Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_718.5d1551558321e-116
KLLA0B08547g1211262687e-31
ADL324W1281252644e-30
AEL278W47669710.19
KLLA0D09933g38552660.74
CAGL0G10021g39458651.1
KLLA0F20636g28557622.2
KLLA0B04730g418127596.6
KLLA0E07326g47022587.0
CAGL0F00187g57055587.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_718.5d
         (155 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_718.5d                                                           325   e-116
KLLA0B08547g 756147..756512 no similarity, hypothetical start         107   7e-31
ADL324W [1417] [Homologous to NOHBY] complement(127252..127638) ...   106   4e-30
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    32   0.19 
KLLA0D09933g complement(838199..839356) similar to sp|P43124 Sac...    30   0.74 
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    30   1.1  
KLLA0F20636g complement(1914452..1915309) some similarities with...    28   2.2  
KLLA0B04730g complement(430341..431597) similar to sp|Q04632 Sac...    27   6.6  
KLLA0E07326g complement(666129..667541) similar to sp|Q08271 Sac...    27   7.0  
CAGL0F00187g 19572..21284 similar to sp|P40988 Saccharomyces cer...    27   7.4  

>Scas_718.5d
          Length = 155

 Score =  325 bits (832), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%)

Query: 1   MEEDGGESHIGKEVLGLLTIGHKTPMKRKWAEEEVVGTTAEDEDNDNSTSRILCNEPPCV 60
           MEEDGGESHIGKEVLGLLTIGHKTPMKRKWAEEEVVGTTAEDEDNDNSTSRILCNEPPCV
Sbjct: 1   MEEDGGESHIGKEVLGLLTIGHKTPMKRKWAEEEVVGTTAEDEDNDNSTSRILCNEPPCV 60

Query: 61  NNLIPLDSYPLHVSQFHDNICTKCDANLVTQYLLELHLVECHNPFVSSSHQPLHCFEKDC 120
           NNLIPLDSYPLHVSQFHDNICTKCDANLVTQYLLELHLVECHNPFVSSSHQPLHCFEKDC
Sbjct: 61  NNLIPLDSYPLHVSQFHDNICTKCDANLVTQYLLELHLVECHNPFVSSSHQPLHCFEKDC 120

Query: 121 SQVFPTQMDRIDHLKNFHNYPDFYNFNIIYTGYKL 155
           SQVFPTQMDRIDHLKNFHNYPDFYNFNIIYTGYKL
Sbjct: 121 SQVFPTQMDRIDHLKNFHNYPDFYNFNIIYTGYKL 155

>KLLA0B08547g 756147..756512 no similarity, hypothetical start
          Length = 121

 Score =  107 bits (268), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 54/126 (42%), Positives = 82/126 (65%), Gaps = 8/126 (6%)

Query: 27  KRKWAEEEVVGTTAEDEDNDNSTSRILCNEPPCVNNLIPLDSYPLHVSQFHDNICTKCDA 86
           KR+ +EE   G     E N N+   +LC++PPC +  +P++ YP HVSQ H+N+CT+C  
Sbjct: 3   KRRSSEEHCGGY----ELNGNA---VLCSDPPCDHEWVPIELYPSHVSQMHENVCTQCLR 55

Query: 87  NLVTQYLLELHLVECHNPFVSSSHQPLHCFEKDCSQVFPTQMDRIDHLKNFHNYPDFYNF 146
           N  ++Y +ELH+ E HNPF + +++ L C E+DCS  F    +RIDHLK  H Y D ++F
Sbjct: 56  NFASEYWMELHIEEFHNPFKNGNYR-LRCLEQDCSMTFSNSNERIDHLKRHHYYSDQFDF 114

Query: 147 NIIYTG 152
           +I+ +G
Sbjct: 115 DILNSG 120

>ADL324W [1417] [Homologous to NOHBY] complement(127252..127638)
           [387 bp, 128 aa]
          Length = 128

 Score =  106 bits (264), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 52/125 (41%), Positives = 74/125 (59%), Gaps = 4/125 (3%)

Query: 29  KWAEEEVVGTTAEDEDNDNSTSRILCNEPPCVNNLIPLDSYPLHVSQFHDNICTKCDANL 88
           K    E      EDE +D+    I+CN+PPC    I +  YP HV++ HDN+C  C+ N+
Sbjct: 3   KRLRTEEYSCNQEDERSDSQV--IVCNDPPCSGARISMHIYPSHVAEHHDNVCAACNKNM 60

Query: 89  VTQYLLELHLVECHNPFVSSSHQPLHCFEKDCSQVFPTQMDRIDHLKNFHNYPDFYNFNI 148
           +T+ +L+LHL E H+PF  +S++ L C+E DC Q F T   R +HL   H YP     +I
Sbjct: 61  ITERMLQLHLQELHDPF--NSNKALECYEADCMQQFQTHSKRREHLITVHEYPMNARLDI 118

Query: 149 IYTGY 153
           +YTGY
Sbjct: 119 VYTGY 123

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 32.0 bits (71), Expect = 0.19,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 26/69 (37%), Gaps = 5/69 (7%)

Query: 72  HVSQFHDN--ICTKCDANLVTQYLLELHLVECHNPFVSSSHQPLHCFEKDCSQVFPTQMD 129
           HV   H+    CT CD      Y L+ H+ + H P     +Q   C    C Q F T   
Sbjct: 224 HVLAVHEQKLTCTHCDKRFQRPYRLKTHIAKHHGPASQFRYQ---CTNAGCVQCFETWSA 280

Query: 130 RIDHLKNFH 138
              HL   H
Sbjct: 281 LQQHLHTDH 289

>KLLA0D09933g complement(838199..839356) similar to sp|P43124
           Saccharomyces cerevisiae YDL105w QRI2 singleton, start
           by similarity
          Length = 385

 Score = 30.0 bits (66), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 8/52 (15%)

Query: 109 SHQPLHCF-EKDCSQV-------FPTQMDRIDHLKNFHNYPDFYNFNIIYTG 152
           +H+P++ F +K  S+V       F T+  R ++L  F NY +F  FN    G
Sbjct: 156 THEPVNDFGDKRTSEVDNDDVSAFKTRQKRSNYLSQFGNYTEFNQFNWFKMG 207

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 29.6 bits (65), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 81  CTKCDANLVTQYLLELHLVECHNPFVSSSHQPLHCFEKDCSQVFPTQMDRIDHLKNFH 138
           C +C+ +    Y L+ H+ + HNP V +++Q   C    CS+ F T      H+KN H
Sbjct: 152 CHECNKSFQRPYRLKNHIAKHHNPDVVNAYQ---CTFSVCSKSFKTWSALRLHVKNDH 206

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 28.5 bits (62), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 6/57 (10%)

Query: 79  NICTKCDANLVTQYLLELHLVECHNPFVSSSHQPLHCFEKDCSQVFPTQMDRIDHLK 135
           +IC +C         L  H++      V S  +P  C  + C++ F  + + I HLK
Sbjct: 232 DICAQCGKQFTRPSALRTHML------VHSGDKPFECTWEGCNKKFNVKSNLIRHLK 282

>KLLA0B04730g complement(430341..431597) similar to sp|Q04632
           Saccharomyces cerevisiae YML071c singleton, start by
           similarity
          Length = 418

 Score = 27.3 bits (59), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 49/127 (38%), Gaps = 14/127 (11%)

Query: 25  PMKRKWAEEEVVGTTAEDEDNDNSTSRILCNEPPCV-----------NNLIPLDSYPLHV 73
            M+ K+  EE+      D   ++    ++  +  CV           N+L   +S  +H+
Sbjct: 261 TMRYKFVTEEIDSYRIVDTTANSVKEMLIKRKIECVREYVYGTISVFNSLFKSESKLIHI 320

Query: 74  SQFHDNICTKCDANLVTQYLLELHLVECHNPFVSS--SHQPLHCFEKDCSQVFPTQMDRI 131
               D+  +K   +  T   L   + EC N  +S   +H+  H  E  C Q+        
Sbjct: 321 ELLLDDTTSKTAHDFETSLALLKFINECTNFLISQLETHKS-HLTESVCLQLVYCSFRLA 379

Query: 132 DHLKNFH 138
           D  +NFH
Sbjct: 380 DANQNFH 386

>KLLA0E07326g complement(666129..667541) similar to sp|Q08271
           Saccharomyces cerevisiae YOL132w, start by similarity
          Length = 470

 Score = 26.9 bits (58), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 13/22 (59%)

Query: 46  DNSTSRILCNEPPCVNNLIPLD 67
           D STSRI+ N P C N    LD
Sbjct: 344 DKSTSRIVNNSPACTNKYTNLD 365

>CAGL0F00187g 19572..21284 similar to sp|P40988 Saccharomyces
           cerevisiae YMR319c FET4 low affinity Fe(II) iron
           transport protein, start by similarity
          Length = 570

 Score = 26.9 bits (58), Expect = 7.4,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 28/55 (50%)

Query: 29  KWAEEEVVGTTAEDEDNDNSTSRILCNEPPCVNNLIPLDSYPLHVSQFHDNICTK 83
           K ++E  V TTA+  D  ++ S I C+          + +  L V  ++DN+CTK
Sbjct: 185 KGSKESDVDTTAQGVDESSNKSDINCDCEDKNETTEFIKTGELPVENWYDNLCTK 239

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,177,719
Number of extensions: 276117
Number of successful extensions: 701
Number of sequences better than 10.0: 17
Number of HSP's gapped: 699
Number of HSP's successfully gapped: 17
Length of query: 155
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 62
Effective length of database: 13,376,635
Effective search space: 829351370
Effective search space used: 829351370
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 57 (26.6 bits)