Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_718.5023623610221e-142
Kwal_56.230803141662923e-31
YBR057C (MUM2)3661832944e-31
ABL103W3171742783e-29
KLLA0F18722g2701872744e-29
CAGL0H10164g4841652404e-23
Scas_661.252251521931e-17
AFR670W717122760.097
CAGL0C05049g118143720.33
CAGL0J08228g75233700.54
YIR003W67985671.6
YKL065C20631651.6
ADL357C117771662.2
Kwal_26.863444798642.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_718.50
         (236 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_718.50                                                           398   e-142
Kwal_56.23080                                                         117   3e-31
YBR057C (MUM2) [247] chr2 complement(352153..353253) Protein req...   117   4e-31
ABL103W [489] [Homologous to ScYBR057C (MUM2) - SH] complement(2...   111   3e-29
KLLA0F18722g 1721734..1722546 weakly similar to sp|P38236 Saccha...   110   4e-29
CAGL0H10164g complement(991125..992579) weakly similar to sp|P38...    97   4e-23
Scas_661.25                                                            79   1e-17
AFR670W [3863] [Homologous to ScYNL272C (SEC2) - SH] complement(...    34   0.097
CAGL0C05049g 475910..479455 similar to sp|Q12451 Saccharomyces c...    32   0.33 
CAGL0J08228g 813529..815787 similar to sp|P17065 Saccharomyces c...    32   0.54 
YIR003W (YIR003W) [2668] chr9 (360882..362921) Protein that inte...    30   1.6  
YKL065C (YKL065C) [3194] chr11 complement(316082..316702) Transm...    30   1.6  
ADL357C [1383] [Homologous to ScYML091C (RPM2) - SH] (77473..810...    30   2.2  
Kwal_26.8634                                                           29   2.9  

>Scas_718.50
          Length = 236

 Score =  398 bits (1022), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 202/236 (85%), Positives = 202/236 (85%)

Query: 1   MNYTNYSFDPNRSMETSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVPSYQFQQ 60
           MNYTNYSFDPNRSMETS                                  RVPSYQFQQ
Sbjct: 1   MNYTNYSFDPNRSMETSFSQMSFNQGQQQQPNMYTNNNNNNNTAYNSQINYRVPSYQFQQ 60

Query: 61  PINKQASWDNTMNNGRNEMEDKKLQEKLNVKDIQIESLENEIQNLKKILQLNPNGTRKGD 120
           PINKQASWDNTMNNGRNEMEDKKLQEKLNVKDIQIESLENEIQNLKKILQLNPNGTRKGD
Sbjct: 61  PINKQASWDNTMNNGRNEMEDKKLQEKLNVKDIQIESLENEIQNLKKILQLNPNGTRKGD 120

Query: 121 DDKISKHYGPIFTNLVSSLLERNEEYESLKRDYEELYLKVAMNLDGSNSITKDGRYDTET 180
           DDKISKHYGPIFTNLVSSLLERNEEYESLKRDYEELYLKVAMNLDGSNSITKDGRYDTET
Sbjct: 121 DDKISKHYGPIFTNLVSSLLERNEEYESLKRDYEELYLKVAMNLDGSNSITKDGRYDTET 180

Query: 181 IAHKMLIRFEMLTKENSRMAKMLSYGRPMETDIELQLVEMENQELKERIKQLEMKK 236
           IAHKMLIRFEMLTKENSRMAKMLSYGRPMETDIELQLVEMENQELKERIKQLEMKK
Sbjct: 181 IAHKMLIRFEMLTKENSRMAKMLSYGRPMETDIELQLVEMENQELKERIKQLEMKK 236

>Kwal_56.23080
          Length = 314

 Score =  117 bits (292), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 100/166 (60%), Gaps = 19/166 (11%)

Query: 84  LQEKLNVKDIQIESLENEIQNLKKILQLNPNGTRKGDDDKISKHYGP------------- 130
           +Q +L +K+ QIESLE EIQ+LK I     +G R   +  +    GP             
Sbjct: 150 MQLELQLKETQIESLEVEIQSLKLIFN---DGLRLRQEHDLRALSGPAINASVEVPASLE 206

Query: 131 -IFTNLVSSLLERNEEYESLKRDYEELYLKVAMNLDGSNSITKDGRYDTETIAHKMLIRF 189
            IF  L S+L  +++E +  K+  E +   VA+N   SN++TK GRYD E +AHKM++R 
Sbjct: 207 AIFQKLSSTLATKDKELDETKKRLESIVTAVALN--PSNTVTKLGRYDEEALAHKMVVRL 264

Query: 190 EMLTKENSRMAKMLSYGRPMETDIELQLVEMENQELKERIKQLEMK 235
           E LTKEN  MAKML YGR  E  IE++L++ ENQELK+++ QLE K
Sbjct: 265 ETLTKENQDMAKMLGYGRSKENHIEIELLKKENQELKKKLSQLERK 310

>YBR057C (MUM2) [247] chr2 complement(352153..353253) Protein
           required for premeiotic DNA synthesis and sporulation
           [1101 bp, 366 aa]
          Length = 366

 Score =  117 bits (294), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 106/183 (57%), Gaps = 24/183 (13%)

Query: 71  TMNN-GRNEMEDKK------LQEKLNVKDIQIESLENEIQNLKKILQLNPNGTRKGDDDK 123
           +MNN   NEM   K      L+ +L +K+ QIESLENEIQ LKKI   N     K ++ K
Sbjct: 173 SMNNVNSNEMNSNKDDRMEALEVELQIKESQIESLENEIQRLKKIF--NEGLNYKQNEHK 230

Query: 124 ISKH--YGP-----------IFTNLVSSLLERNEEYESLKRDYEELYLKVAMNLDGSNSI 170
             K   + P           IF  L SSL  + +E    K + E +   +A+N   +NS+
Sbjct: 231 YEKENCHIPQTFELPASLEVIFRKLSSSLHAKEKELAETKENLESILTALALN--PTNSV 288

Query: 171 TKDGRYDTETIAHKMLIRFEMLTKENSRMAKMLSYGRPMETDIELQLVEMENQELKERIK 230
           TK GRYD E+IAHKM++R E LT EN  MAKML+YGR  ET IELQL + EN EL+E+I 
Sbjct: 289 TKYGRYDAESIAHKMVVRLENLTNENKEMAKMLAYGRSKETQIELQLAKKENLELREKIA 348

Query: 231 QLE 233
            LE
Sbjct: 349 SLE 351

>ABL103W [489] [Homologous to ScYBR057C (MUM2) - SH]
           complement(205068..206021) [954 bp, 317 aa]
          Length = 317

 Score =  111 bits (278), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 104/174 (59%), Gaps = 25/174 (14%)

Query: 79  MEDKKLQEKLNVKDIQIESLENEIQNLKKILQLNPNGTRKGDDDKISKH----------Y 128
           ME  +L+  L +K+ QIESLE+EI  LK I   N   T K  + ++ K           +
Sbjct: 140 MESLRLE--LQLKETQIESLEDEITKLKSIF--NQGLTFKQQEQQLQKRKLHQHALDLDH 195

Query: 129 GP---------IFTNLVSSLLERNEEYESLKRDYEELYLKVAMNLDGSNSITKDGRYDTE 179
            P         IF  L +SL  ++EE E  ++  E +   +A+N   SNS+T+ GRYD E
Sbjct: 196 MPVEIPANLEIIFNKLATSLKRKDEELEDTRKRLESIMTAIALNP--SNSVTRFGRYDEE 253

Query: 180 TIAHKMLIRFEMLTKENSRMAKMLSYGRPMETDIELQLVEMENQELKERIKQLE 233
            +AHKM++R EMLTKEN  MAK+LSYGR  ET IEL+L++  N++L+ +++QLE
Sbjct: 254 ALAHKMIVRLEMLTKENQEMAKLLSYGRSKETHIELELLKKVNRDLQRKVEQLE 307

>KLLA0F18722g 1721734..1722546 weakly similar to sp|P38236
           Saccharomyces cerevisiae YBR057c MUM2 meiotic protein
           singleton, hypothetical start
          Length = 270

 Score =  110 bits (274), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 104/187 (55%), Gaps = 19/187 (10%)

Query: 65  QASWDNTMNNGRNEMEDKKLQEKLNVKDIQIESLENEIQNLKKILQLNPNGTRKGDDDK- 123
           ++S  NT  +   E      + +L +K+ QIESLE EI+ LK++   N   T K  +++ 
Sbjct: 88  KSSGFNTTFDSETEPSSDNFKLELQLKETQIESLEIEIKKLKEVF--NQGLTFKQQEEQK 145

Query: 124 --------------ISKHYGPIFTNLVSSLLERNEEYESLKRDYEELYLKVAMNLDGSNS 169
                         I      IF  L  SL  +++E +  KR  E +   VA+N   SNS
Sbjct: 146 MKKSKALTFDSEIQIPASLEIIFCKLSDSLKRKDQELQETKRRLEGIVTAVALN--PSNS 203

Query: 170 ITKDGRYDTETIAHKMLIRFEMLTKENSRMAKMLSYGRPMETDIELQLVEMENQELKERI 229
            TK GRYD E +AHKM+ R E L KEN  MAKMLSYGR  ET IEL+L+  ENQELKER+
Sbjct: 204 TTKFGRYDEEALAHKMVTRLETLMKENEEMAKMLSYGRVKETSIELELLRKENQELKERL 263

Query: 230 KQLEMKK 236
           + L+ +K
Sbjct: 264 RILQQEK 270

>CAGL0H10164g complement(991125..992579) weakly similar to sp|P38236
           Saccharomyces cerevisiae YBR057c MUM2 meiotic protein,
           hypothetical start
          Length = 484

 Score = 97.1 bits (240), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 64/165 (38%), Positives = 95/165 (57%), Gaps = 15/165 (9%)

Query: 84  LQEKLNVKDIQIESLENEIQNLKKILQLNPNGTR----KGDDDK---------ISKHYGP 130
           L+  + VKD Q++SL+ E+  LK  + +  + T+    K  D +         +      
Sbjct: 316 LKYDIQVKDAQLQSLQRELTRLKSAISVAVDNTKDISSKTADKEEHITTKEIDVPNSLDI 375

Query: 131 IFTNLVSSLLERNEEYESLKRDYEELYLKVAMNLDGSNSITKDGRYDTETIAHKMLIRFE 190
           IF  L S+L +R +E +  K + E +    AM L+ SNS TK GRYD E +AHK ++R E
Sbjct: 376 IFRKLSSALQKREKELDETKTNLESVL--AAMALNPSNSSTKFGRYDPENLAHKTVVRLE 433

Query: 191 MLTKENSRMAKMLSYGRPMETDIELQLVEMENQELKERIKQLEMK 235
            LTKEN  MA+MLS+GR  E  I L+L++ EN++LK +I QL+ K
Sbjct: 434 TLTKENQEMARMLSFGRAKEKHIALELLKKENKDLKTQIIQLKEK 478

>Scas_661.25
          Length = 225

 Score = 79.0 bits (193), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/152 (35%), Positives = 87/152 (57%), Gaps = 8/152 (5%)

Query: 88  LNVKDIQIESLENEIQNLKKILQLNPNGTRKGDDDKISK------HYGPIFTNLVSSLLE 141
           L++K+ Q+ SL+ E+ +LK IL+      +K  DD  S       ++  +FT L S L +
Sbjct: 69  LSIKETQLSSLQIEMDHLKSILKERVQEQQKSVDDPNSHELLNVTNHELLFTRLNSLLQD 128

Query: 142 RNEEYESLKRDYEELYLKVAMNLDGSNSITKDGRYDTETIAHKMLIRFEMLTKENSRMAK 201
           +  E + ++  YE +    A+ LD +N +   G+ D E I+ KM+ + E LTKEN  M+K
Sbjct: 129 KEREIKDIRFKYESML--TALALDPANPMKSYGQLDVEMISQKMVTQLETLTKENQEMSK 186

Query: 202 MLSYGRPMETDIELQLVEMENQELKERIKQLE 233
           +L++      +IEL LV  EN EL++R+ QLE
Sbjct: 187 LLNFEVSKSKNIELNLVRKENDELRKRLNQLE 218

>AFR670W [3863] [Homologous to ScYNL272C (SEC2) - SH]
           complement(1667974..1670127) [2154 bp, 717 aa]
          Length = 717

 Score = 33.9 bits (76), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 56/122 (45%), Gaps = 28/122 (22%)

Query: 78  EMEDKKLQEKLNVKDIQIESLENEIQNLKKIL------------------QLNPNGTRKG 119
           E  + +LQE+L  KD+ +++L  +++NLK +L                   +NP+ T   
Sbjct: 136 EQHNARLQEQLREKDMLLDTLTIQLKNLKDVLYKVEDEQNTRSRRQSVMDSVNPSHTSLD 195

Query: 120 DDDKISKHYGPIFTNLVSSLLERNEEYESLKRD---YEELYLKVAMNLDGSNSITKDGRY 176
            D      Y   F N++SS L      +SL+ D   Y E YL+    L    SI +D R+
Sbjct: 196 VDG-----YASAFDNMLSSGLLFTPAVQSLRYDIPMYTE-YLRFLAVLPMCKSI-RDTRH 248

Query: 177 DT 178
           D+
Sbjct: 249 DS 250

>CAGL0C05049g 475910..479455 similar to sp|Q12451 Saccharomyces
           cerevisiae YDL019c OSH2, hypothetical start
          Length = 1181

 Score = 32.3 bits (72), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 30/43 (69%), Gaps = 3/43 (6%)

Query: 82  KKLQEKLNVKDIQIESLENEIQNLKKILQL---NPNGTRKGDD 121
           K+L+ +L  KD ++ SL+ E +NLKK+LQ    +PNGT + DD
Sbjct: 628 KELEFELKDKDERLASLDKERRNLKKLLQRKFQSPNGTTEDDD 670

>CAGL0J08228g 813529..815787 similar to sp|P17065 Saccharomyces
           cerevisiae YNL272c SEC2 protein transport protein, start
           by similarity
          Length = 752

 Score = 31.6 bits (70), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 25/33 (75%)

Query: 78  EMEDKKLQEKLNVKDIQIESLENEIQNLKKILQ 110
           E+++ +LQE L  KD  +E+L  +++NLKK+LQ
Sbjct: 128 EIQNSRLQETLKEKDTVLETLNLQLKNLKKVLQ 160

>YIR003W (YIR003W) [2668] chr9 (360882..362921) Protein that
           interacts with Abp1p through a C-terminal SH3 binding
           motif, has similarity to E. coli and Bacillus subtilis
           MinD [2040 bp, 679 aa]
          Length = 679

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 42/85 (49%), Gaps = 4/85 (4%)

Query: 53  VPSYQFQQPINKQAS--WDNTMNNGRNEMED-KKLQEKLNVKDIQIESLENEIQNLKKIL 109
           +P    Q+P+ +  +   +N MNN   E+E+ + L  K N+ ++  +     ++   K+ 
Sbjct: 71  LPKVPLQRPVRRSTTEELNNVMNNTSKELEEIESLISKHNIHNVSRKKSPTSVEE-GKVA 129

Query: 110 QLNPNGTRKGDDDKISKHYGPIFTN 134
            ++ NG R   D+K S +  P+  N
Sbjct: 130 AIHQNGQRSASDNKTSTNPSPLEKN 154

>YKL065C (YKL065C) [3194] chr11 complement(316082..316702)
           Transmembrane protein of the endoplasmic reticulum [621
           bp, 206 aa]
          Length = 206

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%)

Query: 77  NEMEDKKLQEKLNVKDIQIESLENEIQNLKK 107
           NE +  KLQE+L  K I +E L+ +++NL+K
Sbjct: 155 NEADSTKLQEELRKKQISLEGLQKQVKNLEK 185

>ADL357C [1383] [Homologous to ScYML091C (RPM2) - SH] (77473..81006)
           [3534 bp, 1177 aa]
          Length = 1177

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 8/71 (11%)

Query: 131 IFTNLVSSLLERNEEYESLKRDYEELYLKVAMNLDGSNSITKDGRYDTETIAHKML---- 186
           I+T ++ SLLER    + LK    E + K+A++L  +++ T    ++ E +   +L    
Sbjct: 259 IYTIVIGSLLERAATTKVLKEGLGEDFFKIALDLFFASNYTHTRGFNQELLDRILLGANL 318

Query: 187 ----IRFEMLT 193
               I++ MLT
Sbjct: 319 YPGHIKYSMLT 329

>Kwal_26.8634
          Length = 447

 Score = 29.3 bits (64), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 44/98 (44%), Gaps = 26/98 (26%)

Query: 94  QIESLENEIQNLKKILQLNPNGTRKGDDD-KISKHYGPI------FTNLVSSLLER---- 142
           +IE+L  EI NLK  LQL+  G + G++D K+      +      F N  +SLL R    
Sbjct: 61  EIEALHEEIANLK--LQLSSKGAKDGEEDNKLKATLAKVQEEKTQFENQYNSLLSRLSSM 118

Query: 143 ----------NEEYESLK---RDYEELYLKVAMNLDGS 167
                      EE ES +   R+YE   L +   LD +
Sbjct: 119 KSVFNKMRESQEELESCQEQLREYESQNLSLRNKLDST 156

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.128    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,048,002
Number of extensions: 297294
Number of successful extensions: 1683
Number of sequences better than 10.0: 150
Number of HSP's gapped: 1658
Number of HSP's successfully gapped: 168
Length of query: 236
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 138
Effective length of database: 13,203,545
Effective search space: 1822089210
Effective search space used: 1822089210
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 60 (27.7 bits)