABL043W [549] [Homologous to ScYMR092C (AIP1) - SH]
           complement(314672..316492) [1821 bp, 606 aa]
          Length = 606

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 71/159 (44%), Gaps = 15/159 (9%)

Query: 282 IVSIKWNED---SKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVD 338
             S+ W +D   S   ++   D +  LW+     +L+ +E    L        V +    
Sbjct: 250 FFSLAWVDDGDKSNRIVTASADGVVRLWDVEANRLLKRWE----LGTEVAQQQVGVVVTR 305

Query: 339 KDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH 398
              ++   ++G++ V+SI+ +KPI  + GH+  I+ ++ N     L+T+S   Y  R+  
Sbjct: 306 DSNIISVSLDGTLNVFSIESDKPIKTIEGHKKGITALKTNP----LVTAS---YDGRVLE 358

Query: 399 GQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRI 437
              E        HS S+ S++ +      + S DG++++
Sbjct: 359 WSAEGTAAVAAMHSNSVTSINNVG-GRTCTVSWDGTLKV 396

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 56/111 (50%), Gaps = 16/111 (14%)

Query: 380 NSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIND----DLVISASMDGSV 435
           + +++L   DS   I+ + G+    C  F+       SL+W++D    + +++AS DG V
Sbjct: 223 DRKIVLYDGDSGEFIK-YIGEDSEECGGFF-------SLAWVDDGDKSNRIVTASADGVV 274

Query: 436 RIWSVVENCLVG---MAMVDGNAIICGKISHDKNKFAIGSMNGQINVYDIK 483
           R+W V  N L+    +        +   ++ D N  ++ S++G +NV+ I+
Sbjct: 275 RLWDVEANRLLKRWELGTEVAQQQVGVVVTRDSNIISV-SLDGTLNVFSIE 324

>KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces
           cerevisiae YGL003c CDH1 substrate-specific activator of
           APC-dependent proteolysis, start by similarity
          Length = 582

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 56/118 (47%), Gaps = 12/118 (10%)

Query: 327 TESLGVDIEWVDKDKLVVPGVNGSIL-VYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLL 385
           +ES    + WVD    +  G++  I+ +Y +  NK I  L GH   ++C+ +N +   +L
Sbjct: 317 SESDFTSLSWVDSGSHLAVGLSSGIVEIYDVLKNKCIRTLSGHVDRVACLSWNNH---VL 373

Query: 386 TSSDSDYSIRIWHGQKENCCNCFY----GHSQSIISLSW-INDDLVISASMDGSVRIW 438
           +S   D   +I H +       F+     HSQ +  L W +N++ + S   D  V ++
Sbjct: 374 SSGSRDR--KILH-RDVRAPEPFFEQIDTHSQEVCGLKWNVNENKLASGGNDNMVYVY 428

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 72/168 (42%), Gaps = 13/168 (7%)

Query: 239 NQITALSWSPD-GELIITSVENGELRLWN--KDGRLQNVFNFHRSPIVSIKWNEDSKHFI 295
           N  T+L   P  G LI++   +  ++LW+   D +    F  H  PI ++ +  DS  F+
Sbjct: 149 NGTTSLRLLPGTGHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDFTSDSSQFL 208

Query: 296 SLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYS 355
           S   D    +W+   G +       ++L   +     +      ++ VV   +  I  Y 
Sbjct: 209 SGSYDQQVKIWDTETGKVT------KRLNTYSTPNSAEFRPTSGNEFVVGLSSSKIKHYD 262

Query: 356 IDDNKPIGKLL---GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQ 400
              ++  G +     H  +I  I++  +    ++SS+ D ++RIW+ Q
Sbjct: 263 TRVSEKDGLVQVYDHHLSSILAIKYFPDGSKFISSSE-DKTLRIWNNQ 309

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 88/224 (39%), Gaps = 27/224 (12%)

Query: 234 TGRKTNQITALSWSPDGELIITS------------VENGELRLWNKDGRLQNVFNFHRSP 281
           TG+ T ++   S     E   TS            +++ + R+  KDG +Q V++ H S 
Sbjct: 223 TGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSSSKIKHYDTRVSEKDGLVQ-VYDHHLSS 281

Query: 282 IVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDK 341
           I++IK+  D   FIS   D    +WN    I ++        +++   +G+  E    + 
Sbjct: 282 ILAIKYFPDGSKFISSSEDKTLRIWNNQVNIPIKQI--SDTTQHSMPYIGIHPE---HNY 336

Query: 342 LVVPGVNGSILVYSIDDN---KPIGKLLGHQ--GTISCIEFNVNSRLLLTSSDSDYSIRI 396
                ++  I  YS+       P  K  GH   G    + F+ + R L  S D+   + +
Sbjct: 337 FSTQSMDSVIYSYSMKPKYKMHPNKKFKGHNSAGYGIGLTFSPDGRFLC-SGDARGQLFL 395

Query: 397 WH-GQKENCCNCFYGHSQSIISLSWINDDL--VISASMDGSVRI 437
           W        C+        I  +SW   +   VI +  DG + +
Sbjct: 396 WDWNTNRKLCDLKLPTKSPITQVSWHPKETSKVICSGPDGRIFV 439

>YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing
           five WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has a region of low
           similarity to a region of S. cerevisiae Sec27p, which a
           coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles [3447 bp, 1148 aa]
          Length = 1148

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 69/173 (39%), Gaps = 19/173 (10%)

Query: 240 QITALSWSPDG--ELIITSVENGELRLWNKDGRLQNVFNF----HRSPIVSIKWNEDSKH 293
           Q+  + WSP       I S  N +  +WN      N   F    H   I  I +N     
Sbjct: 69  QVADVQWSPHPAKPYWIVSTSNQKAIIWNLAKSSSNAIEFVLHGHSRAITDINFNPQHPD 128

Query: 294 FI-SLDLDNITILWNAINGIILQHFEPEQKLENNT--ESLGVDIEWVDKDKLVVPGVNGS 350
            + +  +D     W+  +        P +   + +   S    ++W  KD  V+   +G+
Sbjct: 129 VLATCSVDTYVHAWDMRS--------PHRPFYSTSSWRSAASQVKWNYKDPNVLASSHGN 180

Query: 351 -ILVYSI-DDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK 401
            I V+ +   + P+  L GH  +++ I+FN      + SS +D +++ W   K
Sbjct: 181 DIFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKYSEIMSSSNDGTVKFWDYSK 233

>ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH]
           complement(1012413..1013798) [1386 bp, 461 aa]
          Length = 461

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 51/110 (46%), Gaps = 16/110 (14%)

Query: 343 VVPGVNGSILV-----------YSIDDNKP---IGKLLGHQGTISCIEF-NVNSRLLLTS 387
           V+   NGS+L+           +S  DN     +  L  H+  +S   F    S LLL +
Sbjct: 171 VMEAENGSLLISTTSKDLQCKIWSFTDNAAFQLLRTLSSHEHIVSQSCFLRSGSDLLLAT 230

Query: 388 SDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRI 437
              D ++++W  +   C   F  H+Q + +L  ++ D VI+ S D ++R+
Sbjct: 231 CSRDLTVKVWDTKSGWCIKSFQPHNQWVRTLE-LHGDYVITGSNDATIRL 279

>YDR324C (UTP4) [1154] chr4 complement(1114426..1116756) Protein
           with multiple WD40 repeats, component of U3 snoRNP (also
           called small subunit processome), which is required for
           18S rRNA biogenesis [2331 bp, 776 aa]
          Length = 776

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 415 IISLSWINDDLVISASMDGSVRIWSVVEN 443
           +++L+W  DD VI    DG +RIWS  +N
Sbjct: 190 VLTLAWKKDDFVIGGCSDGRIRIWSAQKN 218

>Kwal_56.24596
          Length = 294

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 64/139 (46%), Gaps = 15/139 (10%)

Query: 357 DDNKPIGKLLGHQGTISCIEF-NVNSRLLLTSSDSDYSIRIWHGQKENC----CNCFYGH 411
           + +K +  L GH+G +  +++ +    ++L S   D  + IW  ++EN           H
Sbjct: 41  ETHKLVETLHGHEGPVWQVDWAHPKFGVILASCSYDGKVLIW--KEENGRWTQIAVHAVH 98

Query: 412 SQSIISLSWINDD---LVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKF 468
           S S+ S+ W   +   L+++AS DG V +    EN      +VD ++I     S     +
Sbjct: 99  SASVNSVQWAPHEYGPLLLAASSDGKVSVVEFKENGTTSPILVDAHSIGVNTAS-----W 153

Query: 469 AIGSMNGQINVYDIKRFVS 487
           A  ++ G      ++RFV+
Sbjct: 154 ASAALQGGAVSQQMRRFVT 172

>AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516)
           [1440 bp, 479 aa]
          Length = 479

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 2/70 (2%)

Query: 241 ITALSWSPDGELIITSVENGELRLWN-KDGRLQNVFNFHR-SPIVSIKWNEDSKHFISLD 298
           +  + +SP GE I+T   +  +R++N K G  + V++  R   +  +K+  DSK+ +S  
Sbjct: 305 VMDVDFSPTGEEIVTGSYDKTIRIFNLKHGHSREVYHTKRMQHVFQVKFTMDSKYIVSGS 364

Query: 299 LDNITILWNA 308
            D    LW A
Sbjct: 365 DDGNVRLWRA 374

 Score = 29.6 bits (65), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 52/111 (46%), Gaps = 10/111 (9%)

Query: 287 WNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPG 346
           W+ +S  F S+  D+  I+ +  +G +L+ F  E   ++        I+   ++   V G
Sbjct: 144 WSVNSDDFNSIK-DDTKIVSDTGDGALLKTFYGEHAFQS--------IDHHRRNPNFVTG 194

Query: 347 VNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIW 397
               I ++ ++  KP+  L      +S + FN N   +L S+ SD SI ++
Sbjct: 195 -GAQIQLWDVNRKKPLSNLSWGVDNVSFVRFNQNEEDILASTGSDNSIVLY 244

>Scas_705.2
          Length = 571

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 60/134 (44%), Gaps = 10/134 (7%)

Query: 316 HFEP--EQKLENNTESLGVDIEWV----DKDKLVVPGVNGSILVYSIDDNKPIGKLL--G 367
            F P   Q+ EN TE    +I  V    D   +V  G +  ++V+S +   PI  +    
Sbjct: 217 RFTPVSNQQYENTTEGHYDEILTVAASPDGKYVVTGGRDRKLIVWSTESLAPIKVIPTKD 276

Query: 368 HQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIN-DDLV 426
            +G +  + F  NS  L  S  +DY IR +  ++ +     YGH   ++ +S ++ +  V
Sbjct: 277 RRGEVLSLVFRKNSDELYASC-ADYKIRTYSIKQFSQLETLYGHHDIVVDISALSMERCV 335

Query: 427 ISASMDGSVRIWSV 440
              + D +  +W +
Sbjct: 336 TVGARDRTAMLWKI 349

>YCL039W (GID7) [504] chr3 (52645..54882) Protein of unknown
           function, member of the WD (WD-40) repeat family [2238
           bp, 745 aa]
          Length = 745

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 51/119 (42%), Gaps = 15/119 (12%)

Query: 381 SRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQS---IISLSWINDDLVISASMDGSVRI 437
           S+ L+  S  D  +++W  ++      ++G  Q    I S     + LV+S S DG + I
Sbjct: 626 SQHLVLVSLQDNELQMWDYKENILIQKYFGQKQQHFIIRSCFAYGNKLVMSGSEDGKIYI 685

Query: 438 WSVVENCLV----GMAMVDGNAI--------ICGKISHDKNKFAIGSMNGQINVYDIKR 484
           W  +   LV    G + V  N+         +      DK  FA G  +G+I ++ I R
Sbjct: 686 WDRIRGNLVSVLSGHSTVMSNSTKPMGKNCNVVASNPADKEMFASGGDDGKIKIWKISR 744

>YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in
           the absence of Cin8p, contains WD (WD-40) repeats [1485
           bp, 494 aa]
          Length = 494

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 2/77 (2%)

Query: 362 IGKLLGHQGTISCIE-FNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW 420
           I  LLGH+  +S ++ +  N+ + + S   D +++IW          F  HSQ + S+  
Sbjct: 246 IRSLLGHEHIVSAVKIWQKNNDVHIASCSRDQTVKIWDFHNGWSLKTFQPHSQWVRSID- 304

Query: 421 INDDLVISASMDGSVRI 437
           +  D +IS S D ++R+
Sbjct: 305 VLGDYIISGSHDTTLRL 321

>AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH]
           (137221..138306) [1086 bp, 361 aa]
          Length = 361

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/87 (20%), Positives = 46/87 (52%), Gaps = 3/87 (3%)

Query: 232 SITGRKTNQITALSWSPDGELIIT-SVENGELRLWN-KDGRLQNVFNF-HRSPIVSIKWN 288
           +I     + ++ +++SP  + + + +  +  +R+W+ ++G  Q    + H++P+++ +W+
Sbjct: 27  TINNPANDSVSDIAFSPQQDFLFSVAAWDNTVRIWDVQNGMTQGRAQYEHQAPVLTTRWS 86

Query: 289 EDSKHFISLDLDNITILWNAINGIILQ 315
            D     S   DNI  L++  +G   Q
Sbjct: 87  SDGTKVASGGCDNILKLYDVASGQAQQ 113

 Score = 32.3 bits (72), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 412 SQSIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNA-IICGKISHDKNKFAI 470
           S S I+ S   D L   A+ D +VRIW V      G A  +  A ++  + S D  K A 
Sbjct: 35  SVSDIAFSPQQDFLFSVAAWDNTVRIWDVQNGMTQGRAQYEHQAPVLTTRWSSDGTKVAS 94

Query: 471 GSMNGQINVYDI 482
           G  +  + +YD+
Sbjct: 95  GGCDNILKLYDV 106

>KLLA0A08800g 770989..772308 similar to sp|P39706 Saccharomyces
           cerevisiae YAR003w FUN16 singleton, start by similarity
          Length = 439

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 5/70 (7%)

Query: 340 DKLVVPGVNGSILVYSIDDNKPIGKLLGHQG----TISCIEFNVNSRLLLTSSDSDYSIR 395
           D L V   NG+I++Y +D  KPI  L  H G    ++  + ++ + R L  SS  D+  +
Sbjct: 40  DYLAVGCSNGAIIIYDMDSLKPIAMLGTHSGAHTRSVQSVCWSNDGRYLW-SSGRDWYAK 98

Query: 396 IWHGQKENCC 405
           +W   +   C
Sbjct: 99  LWDMTQPTKC 108

>Kwal_55.20233
          Length = 747

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 58/133 (43%), Gaps = 29/133 (21%)

Query: 339 KDKLVVPGVNGSI--LVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSD----Y 392
           ++ L+  G   +I  LV+S +  +P+ +L    G+    E+++ +RL L + D +    +
Sbjct: 64  QETLIQGGTGRTIEGLVWSNNPGEPL-RLFSIGGSTVVTEWDLKTRLPLKNHDCNAGVIW 122

Query: 393 SIRIWHGQKENCCNCFYG----------------------HSQSIISLSWINDDLVISAS 430
           S+ I   Q +    C  G                          ++S++W  D+ VI   
Sbjct: 123 SVAINASQNKLAVGCDNGCVVIIDISGGTGVMEHESVLQRQDSRVLSVTWKGDENVIGGC 182

Query: 431 MDGSVRIWSVVEN 443
            DG +R+WS ++N
Sbjct: 183 ADGRIRVWSALKN 195

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,570,903
Number of extensions: 843309
Number of successful extensions: 4397
Number of sequences better than 10.0: 442
Number of HSP's gapped: 3682
Number of HSP's successfully gapped: 857
Length of query: 546
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 439
Effective length of database: 12,891,983
Effective search space: 5659580537
Effective search space used: 5659580537
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)