Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_718.532432416610.0
CAGL0K12210g31132411021e-152
YBR104W (YMC2)32933210921e-150
Scas_667.2230632410831e-149
YPR058W (YMC1)30732610611e-146
Sklu_1926.230532410591e-145
CAGL0D01606g30532410511e-144
Kwal_27.1259930432410001e-136
KLLA0B08503g3033249571e-130
Sklu_2398.43093238951e-120
Kwal_33.129883033238861e-119
Sklu_1275.13113238821e-118
Kwal_56.230113033238761e-118
KLLA0F17864g3072868511e-114
KLLA0E09680g3072883237e-35
CAGL0B04543g3173043221e-34
ADL264C3292943222e-34
Kwal_33.154463052913184e-34
Scas_697.473283013187e-34
KLLA0C13431g3283063161e-33
Kwal_23.29133203023124e-33
YOR100C (CRC1)3273053048e-32
CAGL0B03883g3063072958e-31
Sklu_2127.52782842869e-30
KLLA0E02772g2842982861e-29
Sklu_2075.33452882891e-29
AGL311C3623042892e-29
Sklu_2037.23103092835e-29
YPL134C (ODC1)3103012774e-28
ACR109W2993032712e-27
YOR130C (ORT1)2922952712e-27
Kwal_55.213353172942712e-27
Kwal_26.86692962892703e-27
Scas_640.253063032695e-27
CAGL0K10362g3013042661e-26
Scas_691.43343112653e-26
YJR095W (SFC1)3223102626e-26
Scas_632.92922932591e-25
Sklu_2334.23193052572e-25
ADL049W9122872592e-24
KLLA0F03212g3052972493e-24
YOR222W (ODC2)3073002484e-24
KLLA0D07073g2972892468e-24
AFR146W2812972412e-23
KLLA0E13453g9062932451e-22
Scas_709.93652932382e-22
Scas_602.88852892423e-22
Kwal_47.182163333322363e-22
CAGL0J04114g3033132336e-22
Scas_714.183053182328e-22
YPR021C (AGC1)9022832381e-21
CAGL0M09020g3483292321e-21
CAGL0K02365g9192892334e-21
CAGL0J02002g3613012261e-20
YBR291C (CTP1)2993062185e-20
Kwal_26.79672973002185e-20
Scas_662.123083112178e-20
KLLA0F04697g3072982142e-19
Kwal_23.47313143052125e-19
Sklu_1149.22962992107e-19
Sklu_2363.23233012091e-18
CAGL0G08910g2892972045e-18
Kwal_47.173218812912095e-18
Sklu_2359.69022962061e-17
YIL006W3732892031e-17
Scas_489.42973001965e-17
Kwal_55.208683803031985e-17
YEL006W3353011932e-16
CAGL0L02079g2973091903e-16
Sklu_2431.53703191915e-16
ADL009W3793071899e-16
KLLA0C11363g5173151901e-15
YIL134W (FLX1)3113061843e-15
Kwal_27.120813693111844e-15
YPR011C3263021818e-15
KLLA0E18810g3773061811e-14
KLLA0D14036g4313231774e-14
AER366W2932971745e-14
YNL083W5452561732e-13
AGL047C3162961702e-13
KLLA0D15015g3173031693e-13
CAGL0G01166g2952791683e-13
Scas_578.3*5242521704e-13
YNL003C (PET8)2842841665e-13
Sklu_2374.75133291686e-13
Scas_589.103163201641e-12
Kwal_23.30425423141661e-12
ACR260W3113181631e-12
Scas_721.273743181641e-12
CAGL0J01661g3272981622e-12
YLR348C (DIC1)2982801612e-12
Sklu_2432.52882831612e-12
KLLA0E23705g3683171596e-12
Kwal_14.22103153011587e-12
Scas_716.293163141578e-12
CAGL0J05522g5192551572e-11
CAGL0K08250g2972951552e-11
AEL253W3653121552e-11
CAGL0F04213g3062951533e-11
Scas_379.23013021533e-11
YGR096W (TPC1)3143061524e-11
YKL120W (OAC1)3243031516e-11
Scas_582.73291821517e-11
KLLA0B12826g3192981507e-11
YJL133W (MRS3)3143011508e-11
Kwal_23.43543432821501e-10
CAGL0G03135g3073101481e-10
Scas_702.103022791472e-10
AER419W4932521464e-10
CAGL0K02915g3423401444e-10
Kwal_33.140503143111445e-10
KLLA0E15532g3263211445e-10
Scas_558.22892971435e-10
Scas_687.15*3283271435e-10
AAR036W3173011411e-09
YHR002W (LEU5)3573291411e-09
Sklu_2430.103241881392e-09
CAGL0M05225g3813131392e-09
Kwal_27.124813043091373e-09
AFR131C3442731383e-09
KLLA0E08877g2941891364e-09
AGL064W2962841355e-09
Scas_718.243372971356e-09
Kwal_0.2322742901347e-09
AAL014C2713051339e-09
Sklu_2435.23442551349e-09
AER184W3053081331e-08
YMR166C3683261341e-08
Sklu_2442.82752921321e-08
Kwal_23.39653073191321e-08
CAGL0K11616g3202981321e-08
Kwal_23.35293952911332e-08
Kwal_27.114192981871312e-08
Scas_562.123002831312e-08
YBL030C (PET9)3183051312e-08
Scas_667.43083071312e-08
AGR383W2931891302e-08
Sklu_2117.22982871302e-08
YBR085W (AAC3)3072991302e-08
CAGL0F07711g3681851313e-08
Kwal_26.79723583321294e-08
Scas_717.203563331294e-08
YBR192W (RIM2)3773171285e-08
Kwal_55.211063282541276e-08
Scas_721.1293231891277e-08
AGL065C3353181269e-08
YKR052C (MRS4)3041771251e-07
CAGL0J09790g3002801242e-07
KLLA0D04290g1881811202e-07
CAGL0F08305g3742731242e-07
Kwal_26.76533251881232e-07
CAGL0L05742g3051911223e-07
Sklu_2115.42991861204e-07
CAGL0H03839g2822871195e-07
Sklu_2433.84203331206e-07
KLLA0A09383g3662221198e-07
CAGL0F00231g3071681171e-06
AFL196W3612971181e-06
YDL198C (YHM1)3002841171e-06
KLLA0E12353g3053091171e-06
Kwal_47.192282811481161e-06
KLLA0D09889g3642891171e-06
KLLA0E02750g3042831152e-06
YGR257C (MTM1)3662771152e-06
Kwal_27.116262992841143e-06
YMR056C (AAC1)3091751143e-06
YER053C3002731133e-06
KLLA0F13464g3001521134e-06
KLLA0B11319g3552841134e-06
Sklu_2194.33122751107e-06
Kwal_33.155973051681109e-06
KLLA0E18788g3812021109e-06
AER450C3081701091e-05
Scas_673.173142021091e-05
CAGL0H10538g2971901082e-05
KLLA0D04950g2742921063e-05
YJR077C (MIR1)3111691063e-05
KLLA0B14454g3051881054e-05
Scas_705.93232981021e-04
Sklu_1119.13071681011e-04
Scas_669.63733001011e-04
KLLA0A00979g3431441002e-04
Scas_328.1227164982e-04
ADR036C340255973e-04
AGR191W298279974e-04
Sklu_2260.5302247947e-04
AFR253W344167957e-04
Scas_645.9391282958e-04
YPR128C (ANT1)328274900.003
Scas_613.24177178870.003
CAGL0D04774g322299890.003
AFR147C315250890.004
YDL119C307219860.009
ABL023W309172840.016
CAGL0C02013g329328830.021
YFR045W28572820.022
Scas_715.4530568800.049
Kwal_55.21338323128800.052
Sklu_2127.4323273790.057
KLLA0D04312g10394700.23
Kwal_23.575730768730.31
KLLA0F08547g308181662.4
Scas_671.1*12384623.6
AAL157C47956654.0
Scas_688.329650644.5
YFR002W (NIC96)839109645.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_718.5
         (324 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_718.5                                                            644   0.0  
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...   429   e-152
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...   425   e-150
Scas_667.22                                                           421   e-149
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...   413   e-146
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement         412   e-145
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...   409   e-144
Kwal_27.12599                                                         389   e-136
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...   373   e-130
Sklu_2398.4 , Contig c2398 9476-10405                                 349   e-120
Kwal_33.12988                                                         345   e-119
Sklu_1275.1 , Contig c1275 314-1249                                   344   e-118
Kwal_56.23011                                                         342   e-118
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...   332   e-114
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...   129   7e-35
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...   128   1e-34
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...   128   2e-34
Kwal_33.15446                                                         127   4e-34
Scas_697.47                                                           127   7e-34
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...   126   1e-33
Kwal_23.2913                                                          124   4e-33
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...   121   8e-32
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...   118   8e-31
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement        114   9e-30
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...   114   1e-29
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement               115   1e-29
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...   115   2e-29
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement        113   5e-29
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...   111   4e-28
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...   108   2e-27
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...   108   2e-27
Kwal_55.21335                                                         108   2e-27
Kwal_26.8669                                                          108   3e-27
Scas_640.25                                                           108   5e-27
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...   107   1e-26
Scas_691.4                                                            106   3e-26
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...   105   6e-26
Scas_632.9                                                            104   1e-25
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement        103   2e-25
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....   104   2e-24
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...   100   3e-24
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...   100   4e-24
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    99   8e-24
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    97   2e-23
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    99   1e-22
Scas_709.9                                                             96   2e-22
Scas_602.8                                                             98   3e-22
Kwal_47.18216                                                          96   3e-22
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    94   6e-22
Scas_714.18                                                            94   8e-22
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    96   1e-21
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    94   1e-21
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    94   4e-21
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    92   1e-20
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    89   5e-20
Kwal_26.7967                                                           89   5e-20
Scas_662.12                                                            88   8e-20
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    87   2e-19
Kwal_23.4731                                                           86   5e-19
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         86   7e-19
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          85   1e-18
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    83   5e-18
Kwal_47.17321                                                          85   5e-18
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          84   1e-17
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    83   1e-17
Scas_489.4                                                             80   5e-17
Kwal_55.20868                                                          81   5e-17
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    79   2e-16
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    78   3e-16
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            78   5e-16
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    77   9e-16
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    78   1e-15
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    75   3e-15
Kwal_27.12081                                                          75   4e-15
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    74   8e-15
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    74   1e-14
KLLA0D14036g complement(1203522..1204817) some similarities with...    73   4e-14
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    72   5e-14
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    71   2e-13
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    70   2e-13
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    70   3e-13
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    69   3e-13
Scas_578.3*                                                            70   4e-13
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    69   5e-13
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       69   6e-13
Scas_589.10                                                            68   1e-12
Kwal_23.3042                                                           69   1e-12
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    67   1e-12
Scas_721.27                                                            68   1e-12
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    67   2e-12
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    67   2e-12
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       67   2e-12
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    66   6e-12
Kwal_14.2210                                                           65   7e-12
Scas_716.29                                                            65   8e-12
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    65   2e-11
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    64   2e-11
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    64   2e-11
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    64   3e-11
Scas_379.2                                                             64   3e-11
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    63   4e-11
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    63   6e-11
Scas_582.7                                                             63   7e-11
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    62   7e-11
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    62   8e-11
Kwal_23.4354                                                           62   1e-10
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    62   1e-10
Scas_702.10                                                            61   2e-10
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    61   4e-10
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    60   4e-10
Kwal_33.14050                                                          60   5e-10
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    60   5e-10
Scas_558.2                                                             60   5e-10
Scas_687.15*                                                           60   5e-10
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    59   1e-09
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    59   1e-09
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         58   2e-09
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    58   2e-09
Kwal_27.12481                                                          57   3e-09
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    58   3e-09
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    57   4e-09
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    57   5e-09
Scas_718.24                                                            57   6e-09
Kwal_0.232                                                             56   7e-09
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    56   9e-09
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         56   9e-09
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    56   1e-08
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    56   1e-08
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          55   1e-08
Kwal_23.3965                                                           55   1e-08
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    55   1e-08
Kwal_23.3529                                                           56   2e-08
Kwal_27.11419                                                          55   2e-08
Scas_562.12                                                            55   2e-08
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    55   2e-08
Scas_667.4                                                             55   2e-08
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    55   2e-08
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            55   2e-08
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    55   2e-08
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    55   3e-08
Kwal_26.7972                                                           54   4e-08
Scas_717.20                                                            54   4e-08
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    54   5e-08
Kwal_55.21106                                                          54   6e-08
Scas_721.129                                                           54   7e-08
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    53   9e-08
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    53   1e-07
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    52   2e-07
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    51   2e-07
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    52   2e-07
Kwal_26.7653                                                           52   2e-07
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    52   3e-07
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            51   4e-07
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    50   5e-07
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       51   6e-07
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    50   8e-07
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    50   1e-06
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    50   1e-06
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    50   1e-06
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    50   1e-06
Kwal_47.19228                                                          49   1e-06
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    50   1e-06
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    49   2e-06
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    49   2e-06
Kwal_27.11626                                                          49   3e-06
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    49   3e-06
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    48   3e-06
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    48   4e-06
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    48   4e-06
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            47   7e-06
Kwal_33.15597                                                          47   9e-06
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    47   9e-06
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    47   1e-05
Scas_673.17                                                            47   1e-05
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    46   2e-05
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    45   3e-05
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    45   3e-05
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    45   4e-05
Scas_705.9                                                             44   1e-04
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             44   1e-04
Scas_669.6                                                             44   1e-04
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    43   2e-04
Scas_328.1                                                             42   2e-04
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    42   3e-04
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    42   4e-04
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         41   7e-04
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    41   7e-04
Scas_645.9                                                             41   8e-04
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    39   0.003
Scas_613.24                                                            38   0.003
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    39   0.003
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    39   0.004
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    38   0.009
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    37   0.016
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    37   0.021
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    36   0.022
Scas_715.45                                                            35   0.049
Kwal_55.21338                                                          35   0.052
Sklu_2127.4 , Contig c2127 6322-7293                                   35   0.057
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    32   0.23 
Kwal_23.5757                                                           33   0.31 
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    30   2.4  
Scas_671.1*                                                            28   3.6  
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    30   4.0  
Scas_688.3                                                             29   4.5  
YFR002W (NIC96) [1682] chr6 (150011..152530) Nuclear pore protei...    29   5.8  

>Scas_718.5
          Length = 324

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/324 (96%), Positives = 312/324 (96%)

Query: 1   MSEDFSSPQLINEFDDEMAXXXXXXXXXXXXMAKDSTRVLKDILAGTCGGISQVIVGQPF 60
           MSEDFSSPQLINEFDDEMA            MAKDSTRVLKDILAGTCGGISQVIVGQPF
Sbjct: 1   MSEDFSSPQLINEFDDEMASNGNDNNGSSHSMAKDSTRVLKDILAGTCGGISQVIVGQPF 60

Query: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120
           DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF
Sbjct: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120

Query: 121 FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFK 180
           FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFK
Sbjct: 121 FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFK 180

Query: 181 GPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLC 240
           GPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLC
Sbjct: 181 GPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLC 240

Query: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300
           SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP
Sbjct: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300

Query: 301 TMLRAAPVNGATFVTFELVMRLLG 324
           TMLRAAPVNGATFVTFELVMRLLG
Sbjct: 301 TMLRAAPVNGATFVTFELVMRLLG 324

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score =  429 bits (1102), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 194/324 (59%), Positives = 245/324 (75%), Gaps = 13/324 (4%)

Query: 1   MSEDFSSPQLINEFDDEMAXXXXXXXXXXXXMAKDSTRVLKDILAGTCGGISQVIVGQPF 60
           MSE+F +PQL+NE +D                     RV+KDI AGT GG++QV+VGQPF
Sbjct: 1   MSEEFPTPQLLNELED-------------VPPPTPYGRVVKDIFAGTMGGVAQVLVGQPF 47

Query: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120
           DTTKVR+QTS   +G +++++ L++NEG  AFYKG L P++GVG CVSVQFGVNE+MKRF
Sbjct: 48  DTTKVRLQTSKTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRF 107

Query: 121 FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFK 180
           F  +N  R    +   L L QYY+CGLTGGVVNSFLA+PIEHVRIRLQTQT  GNER+FK
Sbjct: 108 FAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFK 167

Query: 181 GPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLC 240
           GP DCI+KL K K+LMRGL P M+RAGHGLG YF  YEAL+  E +KG  R++I +WKLC
Sbjct: 168 GPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLC 227

Query: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300
           S+G+LSG +LWL +YP+DVVKS++QTD++ NP++KNS+      LY++ GI AFFKGF P
Sbjct: 228 SFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVP 287

Query: 301 TMLRAAPVNGATFVTFELVMRLLG 324
           TM+RAAP N ATFV+FE+ MR+LG
Sbjct: 288 TMIRAAPANAATFVSFEMTMRVLG 311

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score =  425 bits (1092), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 205/332 (61%), Positives = 247/332 (74%), Gaps = 13/332 (3%)

Query: 1   MSEDFSSPQLINEFDDEMAXXXXXXXXXXXXMAKDSTRVLKDILAGTCGGISQVIVGQPF 60
           MSE+F +PQL++E +D+                  S RVLKDI AGT GGI+QV+VGQPF
Sbjct: 1   MSEEFPTPQLLDELEDQQKVTTPNEKREL-----SSNRVLKDIFAGTIGGIAQVLVGQPF 55

Query: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120
           DTTKVR+QT+      L+++R LVKNEGV+AFYKG+L P++GVG CVSVQFGVNEAMKRF
Sbjct: 56  DTTKVRLQTATTRTTTLEVLRNLVKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRF 115

Query: 121 FREWNTSRGTQ--------HRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTG 172
           F+ +N S+            R  TL L QYY+CGLTGGVVNSFLASPIE +RIRLQTQT 
Sbjct: 116 FQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTS 175

Query: 173 NGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRS 232
           NG +REFKGP DCI+KL  +  LMRGL P M+RAGHGLG YFL YEAL+A EI  G  R+
Sbjct: 176 NGGDREFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRN 235

Query: 233 EIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGIS 292
           EI  WKLC +G+ SG +LWL +YPLDVVKS+IQ D LR P++KNS+  V   +Y ++GI 
Sbjct: 236 EIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIR 295

Query: 293 AFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
           AFFKGF PTM+R+APVNGATF+TFELVMR LG
Sbjct: 296 AFFKGFGPTMVRSAPVNGATFLTFELVMRFLG 327

>Scas_667.22
          Length = 306

 Score =  421 bits (1083), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 199/324 (61%), Positives = 244/324 (75%), Gaps = 18/324 (5%)

Query: 1   MSEDFSSPQLINEFDDEMAXXXXXXXXXXXXMAKDSTRVLKDILAGTCGGISQVIVGQPF 60
           MSE+F +PQLI++ ++                  D+ RV+KD+LAGT GGI+QV+VGQPF
Sbjct: 1   MSEEFPTPQLIDDLENHPK--------------HDNARVIKDLLAGTAGGIAQVLVGQPF 46

Query: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120
           DTTKVR+QTS+    A+++IRKL+KNEG   FYKG+L P++GVGACVS+QFGVNEAMKRF
Sbjct: 47  DTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRF 106

Query: 121 FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFK 180
           F   N    +Q     L L QYYICGLTGG+ NSFLASPIEHVRIRLQTQTG+G   EFK
Sbjct: 107 FHSRNPDSTSQ----ILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFK 162

Query: 181 GPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLC 240
           GPLDCIRKL  +   MRGL P MLR GHG G YFL YEA++ANEI KG  R+E+ +WKLC
Sbjct: 163 GPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLC 222

Query: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300
            +G+LSG  LW+ +YPLDV+KS++QTD L++P++ NS+ +V   LY + G+ AFFKGF P
Sbjct: 223 LFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYAKGGLGAFFKGFGP 282

Query: 301 TMLRAAPVNGATFVTFELVMRLLG 324
           TMLRAAP NGATF TFEL MRLLG
Sbjct: 283 TMLRAAPANGATFATFELAMRLLG 306

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score =  413 bits (1061), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 198/326 (60%), Positives = 243/326 (74%), Gaps = 21/326 (6%)

Query: 1   MSEDFSSPQLINEFDDEMAXXXXXXXXXXXXMAKDSTRVLKDILAGTCGGISQVIVGQPF 60
           MSE+F SPQLI++ ++                  D+ RV+KD+LAGT GGI+QV+VGQPF
Sbjct: 1   MSEEFPSPQLIDDLEEHPQ--------------HDNARVVKDLLAGTAGGIAQVLVGQPF 46

Query: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120
           DTTKVR+QTS+    A++++RKL+ NEG   FYKG+L P++GVGACVS+QFGVNEAMKRF
Sbjct: 47  DTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRF 106

Query: 121 FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFK 180
           F   N    +     TL L QYY CG+TGG+VNSFLASPIEHVRIRLQTQTG+G   EFK
Sbjct: 107 FHHRNADMSS-----TLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFK 161

Query: 181 GPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKK--GKDRSEIASWK 238
           GPL+CI+KL   K+L+RGL P +LR GHG G YFL YEALIAN++ K  G +R +I +WK
Sbjct: 162 GPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWK 221

Query: 239 LCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGF 298
           LC +G+LSG  LWL +YPLDV+KS++QTD L+ P+F NS+ +V   LY   GI AFFKGF
Sbjct: 222 LCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGF 281

Query: 299 APTMLRAAPVNGATFVTFELVMRLLG 324
            PTMLRAAP NGATF TFEL MRLLG
Sbjct: 282 GPTMLRAAPANGATFATFELAMRLLG 307

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score =  412 bits (1059), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 199/324 (61%), Positives = 235/324 (72%), Gaps = 19/324 (5%)

Query: 1   MSEDFSSPQLINEFDDEMAXXXXXXXXXXXXMAKDSTRVLKDILAGTCGGISQVIVGQPF 60
           M+E+  +P +I++ D                 A DSTRV KD+LAGT GG+SQV++GQPF
Sbjct: 1   MTEELPTPLIIDDLDG----------------AHDSTRVFKDLLAGTAGGVSQVLIGQPF 44

Query: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120
           DTTKVR+QTS+    ALD+++KLVKNEG   FYKG+L P+VGVGACVSVQFGVNEAMKRF
Sbjct: 45  DTTKVRLQTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRF 104

Query: 121 FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFK 180
           F   N + G      TL L QYY+CG  GG  NSFLASPIEHVRIRLQTQTG G   +F 
Sbjct: 105 FHSRNGNSGPNE---TLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFH 161

Query: 181 GPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLC 240
           GPLDCI+KL    SLMRGL P MLR  HG G YFLTYEALIANE+ KG  RSEI +WKLC
Sbjct: 162 GPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLC 221

Query: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300
            +G+ SG  LWL IYPLDV+KS++QTD+L  P+   +M  V   +Y  +G+S+FFKGF P
Sbjct: 222 LFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGP 281

Query: 301 TMLRAAPVNGATFVTFELVMRLLG 324
           TMLRAAP NGATF TFEL MR+LG
Sbjct: 282 TMLRAAPANGATFATFELAMRVLG 305

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score =  409 bits (1051), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 194/324 (59%), Positives = 238/324 (73%), Gaps = 19/324 (5%)

Query: 1   MSEDFSSPQLINEFDDEMAXXXXXXXXXXXXMAKDSTRVLKDILAGTCGGISQVIVGQPF 60
           MSE+F +PQLI++ +D                 +D+ RV+KD+LAGT GGI+QV++GQPF
Sbjct: 1   MSEEFPTPQLIDDLEDHPG--------------QDNGRVVKDLLAGTAGGIAQVLIGQPF 46

Query: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120
           DTTKVR+QTS     A ++++ L+KNEG   FYKG+L P+VGVGACVS+QFGVNEAMKRF
Sbjct: 47  DTTKVRLQTSKVPTSAAEVVKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVNEAMKRF 106

Query: 121 FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFK 180
           F   N        + TL L QYY+CGLTGG+ NSFLASPIEHVRIRLQTQTG+G + EFK
Sbjct: 107 FHARNVDH-----NATLSLSQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAEFK 161

Query: 181 GPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLC 240
           GP+DCI+KL  +K LMRGL P MLR GHG G YFL YEAL++ +I +G  R+EI  WKLC
Sbjct: 162 GPIDCIKKLRSQKGLMRGLIPTMLREGHGCGTYFLVYEALVSKQINQGLKRTEIPPWKLC 221

Query: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300
            YG+LSG  LWL +YP+DVVKS++QTD L  P+   +M  V  +LY  +G+ AFFKGF P
Sbjct: 222 LYGALSGTALWLMVYPIDVVKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGP 281

Query: 301 TMLRAAPVNGATFVTFELVMRLLG 324
           TMLRAAP NG TF TFEL MRLLG
Sbjct: 282 TMLRAAPANGGTFATFELAMRLLG 305

>Kwal_27.12599
          Length = 304

 Score =  389 bits (1000), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 193/324 (59%), Positives = 232/324 (71%), Gaps = 20/324 (6%)

Query: 1   MSEDFSSPQLINEFDDEMAXXXXXXXXXXXXMAKDSTRVLKDILAGTCGGISQVIVGQPF 60
           M E+ SSP LI++ D +                 DS RVLKD+LAGT GG++QV+VGQPF
Sbjct: 1   MPEETSSPLLIDDIDQQ---------------PHDSGRVLKDLLAGTAGGMAQVLVGQPF 45

Query: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120
           DTTKVR+QTS     A+++++KLVKNEG+  FYKG+L P+VGVGACVS QFGVNEAMKRF
Sbjct: 46  DTTKVRLQTSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRF 105

Query: 121 FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFK 180
           FR    S    H+  TL L QYYICG  GGV NSFLASPIEHVRIRLQTQT +G   EFK
Sbjct: 106 FRG---SSADPHK--TLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFK 160

Query: 181 GPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLC 240
           GPLDCI KL    +LMRGL P +LR   G   YFLTYEAL+AN+I KG  RS++ +WKLC
Sbjct: 161 GPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLC 220

Query: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300
            +G++SGV LWL +YPLDV+KS++QTD L+NP    ++  V   +  + G  +FFKGF P
Sbjct: 221 LFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGP 280

Query: 301 TMLRAAPVNGATFVTFELVMRLLG 324
           TMLRAAP NGATF TFEL MR LG
Sbjct: 281 TMLRAAPANGATFATFELAMRFLG 304

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score =  373 bits (957), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 188/324 (58%), Positives = 234/324 (72%), Gaps = 21/324 (6%)

Query: 1   MSEDFSSPQLINEFDDEMAXXXXXXXXXXXXMAKDSTRVLKDILAGTCGGISQVIVGQPF 60
           M+E+F +PQLI++ +                   D+TRV+KD+LAGT GGI+QV+VGQPF
Sbjct: 1   MTEEFPTPQLIDDLES----------------PHDNTRVIKDLLAGTAGGIAQVLVGQPF 44

Query: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120
           DTTKVR+QTS  S  A+ +I+ L+KNEG   FYKG+L P+VGVGACVS+QFGVNEAMKRF
Sbjct: 45  DTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRF 104

Query: 121 FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFK 180
           F  ++ +  +QH    L L QYYICG+ GG  NSFLASPIEH+RIRLQTQTG+G   EFK
Sbjct: 105 FHTFDEA-ASQH----LSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFK 159

Query: 181 GPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLC 240
           GP+DCI+KL     LMRGL P MLR  HG G YFLTYEALI +++K G  R +I +WKLC
Sbjct: 160 GPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLC 219

Query: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300
            +G+ SG +LW  +YPLDV+KS++QTD L+ P+  N++  V   +   QG+S  FKGFAP
Sbjct: 220 LFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAP 279

Query: 301 TMLRAAPVNGATFVTFELVMRLLG 324
           TMLRAAP N ATF TFE  MRLLG
Sbjct: 280 TMLRAAPANAATFATFETAMRLLG 303

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score =  349 bits (895), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 169/323 (52%), Positives = 218/323 (67%), Gaps = 21/323 (6%)

Query: 1   MSEDFSSPQLINEFDDEMAXXXXXXXXXXXXMAKDSTRVLKDILAGTCGGISQVIVGQPF 60
           MS++ ++PQ++++  D +                D  R +KDIL+GT GGI+QV+VGQPF
Sbjct: 1   MSDELTAPQVVDDLSDSL----------------DYKRAIKDILSGTAGGIAQVLVGQPF 44

Query: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120
           D TKVRMQTSA S  A+D++  L+KNEG+  FYKG+L P+VGVGACVS QFGVNEAMKR 
Sbjct: 45  DITKVRMQTSAGSATAVDVVTSLIKNEGILGFYKGTLAPLVGVGACVSCQFGVNEAMKRR 104

Query: 121 FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFK 180
           FR  N           L L QYY+CG+  G  N+FLA+PIEHVRIRLQ QT +    E++
Sbjct: 105 FRRMNGDPSK-----PLSLKQYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLANAEYQ 159

Query: 181 GPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLC 240
           G LDC+RKL+K+ +LMRG    ++R  HG G YF TYEALIAN+ KKG  R +IA WK+C
Sbjct: 160 GSLDCMRKLLKQGALMRGFTATLMRTCHGFGIYFSTYEALIANQHKKGIPRKDIAPWKVC 219

Query: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300
            +G+ SG   W   YP+DVVKS++Q+D L +P    ++  V   +Y  +G  AF KGF P
Sbjct: 220 IFGAFSGACYWAMAYPIDVVKSIMQSDRLVSPVHGTNVWQVAKSIYTTRGKRAFIKGFMP 279

Query: 301 TMLRAAPVNGATFVTFELVMRLL 323
            MLR+ PVNGATF TFE+ MRLL
Sbjct: 280 AMLRSLPVNGATFATFEMTMRLL 302

>Kwal_33.12988
          Length = 303

 Score =  345 bits (886), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 162/323 (50%), Positives = 220/323 (68%), Gaps = 21/323 (6%)

Query: 1   MSEDFSSPQLINEFDDEMAXXXXXXXXXXXXMAKDSTRVLKDILAGTCGGISQVIVGQPF 60
           MS++ + PQ++++  D+                 D  R LKDI AGT GGI+QV+VGQPF
Sbjct: 1   MSDELTMPQVVDDLTDK----------------SDIRRTLKDITAGTTGGIAQVLVGQPF 44

Query: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120
           D TKVR+QTS+    AL +++ LVKNEG+  FYKG+ +P++GVG CVS QFG NEAMKR+
Sbjct: 45  DITKVRLQTSSTPTTALRVVQDLVKNEGLRGFYKGTTLPLIGVGLCVSSQFGTNEAMKRY 104

Query: 121 FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFK 180
           F + N  + T     +L+L +YY CG   G  N+FLA+PIEHVRI LQ QT +  + E++
Sbjct: 105 FHKRNNFQST-----SLRLPEYYACGFVSGCANAFLATPIEHVRILLQVQTKSRADAEYQ 159

Query: 181 GPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLC 240
           G +DCI+KL+KE  LMRG  P +LR  HG G YF +YEA+I +E +KG  R +I +WKLC
Sbjct: 160 GAMDCIKKLLKEGKLMRGFTPTILRTSHGFGVYFTSYEAMICSEQRKGIARKDIPAWKLC 219

Query: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300
            YG+ SG +LW  +YP DV+KS++Q+D LR P +  ++  V  ++Y E+G  AF KGF P
Sbjct: 220 LYGAFSGSLLWAMVYPFDVIKSVMQSDKLRTPVYGTNVFQVAKNIYNERGPKAFVKGFGP 279

Query: 301 TMLRAAPVNGATFVTFELVMRLL 323
           TMLR+ PVNGATF  FE+ MR+L
Sbjct: 280 TMLRSLPVNGATFTAFEMAMRIL 302

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score =  344 bits (882), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 165/323 (51%), Positives = 220/323 (68%), Gaps = 21/323 (6%)

Query: 1   MSEDFSSPQLINEFDDEMAXXXXXXXXXXXXMAKDSTRVLKDILAGTCGGISQVIVGQPF 60
           MS++ ++PQ++++  D                A +  + +KDI++GT GGI+QV+VGQPF
Sbjct: 1   MSDELTTPQVVDDLSD----------------APEFRKAIKDIISGTSGGIAQVLVGQPF 44

Query: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120
           D TKVRMQTS+ S  A+++I+ LVKNEG+ AFYKG+L+P++GVGACVS QFGVNEAMKR+
Sbjct: 45  DITKVRMQTSSGSPTAIEVIKNLVKNEGLLAFYKGTLVPLIGVGACVSCQFGVNEAMKRY 104

Query: 121 FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFK 180
           F   N      ++D  L L QYY CG   G  N+FLA+PIEHVRIRLQ QT    + E++
Sbjct: 105 FLRVNG-----YKDQHLSLLQYYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKAEYR 159

Query: 181 GPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLC 240
           G LDC++KL+K+K+LMRG    ++R  HG G YFLTYEALI N+ K G  R +I  WK+C
Sbjct: 160 GSLDCMKKLLKQKALMRGFTATLMRTSHGFGVYFLTYEALIMNQNKNGVLRKDIPPWKVC 219

Query: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300
            +G+ SG   W   YP DVVKS++Q D L +P    ++  V   ++  +G  AF KGF P
Sbjct: 220 VFGAFSGAFFWAMTYPFDVVKSIMQADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVP 279

Query: 301 TMLRAAPVNGATFVTFELVMRLL 323
           TMLR+ PVNGATF TFE+ MRLL
Sbjct: 280 TMLRSLPVNGATFATFEVTMRLL 302

>Kwal_56.23011
          Length = 303

 Score =  342 bits (876), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 165/323 (51%), Positives = 210/323 (65%), Gaps = 21/323 (6%)

Query: 1   MSEDFSSPQLINEFDDEMAXXXXXXXXXXXXMAKDSTRVLKDILAGTCGGISQVIVGQPF 60
           MSE+ +SPQ++++  D                  D  + LKD+  GT GG++QV+VGQPF
Sbjct: 1   MSEELTSPQVVDDLVD----------------THDFKQALKDVFCGTVGGVAQVLVGQPF 44

Query: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120
           D TKVR+QTS     A  +I+ LVKNEG+ AFYKG+L P+ GVGACVS QFGVNEA+K++
Sbjct: 45  DITKVRLQTSPVPTTAAQVIKSLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEALKKW 104

Query: 121 FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFK 180
           FR+ +      + D  L L QYY CG   G  N+FLA+PIEHVRIRLQ QT + +  E+ 
Sbjct: 105 FRKKDG-----NFDQPLALRQYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYH 159

Query: 181 GPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLC 240
           G LDC RKL+K+ +LMRG     LR  HG G YFLTYE LIAN+   G  R  I +WK+C
Sbjct: 160 GSLDCARKLLKQGALMRGFTATTLRTSHGFGIYFLTYETLIANQAHHGVLRENIPAWKVC 219

Query: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300
            YG+ SG   W   YP DVVKS++Q D L+NP +  +   V   +YRE+G  AF KGF P
Sbjct: 220 VYGAFSGAFFWAMTYPFDVVKSVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTP 279

Query: 301 TMLRAAPVNGATFVTFELVMRLL 323
           TMLR+ PVNGATF  FE+ MRL+
Sbjct: 280 TMLRSLPVNGATFAAFEITMRLI 302

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score =  332 bits (851), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 155/286 (54%), Positives = 198/286 (69%), Gaps = 2/286 (0%)

Query: 38  RVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSL 97
           + LKD+ +GT GG++QV+VGQPFD  KVR+QT   +  A + I  LVK EG   FYKG++
Sbjct: 23  KTLKDVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGNATAWEAITDLVKYEGFMGFYKGTM 82

Query: 98  IPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLA 157
            P+VGVGACVS QFG+NEAMKR+FR+ N SRG    D TL LGQYY CG   G  N+ LA
Sbjct: 83  APLVGVGACVSCQFGINEAMKRYFRDLNRSRGIY--DNTLSLGQYYTCGFVSGSANALLA 140

Query: 158 SPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTY 217
           +PIEHVRIRLQ Q       E+K  LDC  KL+K+ SLMRG    ++R  HG G YFLTY
Sbjct: 141 TPIEHVRIRLQLQKEALANAEYKSTLDCTEKLLKQGSLMRGFTATLMRTSHGFGIYFLTY 200

Query: 218 EALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNS 277
           E LIA+++  G  R +I++WK C +G+LSG   W   YP DVVKS++Q D L NP +  +
Sbjct: 201 ETLIASQLAHGFRREDISAWKACMFGALSGAFFWAMTYPFDVVKSVMQADKLVNPAYGTN 260

Query: 278 MKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
           +  V  ++YRE+G+ AF KGF PTMLR+ PVNGATF  FE+ M++L
Sbjct: 261 VVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAAFEVTMQML 306

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score =  129 bits (323), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 93/288 (32%), Positives = 140/288 (48%), Gaps = 16/288 (5%)

Query: 43  ILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV---GALDIIRKLVKNEGVWAFYKGSLIP 99
            +AG   G+++  VG PFDT KVR+QTS       G LD + K  +N+G+  FY G   P
Sbjct: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPP 86

Query: 100 IVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASP 159
           +VG     SV  G     +    ++         D  L L    I G+  G   SF+A P
Sbjct: 87  LVGWILMDSVMLGCLHNYRMLMHKY-----VYPNDEKLPLSGCIISGVLAGWSVSFIAPP 141

Query: 160 IEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGLGCYFLT 216
           IE  + +LQ Q      R +KGPLD I+K+      + L +GL   ++   H +  ++ +
Sbjct: 142 IELAKAKLQVQYDKTTTR-YKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFV-YWWGS 199

Query: 217 YEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKN 276
           YE L+    ++    SE A+    + G  +    W   YP DVVK ++  +   +  FK 
Sbjct: 200 YE-LLTRWFRENTKMSE-AAINFWAGGFSASFGFWTTAYPSDVVKQVVLCNDKYDGSFK- 256

Query: 277 SMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
           S +  +  +Y+ +GI+ FFKGF P+ LR+ P N A    FE V+R  G
Sbjct: 257 SWRTAVKDIYQSKGINGFFKGFVPSFLRSFPANAAALAAFEFVLRTSG 304

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score =  128 bits (322), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 94/304 (30%), Positives = 142/304 (46%), Gaps = 43/304 (14%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQTS-AKS-VGALDIIRK--------------- 82
           +K ++AG  GG+  V+ G PFD  KVR Q++ AKS + A+ II K               
Sbjct: 22  MKALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGSLTTS 81

Query: 83  LVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQY 142
           L     V  FYKG + P++GV    +V F   +  KR    W      Q  D  L   Q 
Sbjct: 82  LFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLV-TWK-----QASDAPLTTAQM 135

Query: 143 YICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGP-LDCIRKLVKE---KSLMRG 198
              G    +  + + +P E +++ LQT +      EFKG  +   + +V     KSL  G
Sbjct: 136 ATAGFISAIPTTLVTAPTERIKVVLQTNS------EFKGSFIKAAKHIVSTGGVKSLFNG 189

Query: 199 LRPMMLRAGHGLGCYFLTYE---ALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIY 255
               + R G G   YF +YE   A +   + K KD+ E+    +C  G ++G+ +WL ++
Sbjct: 190 SLATLARDGPGSALYFASYELSKAFLNKSVAK-KDKDEVNLANVCLAGGIAGMSMWLVVF 248

Query: 256 PLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQ-GISAFFKGFAPTMLRAAPVNGATFV 314
           P+D +K+ +Q  T        SM      +Y ++ GI  FF G  P +LR+ P N ATF+
Sbjct: 249 PIDTIKTRLQVATT-----PISMVQATKDIYIQRGGIKGFFPGLGPALLRSFPANAATFL 303

Query: 315 TFEL 318
             EL
Sbjct: 304 GVEL 307

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 44/95 (46%), Gaps = 5/95 (5%)

Query: 34  KDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKL-VKNEGVWAF 92
           KD   +    LAG   G+S  +V  P DT K R+Q +   +  +   + + ++  G+  F
Sbjct: 224 KDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTRLQVATTPISMVQATKDIYIQRGGIKGF 283

Query: 93  YKGSLIPIV--GVGACVSVQFGVNEAMKRFFREWN 125
           + G L P +     A  +   GV E    FF+++N
Sbjct: 284 FPG-LGPALLRSFPANAATFLGV-ELTHAFFKKYN 316

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score =  128 bits (322), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 87/294 (29%), Positives = 136/294 (46%), Gaps = 29/294 (9%)

Query: 41  KDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLV----KNEGVWA----- 91
           K + AG  GG+  V+ G PFD  KVR Q++  S G +D +RK++       G+ A     
Sbjct: 49  KSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQAS-GTVDAVRKILVEARAQSGLSAVNMMR 107

Query: 92  -FYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGG 150
            FYKG + P++GV    +V F   +  K+    WN +       G L   Q    G    
Sbjct: 108 GFYKGVIPPLLGVTPIFAVSFWGYDVGKKLV-TWNDN------SGKLTTAQLATAGFISA 160

Query: 151 VVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGL 210
           +  + + +P E V++ LQTQ+              I      +SL RG    + R G G 
Sbjct: 161 IPTTLVMAPTERVKVVLQTQS----NHSLGSAAKHILATGGVRSLFRGSLATLARDGPGS 216

Query: 211 GCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLR 270
             YF +YEA  A  +      +E++   +C  G ++GV +W+ ++P+D +K+ +Q+   R
Sbjct: 217 ALYFASYEATKA-YLNARSGTNELSIKNVCLAGGMAGVSMWVGVFPIDTIKTELQSSNTR 275

Query: 271 NPRFKNSMKNVINHLYREQ-GISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
                 +M      +Y  + GI  FF G  P +LR+ P N ATF+  EL   L 
Sbjct: 276 -----QTMMEATRKIYNTRGGIKGFFPGIGPALLRSFPANAATFLGVELTHSLF 324

>Kwal_33.15446
          Length = 305

 Score =  127 bits (318), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 88/291 (30%), Positives = 147/291 (50%), Gaps = 22/291 (7%)

Query: 43  ILAGTCGGISQVIVGQPFDTTKVRMQTSAKS---VGALDIIRKLVKNEGVWAFYKGSLIP 99
            ++G   GI++  VG PFDT KVR+QTS  +    G LD + + ++ +G+  FY G   P
Sbjct: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81

Query: 100 IVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASP 159
           +VG     SV  G     +   +++      QH +  L L    + G+  G   SF+A+P
Sbjct: 82  LVGWILMDSVMLGCLHNYRMLLKKYVY----QHEE-KLPLSGCILSGVLAGWSVSFIAAP 136

Query: 160 IEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGLGCYFLT 216
           +E  + +LQ Q  +     ++GPLD I+K+      + + +GL   ++   H +  ++ +
Sbjct: 137 VELAKAKLQVQY-DAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFV-YWWGS 194

Query: 217 YEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKN 276
           YE L+    K   + S+ A     + G  +    W   YP DV+K +I    L N ++  
Sbjct: 195 YE-LLTRWFKANTNLSDTAI-NFWAGGFSASFGFWTTAYPSDVIKQVI----LCNDKYDG 248

Query: 277 SMK---NVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
           S++   N  + ++R +GI  FFKGF P+ LR+ P N A   +FE V+R+ G
Sbjct: 249 SLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRVSG 299

>Scas_697.47
          Length = 328

 Score =  127 bits (318), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 86/301 (28%), Positives = 142/301 (47%), Gaps = 31/301 (10%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQT--SAKSVGALDIIRKLVKN--------EGV 89
           LK ++AG  GG+  V+ G PFD  KVR Q+  ++ ++ A+ II K  +           V
Sbjct: 37  LKSLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNMLVNSV 96

Query: 90  WAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTG 149
             FYKG + P++GV    +V F   +  K+     ++S         L +GQ    G   
Sbjct: 97  KGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSS------SAQLTMGQMAAAGFIS 150

Query: 150 GVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHG 209
            +  + + +P E +++ LQT   N ++  F G    I K    KSL +G    + R G G
Sbjct: 151 AIPTTLVTAPTERIKVVLQTAGAN-SKTSFIGAAKNIVKDGGVKSLFKGSLATLARDGPG 209

Query: 210 LGCYFLTYEALIANEIKKGKDRS------EIASWKLCSYGSLSGVVLWLAIYPLDVVKSM 263
              YF +YE  I+ +    ++ +      E+    +C  G ++G+ +WL ++P+D +K+ 
Sbjct: 210 SALYFASYE--ISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTK 267

Query: 264 IQTDTLRNPRFKNSMKNVINHLY-REQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRL 322
           +Q+ +        SM      +Y +  GI  FF G  P +LR+ P N ATF+  EL   L
Sbjct: 268 LQSSS-----GSQSMVAATREIYVKRGGIKGFFPGLGPALLRSFPANAATFLGVELTHSL 322

Query: 323 L 323
            
Sbjct: 323 F 323

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score =  126 bits (316), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 90/306 (29%), Positives = 143/306 (46%), Gaps = 33/306 (10%)

Query: 37  TRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKN---------- 86
           T  LK + AG  GG+  V+ G PFD  KVR Q S ++  A+D +  +++           
Sbjct: 26  TENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQ-SNQARSAMDAVSHILQAARQAAGPTSL 84

Query: 87  EGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHR--DGTLQLGQYYI 144
             V  FYKG + P++GV    +V F   +  K+      +S  +     +  L L Q   
Sbjct: 85  NAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQMAA 144

Query: 145 CGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRP 201
            G    +  + + +P E V++ LQT  G  +       LD  +++V+ +   SL +G   
Sbjct: 145 AGFISAIPTTLVTAPTERVKVVLQTTQGKASF------LDAAKQIVRTQGFQSLFKGSLA 198

Query: 202 MMLRAGHGLGCYFLTYEALIANEI---KKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLD 258
            + R G G   YF +YE  I  E      G    E++   +C  G ++GV +W+ ++P+D
Sbjct: 199 TLSRDGPGSALYFASYE--ICKEYLNKASGHTSGELSITNVCISGGMAGVSMWVVVFPID 256

Query: 259 VVKSMIQTDTLRNPRFKNSMKNVINHLYREQ-GISAFFKGFAPTMLRAAPVNGATFVTFE 317
            VK+ +Q+ + R      SM  V   +Y  + GI  FF G  P +LR+ P N ATF+  E
Sbjct: 257 TVKTQLQSSSKR-----QSMLEVTRMIYNTRGGIKGFFPGVGPAILRSFPANAATFLGVE 311

Query: 318 LVMRLL 323
           L   L 
Sbjct: 312 LTHSLF 317

>Kwal_23.2913
          Length = 320

 Score =  124 bits (312), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 79/302 (26%), Positives = 139/302 (46%), Gaps = 33/302 (10%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKN----------EGV 89
            + + AG  GG+  V+ G PFD  KVR Q++  S G LD I +++              +
Sbjct: 29  FESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQAS-GTLDAISRVLHEAKSKSGPLPLNQI 87

Query: 90  WAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTS-----RGTQHRDGTLQLGQYYI 144
             FY+G + P++GV    +V F   +  KR    W ++      G+  +   L   Q  +
Sbjct: 88  KGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLV-TWGSNPVTDIAGSSSKLTPLTTSQLAL 146

Query: 145 CGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRP 201
            G    +  + + +P E V++ LQT        E    L   R L++E   +SL +G   
Sbjct: 147 AGFFSAIPTTLITAPTERVKVVLQTS-------ESGSFLGAARTLIREGGVRSLFQGTLA 199

Query: 202 MMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVK 261
            + R G G   YF +YE +    + + +D   ++   +C  G ++G+ +W+ ++P+D +K
Sbjct: 200 TLARDGPGSALYFASYE-VSKRFLSRNQDTDALSVVSICVAGGVAGMSMWIGVFPIDTIK 258

Query: 262 SMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMR 321
           + +Q+ +        SM      +Y   G+  FF G  P ++R+ P N ATF+  E   +
Sbjct: 259 TKLQSSSR-----SQSMVQAAREIYTRAGLRGFFPGLGPALMRSFPANAATFLGVEFTHQ 313

Query: 322 LL 323
           L 
Sbjct: 314 LF 315

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%)

Query: 35  DSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYK 94
           D+  V+   +AG   G+S  I   P DT K ++Q+S++S   +   R++    G+  F+ 
Sbjct: 229 DALSVVSICVAGGVAGMSMWIGVFPIDTIKTKLQSSSRSQSMVQAAREIYTRAGLRGFFP 288

Query: 95  G 95
           G
Sbjct: 289 G 289

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score =  121 bits (304), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 87/305 (28%), Positives = 141/305 (46%), Gaps = 39/305 (12%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQT--SAKSVGALDIIRKLVKNE--------GV 89
           +K  +AG  GG+  V  G PFD  KVR Q   +  +V A+  I K  K +         V
Sbjct: 36  IKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNSV 95

Query: 90  WAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTG 149
             FYKG + P++GV    +V F   +  K+     N   G+      L +GQ    G   
Sbjct: 96  KGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNE----LTMGQMAAAGFIS 151

Query: 150 GVVNSFLASPIEHVRIRLQTQTGNGNEREFKGP-LDCIRKLVKE---KSLMRGLRPMMLR 205
            +  + + +P E V++ LQT +        KG  +   + +VKE    SL +G    + R
Sbjct: 152 AIPTTLVTAPTERVKVVLQTSS--------KGSFIQAAKTIVKEGGIASLFKGSLATLAR 203

Query: 206 AGHGLGCYFLTYEALIANEIKKGKDRSE------IASWKLCSYGSLSGVVLWLAIYPLDV 259
            G G   YF +YE +  N +   + R +      +    +C  G ++G+ +WLA++P+D 
Sbjct: 204 DGPGSALYFASYE-ISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDT 262

Query: 260 VKSMIQTDTLRNPRFKNSMKNVINHLYREQ-GISAFFKGFAPTMLRAAPVNGATFVTFEL 318
           +K+ +Q  + R      +M +    +Y ++ GI  FF G  P +LR+ P N ATF+  E+
Sbjct: 263 IKTKLQASSTR-----QNMLSATKEIYLQRGGIKGFFPGLGPALLRSFPANAATFLGVEM 317

Query: 319 VMRLL 323
              L 
Sbjct: 318 THSLF 322

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score =  118 bits (295), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 92/307 (29%), Positives = 147/307 (47%), Gaps = 31/307 (10%)

Query: 37  TRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGA-------LDIIRKLVKNEGV 89
           +RV+   +AG   G+++  VG PFDT KVR+QTS    GA       LD + K +KN+G+
Sbjct: 8   SRVM-GFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGI 66

Query: 90  WAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTG 149
              Y G   P+ G     S   G     +    ++            L L    I G+  
Sbjct: 67  RGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKY-----VYPEHDKLPLSGCIISGVMA 121

Query: 150 GVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE-----------KSLMRG 198
           G   SF+A+P+E  + +LQ Q  +    ++ GP+D ++K+ K+           +SL +G
Sbjct: 122 GWTVSFIAAPVELAKAKLQVQY-DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180

Query: 199 L-RPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPL 257
           L   ++ R+      ++ +YE LI    +K  + S  A     + G  +    W + YP 
Sbjct: 181 LISTLIFRSNFVF--WWGSYE-LITQWFQKNTNLSAPAI-NFWAGGLSASFGFWTSAYPS 236

Query: 258 DVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
           DVVK ++  +   +  FK S +  ++ +YR++GI  FFKGF P+ LR+ P N A    FE
Sbjct: 237 DVVKQVVLCNDKYDGSFK-SWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPANAAALAAFE 295

Query: 318 LVMRLLG 324
            V+R  G
Sbjct: 296 FVLRTSG 302

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score =  114 bits (286), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 77/284 (27%), Positives = 132/284 (46%), Gaps = 25/284 (8%)

Query: 41  KDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV--GALDIIRKLVKNEGVW-AFYKGSL 97
           KDIL G+  G    ++  PFDT KVR+QT    +       I+    NEG+W  FY+G  
Sbjct: 8   KDILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTTWSCIKFTYDNEGLWRGFYQGIG 67

Query: 98  IPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQ-LGQYYICGLTGGVVNSFL 156
            P+ G     +V           F  +N ++     +  L  L +    G   G   SF+
Sbjct: 68  SPLAGAALENAV----------LFVSFNQAKRLLDVESLLSPLSKTVWAGAFAGACASFV 117

Query: 157 ASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKS---LMRGLRPMMLRAGHGLGCY 213
            +P+E ++ +LQ    +  +      L  I+ ++ E+    L +G     +R   G   +
Sbjct: 118 LTPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAW 177

Query: 214 FLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPR 273
           F TYE ++ N +   +   +  +W+L + G+ +G+    +I+P D +KS +QTD +    
Sbjct: 178 FTTYE-VVKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQTDHI---- 232

Query: 274 FKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
               + +    +Y  QGI+ F++G   T++RA P N A F T+E
Sbjct: 233 ---DLSSATRKIYARQGIAGFYRGLGITLIRAVPANAAIFYTYE 273

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 80/191 (41%), Gaps = 22/191 (11%)

Query: 144 ICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGL---- 199
           + G   G V   +  P + V++RLQTQ  +     F     CI+     + L RG     
Sbjct: 11  LYGSIAGAVGKVIEYPFDTVKVRLQTQPAH----MFPTTWSCIKFTYDNEGLWRGFYQGI 66

Query: 200 -RPMMLRAGHGL--GCYFLTYEALIANEIKKGKDRSEIAS--WKLCSYGSLSGVVLWLAI 254
             P+   AG  L     F+++     N+ K+  D   + S   K    G+ +G      +
Sbjct: 67  GSPL---AGAALENAVLFVSF-----NQAKRLLDVESLLSPLSKTVWAGAFAGACASFVL 118

Query: 255 YPLDVVKSMIQTDTLRNPRFKNS-MKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATF 313
            P++++K  +Q   L   +  ++ +   I  +  E+G    ++G + T +R +    A F
Sbjct: 119 TPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWF 178

Query: 314 VTFELVMRLLG 324
            T+E+V   L 
Sbjct: 179 TTYEVVKNYLA 189

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score =  114 bits (286), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 83/298 (27%), Positives = 135/298 (45%), Gaps = 25/298 (8%)

Query: 35  DSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV--GALDIIRKLVKNEGVW-A 91
           D    LKDI  G+  G    ++  PFDT KVR+QT    +       IR    +EG+W  
Sbjct: 3   DLESALKDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHLYPTTWSCIRSTYTDEGIWKG 62

Query: 92  FYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGV 151
           FY+G   P+ G     +V F        F  E+     TQ +     L +    G   G 
Sbjct: 63  FYQGIASPLFGAALENAVLFVSFNQCTNFLDEF-----TQLKP----LTKTIYSGAFAGA 113

Query: 152 VNSFLASPIEHVRIRLQTQTGNGNERE---FKGPLDCIRKLVKEKSLM---RGLRPMMLR 205
             SF+ +P+E V+ +LQ    + +  +          I+ ++KEK L+   +G     +R
Sbjct: 114 CASFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVR 173

Query: 206 AGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQ 265
              G   +F TYE +            E  +W+L   G+ +GV+   +++P D VKS+ Q
Sbjct: 174 ECLGGAVWFTTYEIMKMKFASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQ 233

Query: 266 TDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
           T+ +       S+ N +  + R  GI+ F++G   T++RAAP N   F T+E + ++ 
Sbjct: 234 TEHV-------SIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYETLKKMF 284

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score =  115 bits (289), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 86/288 (29%), Positives = 139/288 (48%), Gaps = 16/288 (5%)

Query: 43  ILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV---GALDIIRKLVKNEGVWAFYKGSLIP 99
            ++G   GI++  VG PFDT KVR+QTS  S    G LD + K    +G+  FY G   P
Sbjct: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPP 123

Query: 100 IVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASP 159
           +VG     SV  G     +   +++       + +  L L    I G+  G   SF+A+P
Sbjct: 124 LVGWILMDSVMLGCLHNYRMLLKKY-----VYYNEEKLPLSGCIISGVMAGWSVSFIAAP 178

Query: 160 IEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGLGCYFLT 216
           +E  + +LQ Q  +    ++ GP+D I+K+      + L +GL   ++   + +  ++ +
Sbjct: 179 VELAKAKLQVQY-DAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFV-FWWGS 236

Query: 217 YEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKN 276
           YE L+    K+  + S+ A     S G  +    W   YP DV+K ++  +   +  F+ 
Sbjct: 237 YE-LLTRWFKEHTNMSDTAI-NFWSGGFSASFGFWTTAYPSDVIKQVVLCNDKYDGTFR- 293

Query: 277 SMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
           S K     ++R +G   FFKGF P+ LR+ P N A    FE V+R  G
Sbjct: 294 SWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPANAAALAAFEFVLRTSG 341

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score =  115 bits (289), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 86/304 (28%), Positives = 142/304 (46%), Gaps = 22/304 (7%)

Query: 33  AKDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQT------SAKSVGALDIIRKLVKN 86
           +K ST    +++AG   G+ + +   P DT KVRMQ         K  G L     +   
Sbjct: 51  SKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSG 110

Query: 87  EGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICG 146
           EG+ AFYKG    ++G+   ++++F   E    F+R     R T    G +  G  ++ G
Sbjct: 111 EGLLAFYKGLGAVVIGIIPKMAIRFSSYE----FYRTLLADRQT----GVVSTGNTFLAG 162

Query: 147 LTGGVVNSFLA-SPIEHVRIRLQTQT--GNGNEREFKGPLDCIRKLVKEK---SLMRGLR 200
           +  GV  + L  +P+E V+IRLQ Q   G   +++++  +     +VKE+   +L RG+ 
Sbjct: 163 VGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVS 222

Query: 201 PMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVV 260
               R     G  F  Y  L+   +++      + SW+    G +SG +   +  PLD +
Sbjct: 223 LTAARQATNQGANFTVYSKLM-ERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTI 281

Query: 261 KSMIQTD-TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELV 319
           K+ +Q D + RN      +  +   L +E+G  A +KG  P ++R AP    TF  +E V
Sbjct: 282 KTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFV 341

Query: 320 MRLL 323
            R L
Sbjct: 342 RRHL 345

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score =  113 bits (283), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 84/309 (27%), Positives = 146/309 (47%), Gaps = 28/309 (9%)

Query: 32  MAKDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQ---TSAKSVGALDIIRKLVKNEG 88
           M  D + V K++++G   G    +   P D  KVR+Q   T+ K  G  D+++++VK+  
Sbjct: 1   MVSDFSPVQKEMISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDVVKRIVKDSK 60

Query: 89  VWAF----YKGSLIPIVGVGACVSVQFGVNEAMKRFFREW-NTS----RGTQHRDGTLQL 139
             +F    Y+G  + ++G      + FG+  A K +  +W NT       T + D  +  
Sbjct: 61  QHSFFRETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTS 120

Query: 140 GQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSL---M 196
             Y +     GV  S L +PI  ++ R+ + T   + R ++  +D I+KL + + L    
Sbjct: 121 LMYLLAAAMSGVATSVLTNPIWVIKTRIMS-TSFVDSRSYRSTVDGIKKLYRIEGLAGFW 179

Query: 197 RGLRPMMLRAGHGLGCYFLTYEAL-----IANEIKKGKDRSEIASWKLCSYGSLSGVVLW 251
           RGL P +     G   YF  Y+ L      A  + K K  S +   +  +  SLS +V  
Sbjct: 180 RGLVPSLFGVSQG-AIYFTVYDTLKYHYFAAKHVDKKKKLSNL---EYITITSLSKMVSV 235

Query: 252 LAIYPLDVVKSMIQT---DTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPV 308
            A+YPL ++KS +Q+    T+ NP+  + +  +I  +Y   G++  +KG    ++RA P 
Sbjct: 236 TAVYPLQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPS 295

Query: 309 NGATFVTFE 317
              TF  +E
Sbjct: 296 TCITFCVYE 304

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score =  111 bits (277), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 90/301 (29%), Positives = 144/301 (47%), Gaps = 44/301 (14%)

Query: 45  AGTCGGISQVIVGQPFDTTKVRMQTSAKS----------------VGALDIIRKLVKNEG 88
           AG   G+S+++V  P D  K RMQ    +                 G +D + K+VK EG
Sbjct: 17  AGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKKEG 76

Query: 89  VWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFRE-WNTSRGTQHRDGTLQLGQYYICGL 147
               YKG   PI+      +++F  N+  + F+++ + T  G    + T ++  Y   G 
Sbjct: 77  FSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNG----EMTQKIAIY--SGA 130

Query: 148 TGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGL----- 199
           + G V +F+ +P E V+IRLQ         +FK P++ ++  V +    SL  GL     
Sbjct: 131 SAGAVEAFVVAPFELVKIRLQDVNS-----QFKTPIEVVKNSVVKGGVLSLFNGLEATIW 185

Query: 200 RPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDV 259
           R ++  AG+  G  F   + L A +    K R+++ +      G++ G V  L   P DV
Sbjct: 186 RHVLWNAGY-FGIIFQIRKLLPAAKTSTEKTRNDLIA------GAIGGTVGCLLNTPFDV 238

Query: 260 VKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELV 319
           VKS IQ  +    ++  S+ +V+  +YRE+G  A +KGFAP ++R AP  G   V F  V
Sbjct: 239 VKSRIQRSSGPLRKYNWSLPSVL-LVYREEGFKALYKGFAPKVMRLAPGGGLLLVVFTNV 297

Query: 320 M 320
           M
Sbjct: 298 M 298

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 84/195 (43%), Gaps = 16/195 (8%)

Query: 43  ILAGTCGGISQVIVGQPFDTTKVRMQ-TSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIV 101
           I +G   G  +  V  PF+  K+R+Q  +++    +++++  V   GV + + G    I 
Sbjct: 126 IYSGASAGAVEAFVVAPFELVKIRLQDVNSQFKTPIEVVKNSVVKGGVLSLFNGLEATIW 185

Query: 102 GVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIE 161
                 +  FG+   +++      TS      D         I G  GG V   L +P +
Sbjct: 186 RHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRND--------LIAGAIGGTVGCLLNTPFD 237

Query: 162 HVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGLGCYFLTYE 218
            V+ R+Q  +  G  R++   L  +  + +E   K+L +G  P ++R   G G   + + 
Sbjct: 238 VVKSRIQRSS--GPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVVFT 295

Query: 219 ALIA--NEIKKGKDR 231
            ++    E+K GK +
Sbjct: 296 NVMDFFREVKYGKKQ 310

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 5/96 (5%)

Query: 33  AKDST-RVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSA----KSVGALDIIRKLVKNE 87
           AK ST +   D++AG  GG    ++  PFD  K R+Q S+    K   +L  +  + + E
Sbjct: 208 AKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQRSSGPLRKYNWSLPSVLLVYREE 267

Query: 88  GVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFRE 123
           G  A YKG    ++ +     +   V   +  FFRE
Sbjct: 268 GFKALYKGFAPKVMRLAPGGGLLLVVFTNVMDFFRE 303

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score =  108 bits (271), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 88/303 (29%), Positives = 144/303 (47%), Gaps = 39/303 (12%)

Query: 36  STRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKS------VGALDIIRKLVKNEGV 89
           S   L    AG   G+S+++V  P D  K RMQ   +        G +D ++K+V  EGV
Sbjct: 8   SLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGV 67

Query: 90  WAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTG 149
              YKG   PI+      + +F  N+  ++ +++   + G +     L +    + G + 
Sbjct: 68  GRLYKGISSPILMEAPKRATKFACNDEFQKLYKQ---AFGVEKLSQPLSM----LAGASA 120

Query: 150 GVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLM---RGLRPMMLRA 206
           G V +F+  P E V+IRLQ  + +     +KGP+D +RK+V  + ++    GL   + R 
Sbjct: 121 GCVEAFVVVPFELVKIRLQDASSS-----YKGPVDVVRKIVAREGVLAMYNGLESTLWRH 175

Query: 207 GHGLGCYF-LTYEA---LIANEIKKGKDRSEIASWKL-CSYGSLSGVVLWLAIYPLDVVK 261
               G YF + ++A   L A   K     +++ S  + CS G +          P DVVK
Sbjct: 176 ALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-------PFDVVK 228

Query: 262 SMIQTDTLRNP----RFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
           S IQ +T   P    ++  S+ +++  +YRE+G  A +KGF P +LR  P  G   V F 
Sbjct: 229 SRIQ-NTAVIPGVVRKYNWSLPSLLT-IYREEGFRALYKGFVPKVLRLGPGGGILLVVFT 286

Query: 318 LVM 320
            V+
Sbjct: 287 GVL 289

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score =  108 bits (271), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/295 (28%), Positives = 135/295 (45%), Gaps = 32/295 (10%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV--GALDIIRKLVKNEGVW-AFYKGSLI 98
           DI+ G+  G    ++  PFDT KVR+QT A +V       I+   +NEG+   F++G   
Sbjct: 16  DIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWSCIKFTYQNEGIARGFFQGIAS 75

Query: 99  PIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLAS 158
           P+VG  AC+       E    F      S+  +       LGQ  I G   G   S + +
Sbjct: 76  PLVG--ACL-------ENATLFVSYNQCSKFLEKHTNVFPLGQILISGGVAGSCASLVLT 126

Query: 159 PIEHVRIRLQT---QTGNGNEREFKGPLDCIRKLVKEKSLM---RGLRPMMLRAGHGLGC 212
           P+E V+ +LQ    Q  +   +  K  L  I+ ++ E+ L    +G     +R   G   
Sbjct: 127 PVELVKCKLQVANLQVASAKTKHTK-VLPTIKAIITERGLAGLWQGQSGTFIRESFGGVA 185

Query: 213 YFLTYEALIANEIKK-----GKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTD 267
           +F TYE ++   +K         R E   W+L   G  +G+    +I+P D VKS++QT+
Sbjct: 186 WFATYE-IVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQTE 244

Query: 268 TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRL 322
            +       S+ N +  ++ + G+  F++G   T+ RA P N A F  FE +  L
Sbjct: 245 HI-------SLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFETLSAL 292

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 81/189 (42%), Gaps = 18/189 (9%)

Query: 144 ICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRG----L 199
           I G   G     +  P + V++RLQTQ  N     F     CI+   + + + RG    +
Sbjct: 18  INGSIAGACGKVIEFPFDTVKVRLQTQASN----VFPTTWSCIKFTYQNEGIARGFFQGI 73

Query: 200 RPMMLRAGHGLGCYFLTYEALIANEIKK--GKDRSEIASWKLCSYGSLSGVVLWLAIYPL 257
              ++ A       F++Y     N+  K   K  +     ++   G ++G    L + P+
Sbjct: 74  ASPLVGACLENATLFVSY-----NQCSKFLEKHTNVFPLGQILISGGVAGSCASLVLTPV 128

Query: 258 DVVKSMIQTDTLRNPRFKNSMKNV---INHLYREQGISAFFKGFAPTMLRAAPVNGATFV 314
           ++VK  +Q   L+    K     V   I  +  E+G++  ++G + T +R +    A F 
Sbjct: 129 ELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVAWFA 188

Query: 315 TFELVMRLL 323
           T+E+V + L
Sbjct: 189 TYEIVKKSL 197

>Kwal_55.21335
          Length = 317

 Score =  108 bits (271), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 132/294 (44%), Gaps = 23/294 (7%)

Query: 35  DSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV--GALDIIRKLVKNEG-VWA 91
           D    LKDIL G+  G +  ++  P DT KVR+QT    V   +   I+   + EG V  
Sbjct: 41  DFKDALKDILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPTSWSCIKYTYQKEGFVKG 100

Query: 92  FYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGV 151
           FY+G   P+VG     +V F      + F +++         +    L Q  + G   G 
Sbjct: 101 FYQGVASPLVGAALENAVLFVTFNRAQNFLQQY---------ESVSPLSQTVLSGAFAGA 151

Query: 152 VNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLRAGH 208
             S++ +P+E ++  LQ     G           ++ +V+ K    L +G     +R   
Sbjct: 152 CTSYVLTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECA 211

Query: 209 GLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDT 268
           G   +F TYE+L  + + + ++ +E  +W+L + G+ +GV    +I+P D +KS  QT  
Sbjct: 212 GGAVWFTTYESL-KSYLARRRNDTENHTWELLASGASAGVAFNASIFPADTIKSTAQTQH 270

Query: 269 LRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRL 322
           L        + +    +    G +  ++G   T++RAAP N   F T+E +  L
Sbjct: 271 L-------GIVDATKRILARSGPAGLYRGLGITLIRAAPANAIVFYTYETLSNL 317

>Kwal_26.8669
          Length = 296

 Score =  108 bits (270), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 84/289 (29%), Positives = 138/289 (47%), Gaps = 29/289 (10%)

Query: 45  AGTCGGISQVIVGQPFDTTKVRMQTSA------KSVGALDIIRKLVKNEGVWAFYKGSLI 98
           AG   GIS+++V  P D  K RMQ         +  G +D I+++V  EG    YKG   
Sbjct: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74

Query: 99  PIVGVGACVSVQFGVNEAMKRFF-REWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLA 157
           P++      + +F  N+  ++ + RE+   + TQ    +L +    + G + G   +F+ 
Sbjct: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQ----SLSI----LSGASAGCCEAFVV 126

Query: 158 SPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLM---RGLRPMMLRAGHGLGCYF 214
            P E V+IRLQ  + +     +KGP+D +RK++ ++ ++    GL   + R G     YF
Sbjct: 127 VPFELVKIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYF 181

Query: 215 -LTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLR--N 271
            + ++  +   + + K +S+     L + GS+ G +  L   P DVVKS IQ   +    
Sbjct: 182 GIIFQ--VRALLPEAKSKSQQTRNDLIA-GSIGGTIGSLMSTPFDVVKSRIQNTAVVAGG 238

Query: 272 PRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVM 320
            R  N     I  +Y+E+G  A +KGF P +LR  P  G   V F   M
Sbjct: 239 ARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCM 287

 Score = 68.6 bits (166), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 85/181 (46%), Gaps = 13/181 (7%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV-GALDIIRKLVKNEGVWAFYKGSLIPI 100
            IL+G   G  +  V  PF+  K+R+Q  + S  G +D++RK++  EGV A Y G    +
Sbjct: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL 170

Query: 101 VGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPI 160
              G   +  FG+   ++    E   S+  Q R+         I G  GG + S +++P 
Sbjct: 171 WRHGVWNAGYFGIIFQVRALLPE-AKSKSQQTRNDL-------IAGSIGGTIGSLMSTPF 222

Query: 161 EHVRIRLQ-TQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGLGCYFLT 216
           + V+ R+Q T    G  R++      I  + KE   ++L +G  P +LR G G G   + 
Sbjct: 223 DVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVV 282

Query: 217 Y 217
           +
Sbjct: 283 F 283

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 76/181 (41%), Gaps = 22/181 (12%)

Query: 143 YICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKS---LMRGL 199
           +  G   G+    +  P++ V+ R+Q Q   G   ++KG +DCI+++V ++    L +G+
Sbjct: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72

Query: 200 RPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCS-----YGSLSGVVLWLAI 254
              +L         F        +E +K   R E    KL        G+ +G      +
Sbjct: 73  SSPVLMEAPKRATKFAC-----NDEFQKIYKR-EFGVEKLTQSLSILSGASAGCCEAFVV 126

Query: 255 YPLDVVKSMIQ--TDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGAT 312
            P ++VK  +Q  + + + P       +V+  +  ++G+ A + G   T+ R    N   
Sbjct: 127 VPFELVKIRLQDVSSSYKGP------IDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGY 180

Query: 313 F 313
           F
Sbjct: 181 F 181

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 42/94 (44%), Gaps = 7/94 (7%)

Query: 36  STRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVG-------ALDIIRKLVKNEG 88
           S +   D++AG+ GG    ++  PFD  K R+Q +A   G       +   I  + K EG
Sbjct: 198 SQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEG 257

Query: 89  VWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFR 122
             A YKG +  ++ +G    +   V      FFR
Sbjct: 258 FRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFR 291

>Scas_640.25
          Length = 306

 Score =  108 bits (269), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 86/303 (28%), Positives = 138/303 (45%), Gaps = 40/303 (13%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQ----------TSAKSVGALDIIRKLVKNEGVWA 91
             +AG   GIS+++V  P D  K RMQ          ++    G +D + ++VK EG   
Sbjct: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75

Query: 92  FYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGV 151
            YKG   P++      +V+F  N+    F + W +  GT+     + +    + G + G+
Sbjct: 76  MYKGISSPMLMEAPKRAVKFASND---EFIKLWKSVFGTKQLTQQISV----LSGASAGI 128

Query: 152 VNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLR--- 205
             + +  P E V+IRLQ         +FKGP++ ++ ++K+   K L  G+   + R   
Sbjct: 129 TEALVIVPFELVKIRLQDVNS-----KFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAV 183

Query: 206 --AGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSM 263
             AG+  G  F   E L   + K+ K R++     LC+ G + G    +   P DVVKS 
Sbjct: 184 WNAGY-FGVIFQVRELLPVAKSKQEKTRND-----LCA-GFVGGTFGVMFNTPFDVVKSR 236

Query: 264 IQTD---TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVM 320
           IQ+D    +   R  N     +  +Y E+G  A +KGF P +LR  P      V F  VM
Sbjct: 237 IQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVM 296

Query: 321 RLL 323
            + 
Sbjct: 297 NVF 299

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 45/103 (43%), Gaps = 10/103 (9%)

Query: 34  KDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV--------GALDIIRKLVK 85
           ++ TR   D+ AG  GG   V+   PFD  K R+Q+    +             + K+  
Sbjct: 206 QEKTR--NDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYH 263

Query: 86  NEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSR 128
            EG  A YKG +  ++ +G   +V   V   +   FRE++  R
Sbjct: 264 EEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREFHEGR 306

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score =  107 bits (266), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/304 (26%), Positives = 132/304 (43%), Gaps = 37/304 (12%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV--GALDIIRKLVKNEGVW-AFYKGS 96
            +DIL G+  G    ++  PFDT KVR+QT  + V       I    KNEG+   F++G 
Sbjct: 14  FRDILYGSIAGALGKVIEYPFDTVKVRLQTQGRHVFPDTWSCITYTYKNEGIIKGFFQGI 73

Query: 97  LIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFL 156
             P+ G            E    F      S+  QH      L    I G   G   SF+
Sbjct: 74  ASPLAGAAI---------ENAALFLSYNQCSKFLQHYTNVSDLTNILISGAFAGSCASFV 124

Query: 157 ASPIEHVRIRLQTQT----------GNGNEREFKGPLDCIRKLVKEKS---LMRGLRPMM 203
            +P+E ++ +LQ             GN         +  I+ ++K +    L +G     
Sbjct: 125 LTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTF 184

Query: 204 LRAGHGLGCYFLTYEALIA-----NEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLD 258
           +R   G   +F TYE +       + I+     ++  +W+L + G+ +G+    +I+P D
Sbjct: 185 IRESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPAD 244

Query: 259 VVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFEL 318
            VKSM+QT+ L        +K  I  ++ E+G+  F++G   T++RA P N   F  +E 
Sbjct: 245 TVKSMMQTEHL-------GLKTAIKKIFVEKGLRGFYRGLGITLIRAIPANATVFYVYET 297

Query: 319 VMRL 322
           + +L
Sbjct: 298 LSKL 301

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 47/90 (52%), Gaps = 4/90 (4%)

Query: 235 ASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQG-ISA 293
           A+++   YGS++G +  +  YP D VK  +QT       F ++  + I + Y+ +G I  
Sbjct: 12  AAFRDILYGSIAGALGKVIEYPFDTVKVRLQTQGRH--VFPDTW-SCITYTYKNEGIIKG 68

Query: 294 FFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
           FF+G A  +  AA  N A F+++    + L
Sbjct: 69  FFQGIASPLAGAAIENAALFLSYNQCSKFL 98

 Score = 34.7 bits (78), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 41/200 (20%), Positives = 83/200 (41%), Gaps = 36/200 (18%)

Query: 146 GLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGL-----R 200
           G   G +   +  P + V++RLQTQ        F     CI    K + +++G       
Sbjct: 20  GSIAGALGKVIEYPFDTVKVRLQTQ----GRHVFPDTWSCITYTYKNEGIIKGFFQGIAS 75

Query: 201 PMMLRAGHGL--GCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLD 258
           P+   AG  +     FL+Y    +  ++   + S++ +  +   G+ +G      + P++
Sbjct: 76  PL---AGAAIENAALFLSYNQC-SKFLQHYTNVSDLTN--ILISGAFAGSCASFVLTPVE 129

Query: 259 VVKSMIQTDTL---------------RNPRFKNSMKNVINHLYREQGISAFFKGFAPTML 303
           ++K  +Q   L               R+ R   +++ VI    + +G    ++G + T +
Sbjct: 130 LIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVI----KNRGFIGLWQGQSGTFI 185

Query: 304 RAAPVNGATFVTFELVMRLL 323
           R +    A F T+EL+ + L
Sbjct: 186 RESFGGVAWFATYELMKKYL 205

>Scas_691.4
          Length = 334

 Score =  106 bits (265), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 143/311 (45%), Gaps = 36/311 (11%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGA-----LDIIRKLVKNEGVWAFYK 94
           L +++AG   G+ + +   P DT KVRMQ + ++ G      +   R +  +EG  A YK
Sbjct: 14  LINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHEGFLALYK 73

Query: 95  GSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNS 154
           G    ++G+   ++++F   E    F+R   T + T+    T+  G  ++ G+  G+  +
Sbjct: 74  GLGAVVIGIIPKMAIRFSSYE----FYRNALTDKETR----TITTGNTFLAGVGAGITEA 125

Query: 155 FLA-SPIEHVRIRLQTQTGNG-----------------NEREFKGPLDCIRKLVKEK--- 193
            L  +P+E V+IRLQ Q  N                   + ++   +     +VKE+   
Sbjct: 126 VLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAG 185

Query: 194 SLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLA 253
           +L RG+     R     G  F  Y  L  + ++K  +R  + SW+    G +SG +   +
Sbjct: 186 ALYRGVSLTAARQATNQGANFTVYSYL-KDYLQKYHNRESLPSWETSCIGLISGAIGPFS 244

Query: 254 IYPLDVVKSMIQTD-TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGAT 312
             PLD +K+ +Q D ++ +      +  +   L +E+G  A +KG  P ++R AP    T
Sbjct: 245 NAPLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPGQAVT 304

Query: 313 FVTFELVMRLL 323
           F  +E V + L
Sbjct: 305 FTVYEFVRKHL 315

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 40/90 (44%), Gaps = 12/90 (13%)

Query: 43  ILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRK-------LVKNEGVWAFYKG 95
           +++G  G  S      P DT K R+Q   KS+ +    +K       L+K EG  A YKG
Sbjct: 235 LISGAIGPFSNA----PLDTIKTRLQKD-KSISSNSAWKKIYIIGTQLIKEEGFRALYKG 289

Query: 96  SLIPIVGVGACVSVQFGVNEAMKRFFREWN 125
               ++ V    +V F V E +++     N
Sbjct: 290 ITPRVMRVAPGQAVTFTVYEFVRKHLETLN 319

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score =  105 bits (262), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 81/310 (26%), Positives = 140/310 (45%), Gaps = 30/310 (9%)

Query: 34  KDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQT--------SAKSVGALDIIRKLVK 85
           K ++    +++AG   G+ + +   P DT KVRMQ           K  G +   R + +
Sbjct: 5   KKASHPAINLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQ 64

Query: 86  NEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYIC 145
            EG  A YKG    ++G+   ++++F   E    F+R    ++      G +  G  ++ 
Sbjct: 65  KEGFLALYKGLGAVVIGIIPKMAIRFSSYE----FYRTLLVNK----ESGIVSTGNTFVA 116

Query: 146 GLTGGVVNSFLA-SPIEHVRIRLQTQTGNGNER----EFKGPLDCIRKLVKEK---SLMR 197
           G+  G+  + L  +P+E V+IRLQ Q    +E     ++   +     +VKE+   +L R
Sbjct: 117 GVGAGITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYR 176

Query: 198 GLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEI-ASWKLCSYGSLSGVVLWLAIYP 256
           G+     R     G  F  Y  L   E  +   + ++  SW+    G +SG +   +  P
Sbjct: 177 GVSLTAARQATNQGANFTVYSKL--KEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAP 234

Query: 257 LDVVKSMIQTDTLRNPRFKNSMKNVIN---HLYREQGISAFFKGFAPTMLRAAPVNGATF 313
           LD +K+ +Q D   +   ++ MK +I     L +E+G  A +KG  P ++R AP    TF
Sbjct: 235 LDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTF 294

Query: 314 VTFELVMRLL 323
             +E V   L
Sbjct: 295 TVYEYVREHL 304

>Scas_632.9
          Length = 292

 Score =  104 bits (259), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 134/293 (45%), Gaps = 28/293 (9%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV--GALDIIRKLVKNEGVW-AFYKGS 96
           L DI+ G+  G    I+  PFDT KVR+QT    +       I+    NEGVW  F++G 
Sbjct: 18  LSDIVNGSIAGAFGKIIEYPFDTVKVRLQTQGSHIFPTTWSCIKYTYHNEGVWRGFFQGI 77

Query: 97  LIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQ-LGQYYICGLTGGVVNSF 155
             P+          FG        F  +N       +   +  L    + G   G   SF
Sbjct: 78  GSPL----------FGAALENATLFVSYNQCSNVLEKFTNVSPLSNILLSGAFAGSCASF 127

Query: 156 LASPIEHVRIRLQT---QTGNGNEREFKGPLDCIRKLVKEKSLM---RGLRPMMLRAGHG 209
           + +P+E ++ +LQ    QT    + +    +  +  +++EK ++   +G     +R   G
Sbjct: 128 VLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLG 187

Query: 210 LGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTL 269
              +F TYE ++   +K  +  +E  +W+L   G+ +G+    +I+P D VKSM+QT+ +
Sbjct: 188 GVAWFATYE-VMKQGLKDRRKDTENKTWELLVSGASAGLAFNASIFPADTVKSMMQTEHI 246

Query: 270 RNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRL 322
                  ++ N +  +    GI+ F++G   T++RA P N   F  +E + ++
Sbjct: 247 -------TLINAVKKVLTTYGITGFYRGLGITLIRAVPANATVFYMYETLSKM 292

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score =  103 bits (257), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 80/305 (26%), Positives = 136/305 (44%), Gaps = 24/305 (7%)

Query: 34  KDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV-------GALDIIRKLVKN 86
           K S+    +++AG   G+ + +   P DT KVRMQ   +S        G +   R +   
Sbjct: 5   KKSSNPAVNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTE 64

Query: 87  EGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICG 146
           EG+ A YKG    ++G+   ++++F   E    F+R     + T    G++  G  ++ G
Sbjct: 65  EGLLALYKGLGAVVIGIIPKMAIRFSSYE----FYRSALADKQT----GSVSTGNTFLAG 116

Query: 147 LTGGVVNSFLA-SPIEHVRIRLQTQ---TGNGNEREFKGPLDCIRKLVKEK---SLMRGL 199
           +  G   + L  +P+E V+IRLQ Q           ++  L     +VKE+   +L RG+
Sbjct: 117 VGAGTTEAVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGV 176

Query: 200 RPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDV 259
                R     G  F  Y  L    +++      + SW+    G +SG +   +  PLD 
Sbjct: 177 SLTAARQATNQGANFTVYSKL-KEFLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDT 235

Query: 260 VKSMIQTD-TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFEL 318
           +K+ +Q D +  N    + +  +   L +E+G  A +KG  P ++R AP    TF  +E 
Sbjct: 236 IKTRLQKDKSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEF 295

Query: 319 VMRLL 323
           V   L
Sbjct: 296 VREHL 300

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score =  104 bits (259), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 81/287 (28%), Positives = 130/287 (45%), Gaps = 19/287 (6%)

Query: 46  GTCGGISQVIVGQPFDTTKVRMQTS---AKSVGALDIIRKLVKNEGVWAFYKGSLIPIVG 102
           G+  G    +V  P D  K RMQ     +K   ++D + K++  EGV   Y G    ++G
Sbjct: 531 GSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEGVRGLYSGLGPQLIG 590

Query: 103 VGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEH 162
           V    +++  VN+ M+       T  G   RDG L L    I G T G       +P+E 
Sbjct: 591 VAPEKAIKLTVNDHMRA------TLAG---RDGKLSLPCEIISGATAGACQVVFTNPLEI 641

Query: 163 VRIRLQTQTGNGNE--REFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEAL 220
           V+IRLQ ++    +  R     +  I+ L     L RG    +LR       YF TY  +
Sbjct: 642 VKIRLQVKSDYVADAARNSVNAISVIKNL-GLIGLYRGAGACLLRDIPFSAIYFPTYAHI 700

Query: 221 IAN----EIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKN 276
            +N    + K    R+++ +W+L   G L+G+       P DV+K+ +Q D  +     N
Sbjct: 701 KSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVYN 760

Query: 277 SMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
            + +    + +E+GI +FFKG    +LR++P  G T   +E+   L 
Sbjct: 761 GIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEIFHNLF 807

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 81/195 (41%), Gaps = 32/195 (16%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTSA--------KSVGALDIIRKLVKNEGVWAFY 93
           +I++G   G  QV+   P +  K+R+Q  +         SV A+ +I    KN G+   Y
Sbjct: 621 EIISGATAGACQVVFTNPLEIVKIRLQVKSDYVADAARNSVNAISVI----KNLGLIGLY 676

Query: 94  KGSLIPIVGVGACV-------SVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICG 146
           +G+       GAC+       ++ F     +K     +N       +   L   Q  + G
Sbjct: 677 RGA-------GACLLRDIPFSAIYFPTYAHIKS--NVFNFDPKDSDKRNKLNTWQLLVSG 727

Query: 147 LTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMM 203
              G+  +FL +P + ++ RLQ     G E  + G  D  R ++KE   KS  +G    +
Sbjct: 728 GLAGMPAAFLTTPFDVIKTRLQIDPKKG-ESVYNGIWDAARTILKEEGIKSFFKGGPARV 786

Query: 204 LRAGHGLGCYFLTYE 218
           LR+    G     YE
Sbjct: 787 LRSSPQFGFTLAAYE 801

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 36/179 (20%), Positives = 80/179 (44%), Gaps = 14/179 (7%)

Query: 143 YICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGL 199
           +  G   G + + +  PI+ V+ R+Q Q    +  ++K  +DC+ K++ +   + L  GL
Sbjct: 528 FTLGSVAGCIGAMVVYPIDMVKTRMQAQR---DFSKYKNSIDCLLKILSKEGVRGLYSGL 584

Query: 200 RPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDV 259
            P ++             + + A     G+D       ++ S G+ +G    +   PL++
Sbjct: 585 GPQLIGVAPEKAIKLTVNDHMRA--TLAGRDGKLSLPCEIIS-GATAGACQVVFTNPLEI 641

Query: 260 VKSMIQTDTLRNPRFKNSMKNVINHL--YREQGISAFFKGFAPTMLRAAPVNGATFVTF 316
           VK  +Q   +++    ++ +N +N +   +  G+   ++G    +LR  P +   F T+
Sbjct: 642 VKIRLQ---VKSDYVADAARNSVNAISVIKNLGLIGLYRGAGACLLRDIPFSAIYFPTY 697

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score =  100 bits (249), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 83/297 (27%), Positives = 138/297 (46%), Gaps = 25/297 (8%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVG----ALDIIR---KLVKNEGVWAFYK 94
           +++AG   G+ + +   P DT KVRMQ    +VG    A   I+   ++ +NEG  AFYK
Sbjct: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72

Query: 95  GSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNS 154
           G    ++G+   ++++F   E    F+R     + T    G +  G  +I G+  G+  +
Sbjct: 73  GLGAVVIGITPKMAIRFSSYE----FYRTLLADKET----GKVSTGNTFIAGVGAGITEA 124

Query: 155 FLASPIEHV-RIRLQTQTGNGNE--REFKGPLDCIRKLVKEK---SLMRGLRPMMLRAGH 208
            +      V +IRLQ Q  N  E   ++K  +     +VKE+   +L RG+     R   
Sbjct: 125 VVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQAT 184

Query: 209 GLGCYFLTYEALIANEIKKGKDRSE-IASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTD 267
             G  F  Y  L   E  +G    E + SW+    G +SG +   +  PLD +K+ +Q D
Sbjct: 185 NQGANFTVYSKL--KEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKD 242

Query: 268 -TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
            + +N      +  +   L +E+G  A +KG  P ++R AP    TF  +E + + L
Sbjct: 243 KSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score =  100 bits (248), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 82/300 (27%), Positives = 139/300 (46%), Gaps = 36/300 (12%)

Query: 44  LAGTCGGISQVIVGQPFDTTKVRMQ-----TSAKSVG--------ALDIIRKLVKNEGVW 90
           ++G   GIS++ V  P D  K R Q      +A +VG         +D ++K+VK EG  
Sbjct: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76

Query: 91  AFYKGSLIPIVGVGACVSVQFGVNEAMKRFFRE-WNTSRGTQHRDGTLQLGQYYICGLTG 149
             Y+G   P++      + +F  N+  ++ F+  +NT+  TQ              G + 
Sbjct: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS--------IAAGASA 128

Query: 150 GVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLM---RGLRPMMLRA 206
           G+  + +  P E ++IR+Q       +  + GP+DC++K +K + +M   +G+   M R 
Sbjct: 129 GMTEAAVIVPFELIKIRMQDV-----KSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRN 183

Query: 207 GHGLGCYF-LTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQ 265
               G YF + Y+  + N +   K + +     L + G++ G V  +   P DVVKS IQ
Sbjct: 184 ALWNGGYFGVIYQ--VRNSMPVAKTKGQKTRNDLIA-GAIGGTVGTMLNTPFDVVKSRIQ 240

Query: 266 T-DTLRNPRFK-NSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
           + D + +   K N     +  +YRE+G  A +KGF P + R AP      V F  +M   
Sbjct: 241 SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 79/173 (45%), Gaps = 13/173 (7%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTSAKS-VGALDIIRKLVKNEGVWAFYKGSLIPI 100
            I AG   G+++  V  PF+  K+RMQ    S +G +D ++K +KNEG+   YKG    +
Sbjct: 121 SIAAGASAGMTEAAVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTM 180

Query: 101 VGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPI 160
                     FGV   ++       T +G + R+         I G  GG V + L +P 
Sbjct: 181 WRNALWNGGYFGVIYQVRNSMPVAKT-KGQKTRND-------LIAGAIGGTVGTMLNTPF 232

Query: 161 EHVRIRLQTQTGNGNE-REFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHG 209
           + V+ R+Q+     +  +++   L  +  + +E   ++L +G  P + R   G
Sbjct: 233 DVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPG 285

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 7/89 (7%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGA-------LDIIRKLVKNEGVWAFYK 94
           D++AG  GG    ++  PFD  K R+Q+      A       L  +  + + EG  A YK
Sbjct: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYK 273

Query: 95  GSLIPIVGVGACVSVQFGVNEAMKRFFRE 123
           G +  +  +    S+   V   M  FFR+
Sbjct: 274 GFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 99.4 bits (246), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 133/289 (46%), Gaps = 27/289 (9%)

Query: 44  LAGTCGGISQVIVGQPFDTTKVRMQ------TSAKSVGALDIIRKLVKNEGVWAFYKGSL 97
           +AG   G+S+++V  P D  K  MQ      +  +  G  D ++++   EG    YKG  
Sbjct: 14  MAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGIS 73

Query: 98  IPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLA 157
            PI+      + +F  N+  ++ +++     G +     L +    + G + G+  SF+ 
Sbjct: 74  SPILMEAPKRATKFACNDEFQKIYKDL---FGAEKLTQPLSI----LSGASAGICESFVV 126

Query: 158 SPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLM---RGLRPMMLRAGHGLGCYF 214
            P E V+IRLQ  +      +F  P+  ++ +V+++ ++    GL   M R G     YF
Sbjct: 127 VPFELVKIRLQDVSS-----KFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYF 181

Query: 215 -LTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRN-- 271
            + ++  +   + K   +SE     L + G++ G +  L   P DVVKS +Q   +    
Sbjct: 182 GIIFQ--VRALLPKASTKSEQTRNDLLA-GTVGGTLSSLLSTPFDVVKSRVQNTAVIPGV 238

Query: 272 PRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVM 320
           PR  N     +  +Y+E+G  A +KGF P +LR  P  G   V F  VM
Sbjct: 239 PRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVM 287

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 89/185 (48%), Gaps = 13/185 (7%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQ-TSAKSVGALDIIRKLVKNEGVWAFYKGSLIPI 100
            IL+G   GI +  V  PF+  K+R+Q  S+K    + +++ +V+ EG+ A Y G    +
Sbjct: 111 SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTM 170

Query: 101 VGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPI 160
              G   +  FG+   ++    + +T +  Q R+  L        G  GG ++S L++P 
Sbjct: 171 WRHGIWNAGYFGIIFQVRALLPKAST-KSEQTRNDLL-------AGTVGGTLSSLLSTPF 222

Query: 161 EHVRIRLQ-TQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGLGCYFLT 216
           + V+ R+Q T    G  R++      +  + KE   K+L +G  P +LR G G G   + 
Sbjct: 223 DVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVV 282

Query: 217 YEALI 221
           +  ++
Sbjct: 283 FTGVM 287

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 77/175 (44%), Gaps = 10/175 (5%)

Query: 143 YICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKS---LMRGL 199
           ++ G   GV    +  P++ V+  +Q Q   G+  ++KG  DC++++  ++    L +G+
Sbjct: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72

Query: 200 RPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSY-GSLSGVVLWLAIYPLD 258
              +L         F   +     +I K    +E  +  L    G+ +G+     + P +
Sbjct: 73  SSPILMEAPKRATKFACNDEF--QKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFE 130

Query: 259 VVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATF 313
           +VK  +Q     + +F + +  V+ ++  ++GI A + G   TM R    N   F
Sbjct: 131 LVKIRLQD---VSSKFTSPIA-VVKNIVEKEGILAMYNGLESTMWRHGIWNAGYF 181

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 43/94 (45%), Gaps = 7/94 (7%)

Query: 36  STRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVG-------ALDIIRKLVKNEG 88
           S +   D+LAGT GG    ++  PFD  K R+Q +A   G       +   +  + K EG
Sbjct: 198 SEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEG 257

Query: 89  VWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFR 122
             A YKG +  ++ +G    +   V   +  FFR
Sbjct: 258 FKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 97.4 bits (241), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 80/297 (26%), Positives = 135/297 (45%), Gaps = 32/297 (10%)

Query: 32  MAKDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV--GALDIIRKLVKNEGV 89
           M++D+ +  KD+L G   G    +V  PFDT KVR+QT + ++       +    K EG+
Sbjct: 1   MSEDADKAYKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQSAALFPTTWSCVSHTYKQEGL 60

Query: 90  W-AFYKGSLIPIVGV---GACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYIC 145
           W  FY+G   P+ G     A + V F   +A+              +  G L+  +    
Sbjct: 61  WRGFYQGMASPVFGAFLEHAVLFVSFNRAQAVLE----------NCYSCGPLE--KVVFA 108

Query: 146 GLTGGVVNSFLASPIEHVRIRLQTQ--TGNGNEREFKGPLDCIRKLVKEK---SLMRGLR 200
           G   G   S++ +P+E V+ +LQ    TG    R +   L  +R +VK+     L +G  
Sbjct: 109 GAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPR-YTAVLPTLRAIVKQNGLGGLWQGQS 167

Query: 201 PMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVV 260
              +R   G   +F  YE L    + + +  +E   W+L + G+ +G     +I+P D V
Sbjct: 168 GTFIRESAGGAVWFTAYEVL-KGWLARRRGSTENTVWELLASGAGAGAAFHASIFPADTV 226

Query: 261 KSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
           KS +QT+ L        +   +  + ++ G + F++G   T+LRA P N   F  +E
Sbjct: 227 KSTMQTEHL-------GLGPAVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVYE 276

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 99.0 bits (245), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 133/293 (45%), Gaps = 19/293 (6%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV---GALDIIRKLVKNEGVWAFYKGS 96
           + +   G+  G     V  P D  K RMQ    SV    ++D + K+ + +G+   Y G 
Sbjct: 505 IHNFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLYSGL 564

Query: 97  LIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFL 156
              ++GV    +++  VN+ M+++F   N SR       T++  Q  + G T G      
Sbjct: 565 GPQLIGVAPEKAIKLTVNDFMRQYF--MNKSR-------TIKWYQEILSGATAGACQVVF 615

Query: 157 ASPIEHVRIRLQTQTG--NGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYF 214
            +P+E V+IRLQ ++     N R   G +  IR+L   + L +G    +LR       YF
Sbjct: 616 TNPLEIVKIRLQMRSDYVGENARPQLGAVGIIRQL-GLRGLYKGAAACLLRDVPFSAIYF 674

Query: 215 LTYEALIAN----EIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLR 270
            TY  L  +    +      R+++ +W+L   G ++G+       P DV+K+ +Q D  +
Sbjct: 675 PTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPRK 734

Query: 271 NPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
                  + +    + +E+ I +FFKG    +LR++P  G T   FE+   L 
Sbjct: 735 GETTYTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFEMFQGLF 787

>Scas_709.9
          Length = 365

 Score = 96.3 bits (238), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 82/293 (27%), Positives = 134/293 (45%), Gaps = 31/293 (10%)

Query: 44  LAGTCGGISQVIVGQPFDTTKVRMQTSA-KSV------GALDIIRKLVKNEGVWAFYKGS 96
           L+G   G    I+  P D TK R+Q    +S+      G L  +  +V +EGV   YKG 
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKG- 127

Query: 97  LIPIV-GVGACVSVQFGVNEAMKRFF-REWNTSRGTQHRDGTLQLGQYYICGLTGGVVNS 154
           LIPI+ G      + F V E  K  + R    S    H              +T G  ++
Sbjct: 128 LIPIILGYFPTWMIYFSVYEFAKDLYPRVLPNSDFISHS----------CSAITAGAAST 177

Query: 155 FLASPIEHVRIRLQTQTGNGNER-EFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGL 210
            L +PI  V+ RL  QT  G  R  ++G +D  +K++ +   ++L  GL P M    H +
Sbjct: 178 VLTNPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGLLH-V 236

Query: 211 GCYFLTYEAL----IANEIKKGKDRSE--IASWKLCSYGSLSGVVLWLAIYPLDVVKSMI 264
             +F  YE L      + I  G +  E  +   +L    S S ++  +  YP +++++ +
Sbjct: 237 AIHFPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRM 296

Query: 265 QTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
           Q  + +    K+ + ++I   YR +G+  F+ GFA  +LR  P +  T V+FE
Sbjct: 297 QLKSDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFE 349

>Scas_602.8
          Length = 885

 Score = 97.8 bits (242), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 129/289 (44%), Gaps = 20/289 (6%)

Query: 46  GTCGGISQVIVGQPFDTTKVRMQTS---AKSVGALDIIRKLVKNEGVWAFYKGSLIPIVG 102
           G+  G     +  P D  K RMQ      K   ++D + K+   EG+   Y G    ++G
Sbjct: 505 GSVAGCIGATLVYPIDFIKTRMQAQRSLTKYKNSIDCLVKIFGKEGIRGLYSGLGPQLIG 564

Query: 103 VGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEH 162
           V    +++  VN+ M++             + G LQLG   + G T G       +P+E 
Sbjct: 565 VAPEKAIKLTVNDFMRK---------SLVDKKGNLQLGAEVLSGATAGACQVVFTNPLEI 615

Query: 163 VRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLM---RGLRPMMLRAGHGLGCYFLTYEA 219
           V+IRLQ ++   N    K  L    +++KE  L+   +G+   +LR       YF TY  
Sbjct: 616 VKIRLQVKSEYTNAMIPKSQLTAF-QIIKELKLIGLYKGVGACLLRDVPFSAIYFPTYAH 674

Query: 220 LIANEIK---KGKD-RSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFK 275
           L  N  +     KD R  + +W+L + G+L+GV       P DV+K+ +Q +        
Sbjct: 675 LKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGETRY 734

Query: 276 NSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
             + + +  + +E+   +FFKG A  ++R++P  G T   +EL   +  
Sbjct: 735 TGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYELFKNMFN 783

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 93/212 (43%), Gaps = 26/212 (12%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKL-----VKNEGVWAFYKGS 96
           ++L+G   G  QV+   P +  K+R+Q  ++   A+    +L     +K   +   YK  
Sbjct: 595 EVLSGATAGACQVVFTNPLEIVKIRLQVKSEYTNAMIPKSQLTAFQIIKELKLIGLYK-- 652

Query: 97  LIPIVGVGACV-------SVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTG 149
                GVGAC+       ++ F     +K+   +++ +   + RD  L+  +    G   
Sbjct: 653 -----GVGACLLRDVPFSAIYFPTYAHLKKNVFQFDPNDKDK-RD-RLKTWELLTAGALA 705

Query: 150 GVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRA 206
           GV  +FL +P + ++ RLQ + G G E  + G L  +R ++KE   +S  +G    ++R+
Sbjct: 706 GVPAAFLTTPFDVIKTRLQIEPGVG-ETRYTGILHAVRTILKEESFRSFFKGGAARVMRS 764

Query: 207 GHGLGCYFLTYEALIANEIKKGKDRSEIASWK 238
               G     YE L  N      D+    + K
Sbjct: 765 SPQFGFTLAAYE-LFKNMFNISDDKQPTKNEK 795

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300
           S GS++G +    +YP+D +K+ +Q       ++KNS+  ++  ++ ++GI   + G  P
Sbjct: 503 SLGSVAGCIGATLVYPIDFIKTRMQAQRSL-TKYKNSIDCLV-KIFGKEGIRGLYSGLGP 560

Query: 301 TMLRAAP 307
            ++  AP
Sbjct: 561 QLIGVAP 567

>Kwal_47.18216
          Length = 333

 Score = 95.5 bits (236), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 80/332 (24%), Positives = 142/332 (42%), Gaps = 52/332 (15%)

Query: 34  KDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV-------GALDIIRKLVKN 86
           K+S+    +++AG   G+ + +   P DT KVRMQ  +++        G +   R +   
Sbjct: 5   KNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQ 64

Query: 87  EGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICG 146
           EG  A YKG    ++G+   ++++F   E    FFR     R T    G +  G  ++ G
Sbjct: 65  EGFLALYKGLGAVVIGIIPKMAIRFTSYE----FFRTLLADRQT----GVVSTGNTFVAG 116

Query: 147 LTGGVVNSFLA-SPIEHVRIRLQTQ-----------------------------TGNGNE 176
           +  G+  + +  +P+E V+IRLQ Q                                   
Sbjct: 117 VGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAAT 176

Query: 177 REFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSE 233
            +++  +     +VKE   ++L RG+     R     G  F  Y  L  + +++      
Sbjct: 177 PKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTL-KSRLQEYHQTDM 235

Query: 234 IASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTD--TLRNPRFKNSMKNVINHLYREQGI 291
           + SW+    G +SG +   +  PLD +K+ +Q D  T ++  +   +  +   L RE+G 
Sbjct: 236 LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILA-IGRQLIREEGF 294

Query: 292 SAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
            A +KG  P ++R AP    TF  +EL+ + L
Sbjct: 295 RALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 94.4 bits (233), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 84/313 (26%), Positives = 142/313 (45%), Gaps = 38/313 (12%)

Query: 32  MAKDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKS--------VGALDIIRKL 83
           M++     +   ++G   G+S+++V  P D  K RMQ    S         G +D + ++
Sbjct: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI 60

Query: 84  VKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFRE-WNTSRGTQHRDGTLQLGQY 142
           VK EG    YKG   P++      + +F  N++ ++ F++ +   + TQ           
Sbjct: 61  VKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQIS-------- 112

Query: 143 YICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGL 199
            + G   GV  + +  P E V+IRLQ         +F GP++ + K ++E    SL  GL
Sbjct: 113 ILSGSLAGVTEACVIVPFELVKIRLQDV-----NSKFNGPMEVVFKTIRETGILSLYNGL 167

Query: 200 RPMMLRAGHGLGCYF-LTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYP-L 257
              M R     G YF + ++  I   + K K  +E  +  L + G++ G   +   +  L
Sbjct: 168 ESTMWRNAFWNGGYFGVIFQ--IRALLPKAKTNTEKTTNDLIA-GTIGGYCRYSTEHTIL 224

Query: 258 DVVKSMIQ---TDTLRN----PRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNG 310
            VVKS IQ   T TL +    P++  +  ++   +Y E+G +A +KGF P +LR  P  G
Sbjct: 225 SVVKSRIQSGATTTLADGTVVPKYNWTWPSLF-KIYSEEGFTALYKGFIPKILRLGPGGG 283

Query: 311 ATFVTFELVMRLL 323
              V F  +M   
Sbjct: 284 IMLVVFNGMMAFF 296

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 41/101 (40%), Gaps = 12/101 (11%)

Query: 35  DSTRVLKDILAGTCGGISQVIVGQP-FDTTKVRMQTSAKSVGALDIIR-----------K 82
           ++ +   D++AGT GG  +           K R+Q+ A +  A   +            K
Sbjct: 198 NTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFK 257

Query: 83  LVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFRE 123
           +   EG  A YKG +  I+ +G    +   V   M  FF+E
Sbjct: 258 IYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQE 298

>Scas_714.18
          Length = 305

 Score = 94.0 bits (232), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 78/318 (24%), Positives = 138/318 (43%), Gaps = 59/318 (18%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV--GALDIIRKLVKNEGVW-AFYKGS 96
           L++ILAG+  G     +  PFDT KVR+QT    +       I+   +NEG+   FY+G 
Sbjct: 13  LREILAGSIAGAIGKFIEYPFDTVKVRLQTQEAYMFPSTWSCIKYTYENEGILEGFYQGI 72

Query: 97  LIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNS-- 154
             P++G     ++ F        F   +             +   + I  ++ G   S  
Sbjct: 73  ESPLIGAALENAILFLAYNQCSSFLNAFT------------EFSAFLIILISAGFAGSCA 120

Query: 155 -FLASPIEHVRIRLQTQT------------------------GNGNEREFKGPLDCIRKL 189
            F+ +P+E ++ +LQ                           G G        +  I+ +
Sbjct: 121 SFVLTPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRI---IPTIKSI 177

Query: 190 VKEKSLM---RGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEI-ASWKLCSYGSL 245
           +KEK L    +G     +R   G   +F TYE L+   ++  K  SE+  +W+L   G+ 
Sbjct: 178 IKEKGLFGLWQGQSSTFIRESIGSVVWFATYE-LMKQTLRDPK--SEVNTTWQLLISGAT 234

Query: 246 SGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRA 305
           +G+    +++P D VKS++QT+ L       ++   +  +    G++ F++G   T+LRA
Sbjct: 235 AGLAFNGSVFPADTVKSIMQTEHL-------ALMETVRSILERDGVAGFYRGLGITLLRA 287

Query: 306 APVNGATFVTFELVMRLL 323
            P N A F T+E + ++L
Sbjct: 288 VPSNAAVFYTYEKLSKIL 305

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 96.3 bits (238), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 130/283 (45%), Gaps = 20/283 (7%)

Query: 46  GTCGGISQVIVGQPFDTTKVRMQTS---AKSVGALDIIRKLVKNEGVWAFYKGSLIPIVG 102
           G+  G     V  P D  K RMQ     A+   ++D + K++  EG+   Y G    ++G
Sbjct: 537 GSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSGLGPQLIG 596

Query: 103 VGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEH 162
           V    +++  VN+ M+        +R T  ++G L L    I G + G       +P+E 
Sbjct: 597 VAPEKAIKLTVNDFMR--------NRLTD-KNGKLSLFPEIISGASAGACQVIFTNPLEI 647

Query: 163 VRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGLGCYFLTYEA 219
           V+IRLQ Q+    E   +   +   ++VK+   + L  G+   ++R       YF TY  
Sbjct: 648 VKIRLQVQSDYVGEN-IQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPTYAH 706

Query: 220 LIAN----EIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFK 275
           L  +    +      R+ + +W+L + G+++G+       P DV+K+ +Q D  +     
Sbjct: 707 LKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGETKY 766

Query: 276 NSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFEL 318
           N + + I  + +E+   +FFKG    +LR++P  G T   +EL
Sbjct: 767 NGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYEL 809

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 85/195 (43%), Gaps = 25/195 (12%)

Query: 39  VLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVG-----ALDIIRKLVKNEGVWAFY 93
           +  +I++G   G  QVI   P +  K+R+Q  +  VG     A +   ++VK  G+   Y
Sbjct: 624 LFPEIISGASAGACQVIFTNPLEIVKIRLQVQSDYVGENIQQANETATQIVKKLGLRGLY 683

Query: 94  KGSLIPIVGVGACV-------SVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICG 146
                   GV AC+       ++ F     +K+   +++ +  T+     L+  +    G
Sbjct: 684 N-------GVAACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKR--NRLKTWELLTAG 734

Query: 147 LTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMM 203
              G+  +FL +P + ++ RLQ     G E ++ G    IR ++KE   +S  +G    +
Sbjct: 735 AIAGMPAAFLTTPFDVIKTRLQIDPRKG-ETKYNGIFHAIRTILKEESFRSFFKGGGARV 793

Query: 204 LRAGHGLGCYFLTYE 218
           LR+    G     YE
Sbjct: 794 LRSSPQFGFTLAAYE 808

 Score = 37.0 bits (84), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 37/67 (55%), Gaps = 2/67 (2%)

Query: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300
           S GS++G +    +YP+D +K+ +Q       ++KNS+  ++  + RE GI   + G  P
Sbjct: 535 SLGSIAGCIGATVVYPIDFIKTRMQAQRSL-AQYKNSIDCLLKIISRE-GIKGLYSGLGP 592

Query: 301 TMLRAAP 307
            ++  AP
Sbjct: 593 QLIGVAP 599

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 94.0 bits (232), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 81/329 (24%), Positives = 137/329 (41%), Gaps = 58/329 (17%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQ--------------------------------- 68
           +++AG   G+ + +   P DT KVRMQ                                 
Sbjct: 14  NLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGDA 73

Query: 69  -TSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTS 127
             + K  G +   R +   EG  A YKG    ++G+   ++++F   E    F+R     
Sbjct: 74  TAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYE----FYRTLLAD 129

Query: 128 RGTQHRDGTLQLGQYYICGLTGGVVNSFLA-SPIEHVRIRLQTQTGNGN----EREFKGP 182
           + T    G +     +I G+  GV  + L  +P+E V+IRLQ Q  N N    + ++   
Sbjct: 130 KQT----GVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNA 185

Query: 183 LDCIRKLVKEK---SLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKL 239
           +     ++KE+   +L RG+     R     G  F  Y  L    +++      + SW+ 
Sbjct: 186 VQAGYTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKL-REFLQEYHGTETLPSWET 244

Query: 240 CSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNS-----MKNVINHLYREQGISAF 294
              G +SG +   +  PLD +K+ +Q D  ++  FK       + ++   L +E+G  A 
Sbjct: 245 SCIGLISGAIGPFSNAPLDTIKTRLQKD--KSTSFKGESGWKRIAHIGTQLLKEEGFRAL 302

Query: 295 FKGFAPTMLRAAPVNGATFVTFELVMRLL 323
           +KG  P ++R AP    TF  +E V R L
Sbjct: 303 YKGITPRVMRVAPGQAVTFTVYEFVRRHL 331

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 94.4 bits (233), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 124/289 (42%), Gaps = 19/289 (6%)

Query: 44  LAGTCGGISQVIVGQPFDTTKVRMQTS---AKSVGALDIIRKLVKNEGVWAFYKGSLIPI 100
           L    G I   IV  P D  K RMQ     ++   ++D   K++  EG+   Y G    +
Sbjct: 549 LGSVAGCIGATIV-YPIDFVKTRMQAQRSLSQYKNSIDCFLKILSREGIRGVYSGLGPQL 607

Query: 101 VGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPI 160
           +GV    +++  VN+ M+   ++ N         G L L    I G + G       +P+
Sbjct: 608 IGVAPEKAIKLTVNDYMRNKLKDKN---------GKLGLLSEIISGASAGACQVIFTNPL 658

Query: 161 EHVRIRLQTQTGNGNEREFKGPLDCIR--KLVKEKSLMRGLRPMMLRAGHGLGCYFLTYE 218
           E V+IRLQ +     E      L  ++  K +    L +G    +LR       YF TY 
Sbjct: 659 EIVKIRLQVKGEYVAENAENAKLTALQIIKRLGLPGLYKGAAACLLRDVPFSAIYFPTYA 718

Query: 219 ALIAN----EIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRF 274
            L  +    +      RS + +W+L S G+L+G+       P DV+K+ +Q D  +    
Sbjct: 719 HLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGETI 778

Query: 275 KNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
              + +    + RE+   +FFKG A  +LR++P  G T   +EL   + 
Sbjct: 779 YKGIIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYELFHNIF 827

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 84/192 (43%), Gaps = 19/192 (9%)

Query: 39  VLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVG---------ALDIIRKLVKNEGV 89
           +L +I++G   G  QVI   P +  K+R+Q   + V          AL II++L    G+
Sbjct: 637 LLSEIISGASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENAKLTALQIIKRL----GL 692

Query: 90  WAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTG 149
              YKG+   ++      ++ F     +KR    +N     +++   L   +    G   
Sbjct: 693 PGLYKGAAACLLRDVPFSAIYFPTYAHLKRDL--FNFDPNDKNKRSRLNTWELLSAGALA 750

Query: 150 GVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRA 206
           G+  ++L +P + ++ RLQ     G E  +KG +   R +++E   KS  +G    +LR+
Sbjct: 751 GMPAAYLTTPFDVIKTRLQIDPKKG-ETIYKGIIHAARTILREESFKSFFKGGAARVLRS 809

Query: 207 GHGLGCYFLTYE 218
               G     YE
Sbjct: 810 SPQFGFTLAAYE 821

 Score = 36.2 bits (82), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 2/67 (2%)

Query: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300
           S GS++G +    +YP+D VK+ +Q     + ++KNS+   +  L RE GI   + G  P
Sbjct: 548 SLGSVAGCIGATIVYPIDFVKTRMQAQRSLS-QYKNSIDCFLKILSRE-GIRGVYSGLGP 605

Query: 301 TMLRAAP 307
            ++  AP
Sbjct: 606 QLIGVAP 612

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 91.7 bits (226), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 137/301 (45%), Gaps = 30/301 (9%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV---------GALDIIRKLVKNEGVWAF 92
           + ++G   G+   IV  P D  K R+Q               G++  +  +V++EGV   
Sbjct: 71  NAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGL 130

Query: 93  YKGSLIPIV-GVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGV 151
           YKG L+PI+ G      + F V E  K   R  N+S  +           +    +T G 
Sbjct: 131 YKG-LVPIIMGYFPTWMIYFSVYEFCKDNLRT-NSSNWS--------FVSHSFSAITAGA 180

Query: 152 VNSFLASPIEHVRIRLQTQTGNG-NEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAG 207
           V++ + +PI  V+ RL  QT  G N   ++G  D  +K++ +   K+L  GL P +L   
Sbjct: 181 VSTVVTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLLGLL 240

Query: 208 HGLGCYFLTYEALIAN----EIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSM 263
           H +  +F  YE L  +    +  +  + S+I   +L    S+S +V  +  YP +++++ 
Sbjct: 241 H-VAIHFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTR 299

Query: 264 IQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
           +Q  +   P  +  +  +I   Y ++GI  F+ GF   + R  P +  T V+FE V   L
Sbjct: 300 LQLKS-DLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYVRNFL 358

Query: 324 G 324
            
Sbjct: 359 N 359

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 88.6 bits (218), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 81/306 (26%), Positives = 137/306 (44%), Gaps = 28/306 (9%)

Query: 34  KDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQ----TSAKSVGALDIIRKLVKNEGV 89
           K     L   LAG+  G ++  +  PF+  K R+Q     S  S   L +I K  K +G+
Sbjct: 7   KSDVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKTAKTQGI 66

Query: 90  WAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTG 149
            + Y G    I+G  A   ++F   + +K   R+  T        G L   +  I GL  
Sbjct: 67  GSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRDSET--------GELSGTRGVIAGLGA 118

Query: 150 GVVNSFLA-SPIEHVRIRLQTQTGNGNEREFKGPLDCIRK---LVKEKS---LMRGLRPM 202
           G++ S  A +P E ++  L     +   +        +R    LV++K    L RG+ P+
Sbjct: 119 GLLESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPV 178

Query: 203 MLRAGHG----LGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLD 258
            +R        LGCY    + LI +     KD+  ++S      G+ SG+V   +  PLD
Sbjct: 179 SMRQAANQAVRLGCYN-KIKTLIQDYTDSPKDK-PLSSGLTFLVGAFSGIVTVYSTMPLD 236

Query: 259 VVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFEL 318
            VK+ +Q+  L + ++ ++M N    +++E+G+  F+KG  P + R     G  F  +E 
Sbjct: 237 TVKTRMQS--LDSTKYSSTM-NCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYEK 293

Query: 319 VMRLLG 324
           V+ +L 
Sbjct: 294 VLVMLA 299

>Kwal_26.7967
          Length = 297

 Score = 88.6 bits (218), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 82/300 (27%), Positives = 139/300 (46%), Gaps = 28/300 (9%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQ----TSAKSVGALDIIRKLVKNEGVWAFYKG 95
           L   LAG+  G  +  +  PF+  K R+Q    +S  S   L +I +  K +G+ A Y G
Sbjct: 10  LHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKVQGLGAVYVG 69

Query: 96  SLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSF 155
               IVG  A   V+F   +A+K   R+  T        G L   +  + GL  G++ S 
Sbjct: 70  CPAFIVGNTAKAGVRFLGFDAIKNILRDPTT--------GELSGPRGIVAGLGAGLLESV 121

Query: 156 LA-SPIEHVRIRLQTQTGNGNEREF---KGPLDCIRKLVKEKS---LMRGLRPMMLRAGH 208
           +A +P E ++  L     + + +     +G L     LV +K    L RG+ P+ +R   
Sbjct: 122 VAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAA 181

Query: 209 G----LGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMI 264
                LGCY    + +I +     KD+  ++S      G+ SG+V      P+D VK+ +
Sbjct: 182 NQAVRLGCYN-KIKTMIQDYTNSAKDK-PLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRM 239

Query: 265 QTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
           Q+  L + ++ +++ N    ++RE+G+  F+KG  P + R     G  F  +E V+ +LG
Sbjct: 240 QS--LDSSKYSSTI-NCFATVFREEGLKTFWKGATPRLGRLILSGGIVFTIYEKVLVVLG 296

>Scas_662.12
          Length = 308

 Score = 88.2 bits (217), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 137/311 (44%), Gaps = 43/311 (13%)

Query: 37  TRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV------GALDIIRKLVKNEG-- 88
           T + K+I++G   G    ++  P D  KVR+Q  A +       G   +I +L+ N    
Sbjct: 5   TPIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKM 64

Query: 89  ---------VWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQL 139
                    +   Y+G  I ++G     S+ F +  + K +  + N      H + T   
Sbjct: 65  GSQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNY----LHNNNT--- 117

Query: 140 GQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRK-----LVKE-- 192
             +   GL  G+  + L +P+  ++ R+ + +     R  K     IR      L KE  
Sbjct: 118 TIFLTSGLISGISTTLLTNPLWVIKTRIMSTS-----RHHKDSYKSIRHGFKSLLTKEGP 172

Query: 193 KSLMRGLRPMMLRAGHGLGCYFLTYEALIAN---EIKKGKDRSEIASWKLCSYGSLSGVV 249
           K++  GL P +L    G   YF+ Y+ L  +    + K K  +  A+ K+    SLS ++
Sbjct: 173 KAIWMGLLPSLLGVSQG-AIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKML 231

Query: 250 LWLAIYPLDVVKSMIQT-DTLRN--PRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAA 306
             +++YP  ++KS +QT  ++ N  P+       +I  +YR+ GI   +KG +  +LRA 
Sbjct: 232 SVMSVYPFQLLKSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAI 291

Query: 307 PVNGATFVTFE 317
           P    TF  +E
Sbjct: 292 PSTCITFCIYE 302

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 87.0 bits (214), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 139/298 (46%), Gaps = 31/298 (10%)

Query: 41  KDILAGTCGGISQVIVGQPFDTTKVRMQTSA---KSVGALDIIRKLVKN-----EGVWAF 92
           K+I++G   G    IV  P D  K+R+Q +A   K     + +++++K+     + +   
Sbjct: 14  KEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLLKEA 73

Query: 93  YKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHR---DGTLQLGQYYICGLTG 149
           Y+G  I I+G      + FG+    K      ++    Q++   D  +    Y +     
Sbjct: 74  YRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAGAS 133

Query: 150 GVVNSFLASPIEHVRIR-LQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLR 205
           G+  + L +P+  ++ R + T++  G    +   L+ I ++  E   K+  RGL P +  
Sbjct: 134 GLATALLTNPMWVIKTRIMSTKSSQG----YTSILNAITRIYTEEGLKTFWRGLVPSLFG 189

Query: 206 AGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYG-----SLSGVVLWLAIYPLDVV 260
              G   YF  Y+ L   ++K   DR++I   +L +       SLS ++   ++YPL ++
Sbjct: 190 VTQG-ALYFAIYDTL---KLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSVYPLQLL 245

Query: 261 KSMIQTDTLRNPRFKNS-MKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
           K+ +QT   R    +NS M ++I  ++   GI+ F+KG    ++RA P    TF  +E
Sbjct: 246 KTNLQT--FRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVYE 301

>Kwal_23.4731
          Length = 314

 Score = 86.3 bits (212), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 68/305 (22%), Positives = 136/305 (44%), Gaps = 21/305 (6%)

Query: 32  MAKDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQ---TSAKSVGALDIIRKLVKNEG 88
           MA D T + ++I+AG   G    I   P D  K+R+Q    +  S G  ++I+ ++++  
Sbjct: 6   MASDFTPLQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSK 65

Query: 89  VWA-----FYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNT------SRGTQHRDGTL 137
             +      Y+G  + ++G      + FG+    K     +        ++ +  +D  +
Sbjct: 66  ADSNVFREAYRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAM 125

Query: 138 QLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSL-- 195
               Y       G+  + L +PI  ++ R+ + +   +ER +K   D IRK+   +    
Sbjct: 126 GPSLYLASAALSGLGTAILTNPIWVIKTRIMSTSSQASER-YKTTWDGIRKVYAHEGFSG 184

Query: 196 -MRGLRPMMLRAGHGLGCYFLTYEALIANEI-KKGKDRSE-IASWKLCSYGSLSGVVLWL 252
             RGL P +     G   YF  Y++L      ++G    E + + +  +  S+S ++   
Sbjct: 185 FWRGLVPSLFGVAQG-AIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVT 243

Query: 253 AIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGAT 312
           A+YP  ++KS +Q+      R      N++  +++++G+   +KG +  +LRA P    T
Sbjct: 244 AVYPFQLLKSNLQSFAAVEKRDSYRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTCIT 303

Query: 313 FVTFE 317
           F  +E
Sbjct: 304 FCIYE 308

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 85.5 bits (210), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 81/299 (27%), Positives = 136/299 (45%), Gaps = 28/299 (9%)

Query: 41  KDILAGTCGGISQVIVGQPFDTTKVRMQ----TSAKSVGALDIIRKLVKNEGVWAFYKGS 96
           K  +AG   G  +  V  PF+  K R+Q     S  S   L +I    K +G+ + Y G 
Sbjct: 11  KSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTAKTQGIGSVYVGC 70

Query: 97  LIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFL 156
              IVG  A   V+F   + +K   R+  T        G L   +  I GL  G++ S +
Sbjct: 71  PAFIVGNTAKAGVRFLGFDTIKNLLRDPKT--------GELSGPRGVIAGLGAGLLESVV 122

Query: 157 A-SPIEHVRIRLQTQTGNGNEREF---KGPLDCIRKLVKEKSL---MRGLRPMMLRAGHG 209
           A +P E ++  L     +   +     KG L     LV+++ L    RG+ P+ +R    
Sbjct: 123 AVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMRQAAN 182

Query: 210 ----LGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQ 265
               LGCY    + ++ +     KD+  ++S      G+ SG+V      P+D VK+ +Q
Sbjct: 183 QAVRLGCYN-KIKVMVQDYTNAPKDK-PLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQ 240

Query: 266 TDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
           +  L + R+ +++ N    +++E+G+ AF+KG  P + R     G  F  +E V+ +LG
Sbjct: 241 S--LDSKRYSSTI-NCFTTIFKEEGLKAFWKGATPRLGRLFLSGGIVFTVYEKVLTVLG 296

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 85.1 bits (209), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 133/301 (44%), Gaps = 27/301 (8%)

Query: 43  ILAGTCGGISQVIVGQPFDTTKVRMQ----TSAKSVGALDIIRKLVKNEGVWAFYKGSLI 98
           +  G  G +S+ +V  PF+  K+ +Q    T+A + G +  +R++ + EG    ++G+ +
Sbjct: 27  LAGGLAGAVSRTVV-SPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGL 85

Query: 99  PIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLAS 158
             + +    +VQF V EA K+ F   + S+G +     LQ  Q    G   G  +     
Sbjct: 86  NCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQ----LQNWQRLFSGALCGGCSVLATY 141

Query: 159 PIEHVRIRLQTQTGN---------GNEREFKGPLDCIRKLVKE----KSLMRGLRPMMLR 205
           P++ VR RL  QT N          N  +  G  D + +  KE    K L RG+ P  L 
Sbjct: 142 PLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLG 201

Query: 206 AGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQ 265
               +   F  YE      + +G D +    +KL S G+LSG V     YP D+++   Q
Sbjct: 202 VVPYVALNFAVYEQF-KEFMPEGTDNTLANFYKL-SIGALSGGVAQTVTYPFDLLRRRFQ 259

Query: 266 TDTLRNPRFKNSMKNVINHLY---REQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRL 322
              +         K+V++ L    + +G   ++KG    + +  P    +++ +E+V  L
Sbjct: 260 VLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDL 319

Query: 323 L 323
           +
Sbjct: 320 M 320

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 83.2 bits (204), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 132/297 (44%), Gaps = 25/297 (8%)

Query: 32  MAKDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQ---TSAKSVGALDIIRKLVKNEG 88
           M+   T + K++++G   G    ++  P D  KVR+Q   TS    G  ++  ++V ++ 
Sbjct: 1   MSDRYTPLQKEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDL 60

Query: 89  VWA--FYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHR---DGTLQLGQYY 143
                 Y+G  + +VG      + F      K +   +N      HR   D  L    Y 
Sbjct: 61  SLTRELYRGLTVNLVGNTIAWGLYFASYRVAKDYLINYN------HRIRNDKDLSSWMYL 114

Query: 144 ICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLR 200
               + G++ + L +P+  ++ R+ ++  N +    K     +R L+K    + L +GL 
Sbjct: 115 SASASSGMLTTVLTNPLWVIKTRMMSK-ANSDLTSMK----VLRDLIKNDGVQGLWKGLV 169

Query: 201 PMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVV 260
           P ++    G   +F  Y+ L    + K +D  EI + +  +  S+S ++   A+YP  ++
Sbjct: 170 PALVGVSQG-ALHFTCYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLL 228

Query: 261 KSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
           KS +Q+       FK  +  +   +Y   G+  F+KG +  +LR+ P    TF  +E
Sbjct: 229 KSNLQSFQASENDFK--LLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYE 283

>Kwal_47.17321
          Length = 881

 Score = 85.1 bits (209), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 125/291 (42%), Gaps = 19/291 (6%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTS---AKSVGALDIIRKLVKNEGVWAFYKGSLI 98
           + L G+  G        P D  K RMQ     ++   ++D   K+   EG+   Y G   
Sbjct: 503 NFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSREGIRGIYSGLGP 562

Query: 99  PIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLAS 158
            +VGV    +++  VN+ +++   + N           L L    I G   G       +
Sbjct: 563 QLVGVAPEKAIKLTVNDYVRKLLMDEN---------NRLTLPLEIISGAAAGACQVIFTN 613

Query: 159 PIEHVRIRLQTQTGNGNEREFKGPLDC--IRKLVKEKSLMRGLRPMMLRAGHGLGCYFLT 216
           P+E V+IRLQ ++   +    K  L    + K +  + L +GL   ++R       YF T
Sbjct: 614 PLEIVKIRLQVRSEYADSLP-KSQLTALGVVKSLGLRGLYKGLVACLMRDVPFSAIYFPT 672

Query: 217 YEAL---IANEIKKGKD-RSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNP 272
           Y  L   I N   + K+ R+ + +W+L + G L+G+       P DV+K+ +Q D  +  
Sbjct: 673 YAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGE 732

Query: 273 RFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
                + +    + +E+   +FFKG    +LR++P  G T   +E+   + 
Sbjct: 733 TRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYEIFQNMF 783

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 84.0 bits (206), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 72/296 (24%), Positives = 126/296 (42%), Gaps = 37/296 (12%)

Query: 46  GTCGGISQVIVGQPFDTTKVRMQTS---AKSVGALDIIRKLVKNEGVWAFYKGSLIPIVG 102
           G+  G     V  P D  K RMQ     ++   ++D   K+   EG+   Y G    ++G
Sbjct: 525 GSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSREGIRGIYSGLGPQLIG 584

Query: 103 VGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYY--ICGLTGGVVNSFLASPI 160
           V    +++  VN+ M          RG +  D    L  Y+  + G   G       +P+
Sbjct: 585 VAPEKAIKLTVNDYM----------RG-RLMDKHANLKWYFEILSGACAGACQVVFTNPL 633

Query: 161 EHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---------KSLMRGLRPMMLRAGHGLG 211
           E V+IRLQ ++      E+ G  D ++  V           K L +G+   ++R      
Sbjct: 634 EVVKIRLQVRS------EYAG--DVLKSQVTALGVIKQLGIKGLYKGIAACLMRDVPFSA 685

Query: 212 CYFLTYEALIAN----EIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTD 267
            YF TY  L  +    + K  K R+++ +W+L   G L+G+       P DV+K+ +Q D
Sbjct: 686 IYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQID 745

Query: 268 TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
             +       + +    + +E+   +FFKG +  +LR++P  G T   +E+   + 
Sbjct: 746 PRKGETRYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYEIFQNMF 801

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 85/193 (44%), Gaps = 28/193 (14%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRK------LVKNEGVWAFYKG 95
           +IL+G C G  QV+   P +  K+R+Q  ++  G  D+++       ++K  G+   YK 
Sbjct: 615 EILSGACAGACQVVFTNPLEVVKIRLQVRSEYAG--DVLKSQVTALGVIKQLGIKGLYK- 671

Query: 96  SLIPIVGVGACV-------SVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLT 148
                 G+ AC+       ++ F     +K+   +++     Q     L+  +  + G  
Sbjct: 672 ------GIAACLMRDVPFSAIYFPTYAHLKKDVFKYDPKDKKQR--NKLKTWELLVAGGL 723

Query: 149 GGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLR 205
            G+  ++L +P + ++ RLQ     G  R ++G     R ++KE   KS  +G    +LR
Sbjct: 724 AGMPAAYLTTPFDVIKTRLQIDPRKGETR-YEGIFHAARTILKEESFKSFFKGGSARVLR 782

Query: 206 AGHGLGCYFLTYE 218
           +    G     YE
Sbjct: 783 SSPQFGFTLAAYE 795

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 80/183 (43%), Gaps = 22/183 (12%)

Query: 143 YICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGL 199
           +  G   G + + +  PI+ V+ R+Q Q       ++K  +DC  K+      + +  GL
Sbjct: 522 FTLGSIAGCIGATVVYPIDLVKTRMQAQRSFS---QYKNSIDCFAKIFSREGIRGIYSGL 578

Query: 200 RPMMLRAGHGLGCYFLTYEALIANEIKKGK--DRSEIASW--KLCSYGSLSGVVLWLAIY 255
            P ++               L  N+  +G+  D+     W  ++ S G+ +G    +   
Sbjct: 579 GPQLIGVAPEKAI------KLTVNDYMRGRLMDKHANLKWYFEILS-GACAGACQVVFTN 631

Query: 256 PLDVVKSMIQTDTLRNPRFKNSMKNVINHL--YREQGISAFFKGFAPTMLRAAPVNGATF 313
           PL+VVK  +Q   +R+    + +K+ +  L   ++ GI   +KG A  ++R  P +   F
Sbjct: 632 PLEVVKIRLQ---VRSEYAGDVLKSQVTALGVIKQLGIKGLYKGIAACLMRDVPFSAIYF 688

Query: 314 VTF 316
            T+
Sbjct: 689 PTY 691

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 82.8 bits (203), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/289 (25%), Positives = 124/289 (42%), Gaps = 26/289 (8%)

Query: 44  LAGTCGGISQVIVGQPFDTTKVRMQTSAKSV--------GALDIIRKLVKNEGVWAFYKG 95
           L+G   G    +   P D  K R+Q              G +  +  +V++EG    YKG
Sbjct: 82  LSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKG 141

Query: 96  SLIPIV-GVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNS 154
            L+PIV G      + F V E  K+FF            D   Q        +T G  ++
Sbjct: 142 -LVPIVLGYFPTWMIYFSVYEFSKKFFHGI-----FPQFDFVAQ----SCAAITAGAAST 191

Query: 155 FLASPIEHVRIRLQTQTGNG-NEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGL 210
            L +PI  V+ RL  Q+  G +   +KG  D  RKL  +   K+L  GL P +L   H +
Sbjct: 192 TLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLFH-V 250

Query: 211 GCYFLTYEALIA--NEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDT 268
             +F  YE L    +   +  + + I   +L    S+S ++     YP +++++ +Q  +
Sbjct: 251 AIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKS 310

Query: 269 LRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
                 +  +  +I   Y ++G+  F+ GF   ++R  P +  T V+FE
Sbjct: 311 DIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFE 359

>Scas_489.4
          Length = 297

 Score = 80.1 bits (196), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 79/300 (26%), Positives = 134/300 (44%), Gaps = 28/300 (9%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQ----TSAKSVGALDIIRKLVKNEGVWAFYKG 95
           L   +AG   G  +  +  PF+  K R+Q    TS  S   L +I    K +G  A Y G
Sbjct: 11  LHSFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLIYNTAKTQGTGAIYVG 70

Query: 96  SLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSF 155
               IVG  A   ++F   + +K   R+  T        G L   +  + GL  G++ S 
Sbjct: 71  CPAFIVGNTAKAGIRFLGFDTIKNMLRDPVT--------GELSGPRGVVAGLGAGLLESV 122

Query: 156 LA-SPIEHVRIRL---QTQTGNGNEREFKGPLDCIRKLVKEKSLM---RGLRPMMLRAGH 208
           +A +P E ++  L   +       +   +G L     LV+++ +M   RG+ P+ +R   
Sbjct: 123 VAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQAA 182

Query: 209 G----LGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMI 264
                LGCY    + ++ +     KDR  ++S      G+ SGVV      P+D VK+ +
Sbjct: 183 NQAVRLGCYN-KIKTMVQDYTNAPKDR-PLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRM 240

Query: 265 QTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
           Q+  L   ++ +++ N    +++E+G+  F+KG  P + R     G  F  +E V+  LG
Sbjct: 241 QS--LDATKYTSTV-NCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVLVFLG 297

>Kwal_55.20868
          Length = 380

 Score = 80.9 bits (198), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 75/303 (24%), Positives = 123/303 (40%), Gaps = 34/303 (11%)

Query: 44  LAGTCGGISQVIVGQPFDTTKVRMQT-------SAKSVGALDIIRKLVKNEGVWAFYKGS 96
           L+G   G    +   P D  K R+Q        S    G L  +  ++++EG    YKG 
Sbjct: 80  LSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKG- 138

Query: 97  LIPIV-GVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSF 155
           L+PI+ G      + F V E  K+ +     S              +    LT G V++ 
Sbjct: 139 LVPIIMGYFPTWMIYFSVYERSKKLYPRIFPS---------FDFISHSASALTAGTVSTI 189

Query: 156 LASPIEHVRIRLQTQTG-NGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGLG 211
           L +P+  V+ RL  QT  N N   +    D   K+      ++   GL P +L   H + 
Sbjct: 190 LTNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGLFH-VA 248

Query: 212 CYFLTYEAL-IANEIKKGKDRSEIASWKLCSY---GSLSGVVLWLAIYPLDVVKSMIQ-- 265
            +F  YE L +         R+E  +  L       S S +V     YP +++++ +Q  
Sbjct: 249 IHFPIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQLK 308

Query: 266 ---TDTLR--NPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVM 320
              TD L       ++ +  +I H Y+ +G+  F+ GF   + R  P +  T V+FE   
Sbjct: 309 AYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFEYFR 368

Query: 321 RLL 323
           + L
Sbjct: 369 KYL 371

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 79.0 bits (193), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/301 (23%), Positives = 125/301 (41%), Gaps = 34/301 (11%)

Query: 44  LAGTCGGISQVIVGQPFDTTKVRMQT---------SAKSVGALDIIRKLVKNEGVWAFYK 94
           ++G   G    ++  PFD  K R+Q          S    G       + K+EG    YK
Sbjct: 43  ISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYK 102

Query: 95  GSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNS 154
           G    ++G    + + F V +  +++  +            +          +T G +++
Sbjct: 103 GLQPTVLGYIPTLMIYFSVYDFCRKYSVDIFPHSPFLSNASS---------AITAGAIST 153

Query: 155 FLASPIEHVRIRLQTQTGNGN-EREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGL 210
              +PI  V+ RL  QTG G     +KG +D  RK++++   K+L  GL P +L     +
Sbjct: 154 VATNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALL-GMLNV 212

Query: 211 GCYFLTYEALIANEIKKGKDRSEIAS--------WKLCSYGSLSGVVLWLAIYPLDVVKS 262
              F  YE L   +I+ G   S   S         KL     LS +V     YP +++++
Sbjct: 213 AIQFPLYENL---KIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRT 269

Query: 263 MIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRL 322
            +Q  +      +  +  +I   YR++G + F+ GFA  ++R  P    T V+FE   + 
Sbjct: 270 RMQLKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEYSKKY 329

Query: 323 L 323
           L
Sbjct: 330 L 330

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 77.8 bits (190), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 82/309 (26%), Positives = 137/309 (44%), Gaps = 30/309 (9%)

Query: 32  MAKDSTRV--LKDILAGTCGGISQVIVGQPFDTTKVRMQ----TSAKSVGALDIIRKLVK 85
           M+KDS +V   K  +AG   G  +  +  PF+  K R+Q    +S  S   L +I    K
Sbjct: 1   MSKDSKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTAK 60

Query: 86  NEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYIC 145
            +GV A Y G    IVG  A  + +F   + ++   ++  T        G L   +  + 
Sbjct: 61  TQGVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKKT--------GELSGPRGVLA 112

Query: 146 GLTGGVVNSFLA-SPIEHVRIRLQTQTGNGNEREFKGPLDCIRK---LVKE---KSLMRG 198
           GL  G++ S +A +P E ++  L     +   +         R    LVK+   + L  G
Sbjct: 113 GLGAGLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGG 172

Query: 199 LRPMMLRAGHG----LGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAI 254
           + P+ +R        LGCY    + L+ +     KD+  + S      G+ SGVV   A 
Sbjct: 173 VLPVSMRQAANQAVRLGCYN-KIKVLVQDYTGAPKDK-PLTSGLTFIVGAFSGVVTVYAT 230

Query: 255 YPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFV 314
            P+D VK+ +Q+  L   ++ +++ N    +Y+E+G+  F+KG  P + R     G  F 
Sbjct: 231 MPIDTVKTRMQS--LTASKYSSTL-NCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFT 287

Query: 315 TFELVMRLL 323
            +E V+  L
Sbjct: 288 IYENVLLYL 296

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 78.2 bits (191), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 79/319 (24%), Positives = 138/319 (43%), Gaps = 67/319 (21%)

Query: 55  IVGQPFDTTKVRMQTS---------AKSVG----------------ALDIIRKLVKNEGV 89
           +V  PFD  K R+Q+          AKS+G                   II  + +NEG 
Sbjct: 68  VVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGF 127

Query: 90  WAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQ-----YYI 144
            + +KG    +VGV    S+ F      K  + +            TL  GQ     + +
Sbjct: 128 RSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSK------------TLNNGQEAVWIHLM 175

Query: 145 CGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLM---RGLRP 201
              T G   S   +PI  V+ RLQ     G  +++K   DC++ +V+++ ++   +GL  
Sbjct: 176 AAATAGWATSTATNPIWLVKTRLQLDKA-GTTKKYKNSWDCLKNVVQKEGILGLYKGLSA 234

Query: 202 MMLRAGHGLGCYFLTYEALIA-------------NEIKKGKDRSEIASWKLCSYGSLSGV 248
             L +  G+  + L YE +               +E++K     +I  W  C     +G+
Sbjct: 235 SYLGSVEGILQWVL-YEQMKHIIKQRSMEKFGNISEVEKSTS-DKIKEW--CQRSGSAGL 290

Query: 249 VLWLA---IYPLDVVKSMIQTDTLRNPRFKNS-MKNVINHLYREQGISAFFKGFAPTMLR 304
             ++A    YP +VV++ ++   L N + K + +   I  + +E+G+++ + G  P +LR
Sbjct: 291 AKFVASIITYPHEVVRTRLRQAPLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLLR 350

Query: 305 AAPVNGATFVTFELVMRLL 323
             P +   F T+ELV+RLL
Sbjct: 351 TVPNSIIMFGTWELVIRLL 369

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 77.4 bits (189), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 76/307 (24%), Positives = 132/307 (42%), Gaps = 35/307 (11%)

Query: 35  DSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGA------LDIIRKLVKNEG 88
           D T+V    ++G   G    I+  P D  K R+Q      G       +  +  ++++EG
Sbjct: 82  DDTQVTA--VSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEG 139

Query: 89  VWAFYKGSLIPIV-GVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGL 147
           V   YKG L PIV G      + F V E  K+ +  +       H              L
Sbjct: 140 VAGLYKG-LAPIVLGYFPTWMLYFSVYEKCKQRYPSYLPGGFVSHAAS----------AL 188

Query: 148 TGGVVNSFLASPIEHVRIRLQTQTG-NGNEREFKGPLDCIRKLVKEKSL---MRGLRPMM 203
           T G +++ L +PI  V+ RL  Q+  + +   ++  LD  RK+ + + L     GL P +
Sbjct: 189 TAGAISTALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSL 248

Query: 204 LRAGHGLGCYFLTYEALIA-----NEIKKGK--DRSEIASWKLCSYGSLSGVVLWLAIYP 256
               H +  +F  YE L            G+  D +++   +L     LS VV  +  YP
Sbjct: 249 FGLFH-VAIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYP 307

Query: 257 LDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTF 316
            +++++ +Q   +R+     S+ N++  +   +G   F+ GFA  ++R  P +  T V+F
Sbjct: 308 HEILRTRMQ---VRHSGVPPSLLNLLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSF 364

Query: 317 ELVMRLL 323
           E   + L
Sbjct: 365 EYFRKYL 371

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 77.8 bits (190), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/315 (22%), Positives = 129/315 (40%), Gaps = 39/315 (12%)

Query: 44  LAGTCGGISQVIVGQPFDTTKV----RMQTSAKSVGALDII------------------- 80
           +AG C G+       PFD  KV    R   S+  + + D +                   
Sbjct: 204 IAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIKA 263

Query: 81  -RKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQL 139
              L +  G+ AFY G+ + +V V    +++FG  E  KR        + T      L  
Sbjct: 264 ATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSE----LSR 319

Query: 140 GQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE------- 192
              YI G  GGV   F   PI+ ++ R+Q    N N ++    L   +++ ++       
Sbjct: 320 LSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLFY 379

Query: 193 KSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKG---KDRSEIASWKLCSYGSLSGVV 249
           + +  G+  +   A   LG +    +  I  E KK    +D   I++  +   G+ SG V
Sbjct: 380 RGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTV 439

Query: 250 LWLAIYPLDVVKSMIQTD-TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPV 308
               +YP++++++ +Q   T  +P   N   +V+    + +G    FKG  P + +  P 
Sbjct: 440 GATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCPA 499

Query: 309 NGATFVTFELVMRLL 323
              +++ +E + RL+
Sbjct: 500 VSISYLCYENLKRLM 514

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 89/199 (44%), Gaps = 12/199 (6%)

Query: 34  KDSTRV--LKDILAGTCGGISQVIVGQPFDTTKVRMQTSA------KSVGALDIIRKLVK 85
           KD++ +  L   +AG  GG++      P DT K R+Q +       KS   L   +++ +
Sbjct: 312 KDTSELSRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQ 371

Query: 86  NEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYI- 144
             G+  FY+G  I ++G+    ++  G   A+K+++ +    +     D  +      + 
Sbjct: 372 QGGIRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLP 431

Query: 145 CGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRP 201
            G   G V + L  PI  +R RLQ Q    +   + G  D ++K ++    + L +GL P
Sbjct: 432 MGAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVP 491

Query: 202 MMLRAGHGLGCYFLTYEAL 220
            + +    +   +L YE L
Sbjct: 492 NLAKVCPAVSISYLCYENL 510

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 34/83 (40%), Gaps = 6/83 (7%)

Query: 46  GTCGGISQVIVGQPFDTTKVRMQTSAKSV------GALDIIRKLVKNEGVWAFYKGSLIP 99
           G   G     +  P +  + R+Q            G  D+++K ++ EG    +KG +  
Sbjct: 433 GAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPN 492

Query: 100 IVGVGACVSVQFGVNEAMKRFFR 122
           +  V   VS+ +   E +KR  +
Sbjct: 493 LAKVCPAVSISYLCYENLKRLMK 515

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/306 (21%), Positives = 135/306 (44%), Gaps = 32/306 (10%)

Query: 37  TRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV-----GALDIIRKLVKNEG--- 88
           T + K++++G   G    +V  P D  KVR+Q SA S      G   +I++++++     
Sbjct: 7   TPLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSG 66

Query: 89  ---VWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRG-TQHR----DGTLQLG 140
                  Y+G  I + G      V FG+    K    +     G TQ +    D  +   
Sbjct: 67  RSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSL 126

Query: 141 QYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMR 197
            Y   G + G++ + L +PI  ++ R+ + T  G +  +    + +++L++    + L +
Sbjct: 127 IYLSAGASSGLMTAILTNPIWVIKTRIMS-TSKGAQGAYTSMYNGVQQLLRTDGFQGLWK 185

Query: 198 GLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDR------SEIASWKLCSYGSLSGVVLW 251
           GL P +     G   YF  Y+ L   ++++ ++       + + + ++ S G +  V L 
Sbjct: 186 GLVPALFGVSQG-ALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTL- 243

Query: 252 LAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGA 311
             +YP  ++KS +Q+      +F+  +  +I  +    G    +KG +  ++RA P    
Sbjct: 244 --VYPFQLLKSNLQSFRANEQKFR--LFPLIKLIIANDGFVGLYKGLSANLVRAIPSTCI 299

Query: 312 TFVTFE 317
           TF  +E
Sbjct: 300 TFCVYE 305

>Kwal_27.12081
          Length = 369

 Score = 75.5 bits (184), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 81/311 (26%), Positives = 137/311 (44%), Gaps = 54/311 (17%)

Query: 55  IVGQPFDTTKVRMQT--------------SAKSVGA--------LDIIRKLVKNEGVWAF 92
           IV  PFD  K R+Q+              S+  V +          II  L K EG  + 
Sbjct: 68  IVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSL 127

Query: 93  YKGSLIPIVGVGACVSVQFGVNEAMKRFF-REWNTSRGTQHRDGTLQLGQYYICGLTGGV 151
           +KG    +VGV    S+ F      K+ + R +N        +G      + I   T G 
Sbjct: 128 FKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFN--------NGEEAPWIHLISAATAGW 179

Query: 152 VNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKS---LMRGLRPMMLRAGH 208
             S   +PI  ++ RLQ     G+ R++K   DC++ +++++    L +GL    L +  
Sbjct: 180 ATSTATNPIWLIKTRLQLDKA-GHTRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLGSVE 238

Query: 209 GLGCYFLTYEALIA----------NEIKKG-KDRSE-IASWKLCSYGSLSGVVLWLA--- 253
           G+   +L YE +              I +G K+ SE I  W  C     +G+  +LA   
Sbjct: 239 GI-LQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEW--CQRSGSAGLAKFLASIV 295

Query: 254 IYPLDVVKSMIQTDTLRNPRFKNS-MKNVINHLYREQGISAFFKGFAPTMLRAAPVNGAT 312
            YP +VV++ ++   L N + K + +      + +E+G+++ + G  P +LR  P +   
Sbjct: 296 TYPHEVVRTRLRQAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHLLRTVPNSIIM 355

Query: 313 FVTFELVMRLL 323
           F T+ELV++LL
Sbjct: 356 FGTWELVIKLL 366

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 74.3 bits (181), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 129/302 (42%), Gaps = 34/302 (11%)

Query: 43  ILAGTCGGISQVIVGQPFDTTKVRMQ----TSAKSVGALDIIRKLVKNEGVWAFYKGSLI 98
           +  G  G +S+ +V  PF+  K+ +Q    T++ + G    IR++   EG    ++G+ +
Sbjct: 27  LAGGVAGAVSRTVV-SPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGL 85

Query: 99  PIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLAS 158
             + +    +VQF V EA K+     N + G +    T +L    +CG    VV ++   
Sbjct: 86  NCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCG-GCSVVATY--- 141

Query: 159 PIEHVRIRLQTQTGN------GNEREFKGPLDCIRKLVKE--------KSLMRGLRPMML 204
           P++ ++ RL  QT N         +    P   I +L+ E        + L RG+ P  L
Sbjct: 142 PLDLIKTRLSIQTANLSSLNRSKAKSISKP-PGIWQLLSETYRLEGGLRGLYRGVWPTSL 200

Query: 205 RAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSY----GSLSGVVLWLAIYPLDVV 260
                +   F  YE L    +     +    SWK   Y    G++SG V     YP D++
Sbjct: 201 GVVPYVALNFAVYEQLREFGVNSSDAQ---PSWKSNLYKLTIGAISGGVAQTITYPFDLL 257

Query: 261 KSMIQTDTLRNPRFKNSMKNVINHLY---REQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
           +   Q   +          +V + L    R +G+S ++KG A  + +  P    +++ +E
Sbjct: 258 RRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317

Query: 318 LV 319
           +V
Sbjct: 318 VV 319

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 39/96 (40%), Gaps = 9/96 (9%)

Query: 37  TRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSA--------KSVGALDIIRKLVKNEG 88
           + + K  +    GG++Q I   PFD  + R Q  A        +     D +  + + EG
Sbjct: 232 SNLYKLTIGAISGGVAQTIT-YPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEG 290

Query: 89  VWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREW 124
           V  +YKG    +  V    +V + V E +    R W
Sbjct: 291 VSGYYKGLAANLFKVVPSTAVSWLVYEVVCDSVRNW 326

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 77/306 (25%), Positives = 131/306 (42%), Gaps = 28/306 (9%)

Query: 34  KDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQ----TSAKSVGALDIIRKLVKNEGV 89
           K +       LAG+  G  +  +  PF+  K R+Q     S  S   L +I    KN G+
Sbjct: 85  KPAVDPFHSFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTGKNYGI 144

Query: 90  WAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTG 149
            + Y G    IVG  A   ++F   + +K   R+  T   +  R          + GL  
Sbjct: 145 SSIYVGCPAFIVGNTAKAGIRFLGFDTIKNLLRDKKTGELSGFRG--------VVAGLGA 196

Query: 150 GVVNSFLA-SPIEHVRIRL---QTQTGNGNEREFKGPLDCIRKLVKEKS---LMRGLRPM 202
           G++ S +A +P E ++  L   +       +   KG +    KL+ ++    L RG+ P+
Sbjct: 197 GLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPV 256

Query: 203 MLRAGHG----LGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLD 258
            +R        LGCY    + L+ +     KD+  ++S      G+ SG+V      P+D
Sbjct: 257 SMRQAANQAVRLGCYN-KIKTLVQDYTNVPKDK-PLSSGLTFIVGAFSGIVTVYTTMPID 314

Query: 259 VVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFEL 318
            VK+ +Q+    N    +S  N    +++E+G+  F+KG  P + R     G  F  +E 
Sbjct: 315 TVKTRMQS---LNAGQYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYEK 371

Query: 319 VMRLLG 324
           V+ +L 
Sbjct: 372 VLTVLA 377

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 72.8 bits (177), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 78/323 (24%), Positives = 129/323 (39%), Gaps = 67/323 (20%)

Query: 44  LAGTCGGISQVIVGQPFDTTKVRMQTSA--------KSVGAL-------------DIIRK 82
           L+G   G    ++  P D  K R+Q           + VG++               +  
Sbjct: 108 LSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTT 167

Query: 83  LVKNEGVWAFYKGSLIPIV-GVGACVSVQFGVNEAMK-RFFREWNTSRGTQHRDGTLQLG 140
           +V++E +   YKG ++PIV G      + F V E  K  + R +N S    H        
Sbjct: 168 IVRDESIRGLYKG-IVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLSHS------- 219

Query: 141 QYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNE--REFKGPLDCIRKLVKE---KSL 195
              +  LT G +++ L +PI  V+ RL  Q+G   +    +K  LD   K+ K    KS 
Sbjct: 220 ---MSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSF 276

Query: 196 MRGLRPMMLRAGHGLGCYFLTYEALI---------------------ANEIKKGKDRSEI 234
             GL P +    H +  +F  YE L                      +N    G    ++
Sbjct: 277 YSGLIPSLFGLLH-VAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQL 335

Query: 235 ASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAF 294
               + S GS   ++     YP +++++ +Q  +   P    S+K++I   Y ++GI  F
Sbjct: 336 GRLIVASCGS--KMIASTLTYPHEILRTRLQLKSDMKP----SIKSIIRTTYAKEGIRGF 389

Query: 295 FKGFAPTMLRAAPVNGATFVTFE 317
           + GF   M R  P +  T V+FE
Sbjct: 390 YSGFLTNMFRTVPASAITLVSFE 412

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 71.6 bits (174), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 65/297 (21%), Positives = 131/297 (44%), Gaps = 21/297 (7%)

Query: 32  MAKDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSA---KSVGALDIIRKLVKNEG 88
           M  + T + +++++G   G    I   P D  K+R+Q SA    +     +IR + + + 
Sbjct: 1   MGHELTSLQREVISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGLIRDIFERQQ 60

Query: 89  VWA--FYKGSLIPIVGVGACVSVQFGVNEAMKRF-FREWNTSRGTQHRDGTLQLGQYYIC 145
            W    Y+G  + ++G     ++ FG     K    R       T   D  L    Y + 
Sbjct: 61  -WGRELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLA 119

Query: 146 GLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLM---RGLRPM 202
             + G+  + L +PI  ++ R+   +  G    +K   D + KL + + ++   RG+ P 
Sbjct: 120 AGSSGIATAVLTNPIWVIKTRIMATSRAG---PYKSTFDGVYKLYQTEGVLAFWRGVVPS 176

Query: 203 MLRAGHGLGCYFLTYEALIANEIKKGKDRSE--IASWKLCSYGSLSGVVLWLAIYPLDVV 260
           +L    G   YF  Y+ L  + +    D++E  ++  ++     +S ++   ++YP  ++
Sbjct: 177 LLGVSQG-AIYFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPFQLL 235

Query: 261 KSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
           KS +Q     +    + +  ++  +Y  +GI  F++G +  +LRA P    TF  +E
Sbjct: 236 KSKLQ-----DFGAPSGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYE 287

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 71.2 bits (173), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/256 (22%), Positives = 114/256 (44%), Gaps = 15/256 (5%)

Query: 80  IRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQL 139
           ++ L +  G+ AFY G+ + ++ V    S++FG  E  K+   +    R T+     L  
Sbjct: 292 VKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKD----LSK 347

Query: 140 GQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGN----GNEREFKGPLDCIRK---LVKE 192
              YI G   G+   F   PI+ ++ R+Q    +    GN   F+   D  R+    +  
Sbjct: 348 FSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFREGGLRLFY 407

Query: 193 KSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKK---GKDRSEIASWKLCSYGSLSGVV 249
           + +  G+  +   A   LG +    +  IA + K     +D+  +++  +   G+ SG V
Sbjct: 408 RGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFSGTV 467

Query: 250 LWLAIYPLDVVKSMIQTD-TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPV 308
               +YP++++++ +Q   T  +P   N  K+V+      +G    FKG  PT+ +  P 
Sbjct: 468 GASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPTLAKVCPA 527

Query: 309 NGATFVTFELVMRLLG 324
              +++ +E + + + 
Sbjct: 528 VSISYLCYENLKKFMN 543

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 45/100 (45%), Gaps = 19/100 (19%)

Query: 243 GSLSGVVLWLAIYPLDVVKSMI-------------QTDTL-RNP-----RFKNSMKNVIN 283
           G +SGV+      P D +K  +             +TD L +NP     +  + +   + 
Sbjct: 234 GGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAKAVK 293

Query: 284 HLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
            LYR+ GI AF+ G    +++  P +   F +FE+  +++
Sbjct: 294 SLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIM 333

 Score = 28.5 bits (62), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 33/81 (40%), Gaps = 6/81 (7%)

Query: 46  GTCGGISQVIVGQPFDTTKVRMQTSAKSV------GALDIIRKLVKNEGVWAFYKGSLIP 99
           G   G     V  P +  + R+Q            G  D++ K ++ EG    +KG +  
Sbjct: 461 GAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPT 520

Query: 100 IVGVGACVSVQFGVNEAMKRF 120
           +  V   VS+ +   E +K+F
Sbjct: 521 LAKVCPAVSISYLCYENLKKF 541

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/296 (23%), Positives = 134/296 (45%), Gaps = 27/296 (9%)

Query: 44  LAGTCGGISQVIVGQPFDTTKVRMQ----TSAKSVGALDIIRKLVKNEGVWAFYKGSLIP 99
           +AG  GG     V  P +  K+ +Q    T+A + G +  ++++ K EGV   ++G+ I 
Sbjct: 21  VAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGIN 80

Query: 100 IVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASP 159
            + +    +VQ+ V E  K   R ++  +    +   L+  +  + G  GG  +  +  P
Sbjct: 81  CLRIFPYSAVQYAVYEFCKT--RVFHVGQSGHEQ---LRSWERLVGGALGGGASVLVTYP 135

Query: 160 IEHVRIRLQTQTGN---------GNEREFKGPLDCIRKLVKE----KSLMRGLRPMMLRA 206
           ++ VR RL  QT N          + R   G ++ +R++ +E    +   RG+ P  L  
Sbjct: 136 LDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGV 195

Query: 207 GHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQT 266
              +   F  YE L A  I    D   +A+ KL + G++SG +    +YP D+++   Q 
Sbjct: 196 VPFVALNFALYERLKA-LIPHDYDAGSVAAAKL-AIGAVSGGIAQTVVYPFDLLRRRFQV 253

Query: 267 DTLRNPRFKNSMKNVINHLY---REQGISAFFKGFAPTMLRAAPVNGATFVTFELV 319
            T+          +V + L+   R++G+  ++KG    +++  P     +  +EL+
Sbjct: 254 LTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 84/196 (42%), Gaps = 17/196 (8%)

Query: 143 YICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGL 199
           ++ G  GG V+  + SP+E V+I LQ Q+         G +  ++++ KE   K L RG 
Sbjct: 20  FVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYN--GGLVHAVKQVYKEEGVKGLFRGN 77

Query: 200 RPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSE-IASWKLCSYGSLSGVVLWLAIYPLD 258
               LR        +  YE         G+   E + SW+    G+L G    L  YPLD
Sbjct: 78  GINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTYPLD 137

Query: 259 VVKSMIQTDTLRNPRFKNSMKN----------VINHLYREQ-GISAFFKGFAPTMLRAAP 307
           +V++ +   T    +   S  +          ++  ++RE+ G+  +++G  PT L   P
Sbjct: 138 LVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVP 197

Query: 308 VNGATFVTFELVMRLL 323
                F  +E +  L+
Sbjct: 198 FVALNFALYERLKALI 213

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/190 (17%), Positives = 79/190 (41%), Gaps = 29/190 (15%)

Query: 55  IVGQPFDTTKVRMQTSAKSV---------------GALDIIRKLVKNE-GVWAFYKGSLI 98
           +V  P D  + R+     ++               G ++++R++ + E G+  +Y+G   
Sbjct: 131 LVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYP 190

Query: 99  PIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLAS 158
             +GV   V++ F + E +K             +  G++   +  I  ++GG+  + +  
Sbjct: 191 TSLGVVPFVALNFALYERLKALIPH-------DYDAGSVAAAKLAIGAVSGGIAQT-VVY 242

Query: 159 PIEHVRIRLQTQTGNGNEREFK--GPLDCIRKLVKEKSL---MRGLRPMMLRAGHGLGCY 213
           P + +R R Q  T   +E  F+     D +  + +++ L    +GL   +++    +   
Sbjct: 243 PFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQ 302

Query: 214 FLTYEALIAN 223
           +  YE +  N
Sbjct: 303 WFVYELISEN 312

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 69.7 bits (169), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 66/303 (21%), Positives = 123/303 (40%), Gaps = 37/303 (12%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTSA----KSVGALDIIRKLVKNEGVWAFYKGSL 97
            ++AG+  G+   +   P DT K+R Q       K  G    +R ++K EG+ A +KG++
Sbjct: 21  SVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYKGIASTVRTIMKEEGLRALWKGNI 80

Query: 98  IPIVGVGACVSVQFGVNEAMKRFFREWNTS--RGTQHRDGTLQLGQYYICGLTGGVVNSF 155
                     +VQFG   +   F   W+    R +Q        GQ    G   G+ +S 
Sbjct: 81  PATAMYVVYGAVQFG---SYSWFNNVWSAKFPRFSQQ-------GQTLTVGALAGMTSSV 130

Query: 156 LASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE--KSLMRGLRPMMLRAGHGLGCY 213
           ++ P++ +R RL     N          +C +  + E  +    G+   M          
Sbjct: 131 VSYPLDLLRTRL---IANRTSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLSTAIM 187

Query: 214 FLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQT------- 266
           FLTYE +  N + +  ++   +     S G ++G V    ++P+D ++  +Q        
Sbjct: 188 FLTYETV--NIVCENHEKEFWSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQVMNSKRTV 245

Query: 267 ------DTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVM 320
                       R+K+S   +I  + R++G+SA ++G    + ++ P    +   +E  M
Sbjct: 246 HFTKFPAVYHEYRYKSSTA-IIYKILRQEGVSALYRGLTMGLCKSVPTTAISLFVYERTM 304

Query: 321 RLL 323
            L 
Sbjct: 305 DLF 307

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 117/279 (41%), Gaps = 17/279 (6%)

Query: 46  GTCGGISQVIVGQPFDTTKVRMQTSA-KSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVG 104
           G   GI  V+   P D TKVR+Q +       + ++R ++KNEG+   Y G    ++   
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQAAPIPKPTIVQMLRSILKNEGIVGLYAGLSASLLRQC 72

Query: 105 ACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVR 164
              + +FG+ +A+K      +      +      LG   + G  GG+  +F     + + 
Sbjct: 73  TYTTARFGMYDALKEHVIPRDKLTNMWY-----LLGASMVSGALGGLAGNF----ADLIN 123

Query: 165 IRLQTQTGN--GNEREFKGPLDCIRKLVKE---KSL-MRGLRPMMLRAGHGLGCYFLTYE 218
           IR+Q  +       R +K  +D + K+ K    KSL + G +P M+R         +TY+
Sbjct: 124 IRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVVTYD 183

Query: 219 ALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSM 278
                 + K     +  S  L S   L+G V      P DV+K+++     +     +S 
Sbjct: 184 MFKNFLVTKYNMDPKKNSTHLTS-SLLAGFVATTVCSPADVIKTIVMNAHKKPGHNHDSS 242

Query: 279 KNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
             ++     ++G S  F+G+ P+  R AP     F   E
Sbjct: 243 FKILMEAINKEGPSFMFRGWVPSFTRLAPFTMLIFFAME 281

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 80/195 (41%), Gaps = 19/195 (9%)

Query: 138 QLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGP--LDCIRKLVKEKS- 194
           Q+   +  G   G+       P++  ++RLQ             P  +  +R ++K +  
Sbjct: 5   QVKYPWWYGGAAGIFAVMNTHPLDLTKVRLQAA-------PIPKPTIVQMLRSILKNEGI 57

Query: 195 --LMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWL 252
             L  GL   +LR        F  Y+AL  + I + K  +    W L     +SG +  L
Sbjct: 58  VGLYAGLSASLLRQCTYTTARFGMYDALKEHVIPRDKLTN---MWYLLGASMVSGALGGL 114

Query: 253 AIYPLDVVKSMIQTDTLRNPRFKNSMKNVIN---HLYREQGI-SAFFKGFAPTMLRAAPV 308
           A    D++   +Q D+      + + KN I+    +Y+ +G  S F  G+ P M+R   +
Sbjct: 115 AGNFADLINIRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLM 174

Query: 309 NGATFVTFELVMRLL 323
             +  VT+++    L
Sbjct: 175 TASQVVTYDMFKNFL 189

>Scas_578.3*
          Length = 524

 Score = 70.1 bits (170), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 111/252 (44%), Gaps = 21/252 (8%)

Query: 80  IRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQL 139
           IR L +  G+ AFY G+ + +  +    S++FG  E  KR     +  +        L  
Sbjct: 271 IRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVND----LSK 326

Query: 140 GQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGL 199
            Q Y+ G   GV+      PI+ ++ R+Q     GN +     +   +++ KE  +    
Sbjct: 327 LQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRVFY 386

Query: 200 RPMMLRAGHGLGCY------FLTYEALIANEIKKGKDRSEIASWK-LCSY------GSLS 246
           R ++L A   LG +        T+ AL    IK+   +  I     + SY      G+ S
Sbjct: 387 RGVLLGA---LGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFS 443

Query: 247 GVVLWLAIYPLDVVKSMIQTD-TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRA 305
           G V   A+YP++++++ +Q   T  +P      ++V     + +G+  F+KG  PT+++ 
Sbjct: 444 GTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTLVKV 503

Query: 306 APVNGATFVTFE 317
            P     ++ +E
Sbjct: 504 CPAVSIGYLCYE 515

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 82/193 (42%), Gaps = 10/193 (5%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQTSA------KSVGALDIIRKLVKNEGVWAFY 93
           L+  +AG   G+   I   P DT K R+Q +        +   +   +++ K  G+  FY
Sbjct: 327 LQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRVFY 386

Query: 94  KGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSR-GTQHRDGTLQLGQYYICGLTGGVV 152
           +G L+  +G+    ++  G   A+K+++ +  + +     +D  L        G   G V
Sbjct: 387 RGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGTV 446

Query: 153 NSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSL---MRGLRPMMLRAGHG 209
            +    PI  +R RLQ Q    +   + G  D   + +K + +    +GL P +++    
Sbjct: 447 GATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTLVKVCPA 506

Query: 210 LGCYFLTYEALIA 222
           +   +L YE   A
Sbjct: 507 VSIGYLCYEKFKA 519

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 47/99 (47%), Gaps = 17/99 (17%)

Query: 243 GSLSGVVLWLAIYPLDVVKSMI--QTD---TLRNPR------------FKNSMKNVINHL 285
           G LSGV+      PLD +K  +  +TD   TL NP+             ++ +   I  L
Sbjct: 215 GGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKAIRSL 274

Query: 286 YREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
           YR+ G+ AF+ G   ++ +  P +   F TFEL  RL+ 
Sbjct: 275 YRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMA 313

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 90/209 (43%), Gaps = 36/209 (17%)

Query: 142 YYICGLTGGVVNSFLASPIEHVRIRLQTQTGNG---------------NEREFKGP-LDC 185
           Y+I G   GV++    +P++ +++ L  +T                  N  + + P +  
Sbjct: 211 YFIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKA 270

Query: 186 IRKLVKEKSLMRGLRPMMLRAGHGLGCY---------FLTYEA---LIANEIKKGKDRSE 233
           IR L ++     GLR   +  G+GL  +         F T+E    L+AN +   K  ++
Sbjct: 271 IRSLYRQG----GLRAFYV--GNGLSVFKICPESSIKFGTFELAKRLMAN-LSGDKLVND 323

Query: 234 IASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLR-NPRFKNSMKNVINHLYREQGIS 292
           ++  +    G ++GV+  ++IYP+D +K  IQ   L  N +    + +    +Y+E GI 
Sbjct: 324 LSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIR 383

Query: 293 AFFKGFAPTMLRAAPVNGATFVTFELVMR 321
            F++G     L   P       TF  + +
Sbjct: 384 VFYRGVLLGALGIFPYAALDLGTFSALKK 412

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 116/284 (40%), Gaps = 20/284 (7%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIV 101
            +L+G   G S  +V  P DT K R+Q                 N G    Y+G    +V
Sbjct: 7   SLLSGAAAGTSTDLVFFPIDTIKTRLQAKGG----------FFANGGYKGIYRGLGSAVV 56

Query: 102 GVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIE 161
                 S+ F   + MK   R + +   +Q  +  +    + +    G +    +  P E
Sbjct: 57  ASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVRVPAE 116

Query: 162 HVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALI 221
            V+ R Q  + N + +  +  L    K    K+L RG    ++R        F  YE L 
Sbjct: 117 VVKQRTQVHSTNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQFPLYEYL- 175

Query: 222 ANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNV 281
                K   +S++  WK    GS++G +      PLD +K+ +  +     +   S+ +V
Sbjct: 176 KKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLN-----KTTASLGSV 230

Query: 282 INHLYREQGISAFFKGFAP-TMLRAAPVNGATFV-TFELVMRLL 323
           I  +YRE+G + FF G  P TM  +A   GA F+  +E V  LL
Sbjct: 231 IIRIYREEGPAVFFSGVGPRTMWISA--GGAIFLGMYETVHSLL 272

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 69.3 bits (168), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 70/329 (21%), Positives = 136/329 (41%), Gaps = 43/329 (13%)

Query: 32  MAKDSTRVLKDILAGTCGGISQVIVGQPFDTTKV----RMQTSAKSVGALDII------- 80
           +  D  R     +AG C G+       PFD  KV    R   S+  + + D +       
Sbjct: 188 LINDFIRGFGFFIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNA 247

Query: 81  -------------RKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTS 127
                          L +  G+ AFY G+ + ++ V    +++FG  E  K+        
Sbjct: 248 DISKIKSPLIKAATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHL--- 304

Query: 128 RGTQHRDGTLQLGQY--YICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDC 185
            G  H   T +L ++  YI G  GGVV  F   PI+ ++ R+Q    +   +  +  +  
Sbjct: 305 EGVHH---TSELSKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLIST 361

Query: 186 IRKLVKE-------KSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGK---DRSEIA 235
            R++ ++       + +  G+  +   A   LG +    +  IA + K      D+  I+
Sbjct: 362 ARQMYRDGGLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTIS 421

Query: 236 SWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTD-TLRNPRFKNSMKNVINHLYREQGISAF 294
           ++ +   G+ SG V    +YP++++++ +Q   T  +P      ++V+    + +G    
Sbjct: 422 NFIVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGL 481

Query: 295 FKGFAPTMLRAAPVNGATFVTFELVMRLL 323
           FKG  P + +  P    +++ +E   RL+
Sbjct: 482 FKGLVPNLAKVCPAVSISYLCYENFKRLM 510

>Scas_589.10
          Length = 316

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 78/320 (24%), Positives = 132/320 (41%), Gaps = 50/320 (15%)

Query: 34  KDSTRV--LKDILAGTCGGISQVIVGQPFDTTKVRMQ---------TSAKSV-------G 75
           KD  ++  +   ++G   G+S+ I+  P D  K R Q         TS+ +V        
Sbjct: 6   KDPVKLPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSS 65

Query: 76  ALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEA-----MKRFFREWNTSRGT 130
            L  + K++K EG    YKG   P++      +V+F  NE      MK+F  +  TS  T
Sbjct: 66  ILSCLSKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVT 125

Query: 131 QHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLV 190
                        + G   G+  S +  P E V+IRLQ       + +++ P+ C R ++
Sbjct: 126 ------------LLAGTFAGITESLIVVPFELVKIRLQDA-----QSDYRSPIRCTRTII 168

Query: 191 KEKSLM---RGLRPMMLRAGHGLGCYF-LTYEALIANEIKKGKDRSEIASWKL-CSYGSL 245
           + + L     G    + R       YF L ++  +   I + K  ++    +     G++
Sbjct: 169 ENQGLFGIYAGFESTIWRNTIWNASYFGLIFQ--VKKFIPRAKSTTKFQGIRNDFLVGAI 226

Query: 246 SGVVLWLAIYPLDVVKSMIQ--TDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTML 303
           +G +      P DVVK+ +Q    T     +  + ++V   +YR +GI   +KG  P + 
Sbjct: 227 AGCMSCFLSVPFDVVKTRMQGSKKTSSGMCYGWAWQSVF-LIYRTEGIKGIYKGILPIIC 285

Query: 304 RAAPVNGATFVTFELVMRLL 323
           R  P  G   V F  V  L 
Sbjct: 286 RYGPGGGLLLVVFNGVNELF 305

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 89/194 (45%), Gaps = 14/194 (7%)

Query: 43  ILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV-GALDIIRKLVKNEGVWAFYKGSLIPIV 101
           +LAGT  GI++ ++  PF+  K+R+Q +       +   R +++N+G++  Y G    I 
Sbjct: 126 LLAGTFAGITESLIVVPFELVKIRLQDAQSDYRSPIRCTRTIIENQGLFGIYAGFESTIW 185

Query: 102 GVGACVSVQFGVNEAMKRFF-REWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPI 160
                 +  FG+   +K+F  R  +T++    R+        ++ G   G ++ FL+ P 
Sbjct: 186 RNTIWNASYFGLIFQVKKFIPRAKSTTKFQGIRND-------FLVGAIAGCMSCFLSVPF 238

Query: 161 EHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGLGCYFLTY 217
           + V+ R+Q      +   +      +  + +    K + +G+ P++ R G G G   + +
Sbjct: 239 DVVKTRMQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGPGGGLLLVVF 298

Query: 218 EALIANEIKKGKDR 231
             +  NE+ +  D 
Sbjct: 299 NGV--NELFRMSDH 310

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 45/100 (45%), Gaps = 15/100 (15%)

Query: 33  AKDSTR---VLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVG------ALDIIRKL 83
           AK +T+   +  D L G   G     +  PFD  K RMQ S K+        A   +  +
Sbjct: 208 AKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTRMQGSKKTSSGMCYGWAWQSVFLI 267

Query: 84  VKNEGVWAFYKGSLIPIV-----GVGACVSVQFGVNEAMK 118
            + EG+   YKG ++PI+     G G  + V  GVNE  +
Sbjct: 268 YRTEGIKGIYKG-ILPIICRYGPGGGLLLVVFNGVNELFR 306

>Kwal_23.3042
          Length = 542

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/314 (21%), Positives = 130/314 (41%), Gaps = 39/314 (12%)

Query: 43  ILAGTCGGISQVIVGQPFDTTKV----RMQTSAKSVGALDIIRK---------------- 82
            +AG   G+       PFD  KV    R   S+  + + DII +                
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVK 287

Query: 83  ----LVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQ 138
               L +  G+ AFY G+ +  + V    +++FG  E  KR   +     G Q   G  +
Sbjct: 288 AATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLE---GVQDTAGLSR 344

Query: 139 LGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE------ 192
              Y   GL GGV+      PI+ ++ R+Q    N   +  +  +   + + KE      
Sbjct: 345 FSTYLAGGL-GGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIF 403

Query: 193 -KSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKG---KDRSEIASWKLCSYGSLSGV 248
            + +  G+  +   A   LG +    +  IA + +     +D+  +++  +   G+ SG 
Sbjct: 404 YRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGT 463

Query: 249 VLWLAIYPLDVVKSMIQTD-TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAP 307
           V   A+YP++++++ +Q   T  +P   N  ++V+    + +G    FKG  P + +  P
Sbjct: 464 VGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCP 523

Query: 308 VNGATFVTFELVMR 321
               +++ +E + R
Sbjct: 524 AVSISYLCYENLKR 537

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 41/206 (19%), Positives = 87/206 (42%), Gaps = 28/206 (13%)

Query: 142 YYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGN----------EREFKGPLDCIRK-LV 190
           ++I G   GVV+    +P + +++ L  +T   +          E+     L  I+  LV
Sbjct: 227 FFIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLV 286

Query: 191 KEKSLMR---GLRPMMLRAGHGLGCYFLTYEALIA-----------NEIKKGKDRSEIAS 236
           K  + +    G+R   +  G+GL    +  E+ I             +++  +D + ++ 
Sbjct: 287 KAATTLYRQGGIRAFYV--GNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSR 344

Query: 237 WKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRN-PRFKNSMKNVINHLYREQGISAFF 295
           +     G L GV+  L++YP+D +K  +Q   L    + +  + +    +Y+E G+  F+
Sbjct: 345 FSTYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIFY 404

Query: 296 KGFAPTMLRAAPVNGATFVTFELVMR 321
           +G    ++   P       TF  + +
Sbjct: 405 RGITVGIMGIFPYAAMDLGTFSALKK 430

 Score = 35.8 bits (81), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 43/101 (42%), Gaps = 19/101 (18%)

Query: 243 GSLSGVVLWLAIYPLDVVKSMI--QTDTL------------RNP-----RFKNSMKNVIN 283
           G +SGVV      P D +K  +  +TD              +NP     + K+ +     
Sbjct: 231 GGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVKAAT 290

Query: 284 HLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
            LYR+ GI AF+ G     ++  P +   F +FEL  RL+ 
Sbjct: 291 TLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMA 331

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 70/318 (22%), Positives = 121/318 (38%), Gaps = 59/318 (18%)

Query: 35  DSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQ---TSAKSVGA------LDIIRKLVK 85
           ++  ++  + AG   GI +  +  P D  K RMQ   T+  S         L  I K+  
Sbjct: 13  ENAPLVYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKIST 72

Query: 86  NEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRD-GTLQLGQYYI 144
            EG  A +KG    ++G G   +V F   E  K        SR     D  T Q  +  +
Sbjct: 73  TEGSLALWKGVQSVVLGAGPAHAVYFATYEMCK--------SRLIDPEDRQTHQPLKTAL 124

Query: 145 CGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMML 204
            G    V    L +P + ++ RLQ    +   +       C  ++ + +           
Sbjct: 125 SGTLATVAADALMNPFDTIKQRLQLHPSDSMTK-------CAVRMYQRE----------- 166

Query: 205 RAGHGLGCYFLTYEALIANEI--------------KKGKDRSEIASWKLCSYGSLSGVVL 250
               G+  +F +Y   IA  I              K     +    W  C  G +SG   
Sbjct: 167 ----GIAAFFYSYPTTIAMNIPFAALNFVIYESSTKIFNPSNNYNPWIHCLCGGISGATC 222

Query: 251 WLAIYPLDVVKSMIQ---TDTLRNPRFK--NSMKNVINHLYREQGISAFFKGFAPTMLRA 305
                PLD VK+++Q    D++++  FK  ++ +   + +++  G S FF+G  P ++  
Sbjct: 223 AAITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISN 282

Query: 306 APVNGATFVTFELVMRLL 323
            P    ++ ++E    LL
Sbjct: 283 MPATAISWTSYEFAKHLL 300

>Scas_721.27
          Length = 374

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 75/318 (23%), Positives = 134/318 (42%), Gaps = 61/318 (19%)

Query: 55  IVGQPFDTTKVRMQTS---------AKSVGA--------------------LDIIRKLVK 85
           +V  PFD  K R+Q+          A +V A                      I+  + K
Sbjct: 68  VVTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYK 127

Query: 86  NEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYIC 145
            EG  + +KG    +VGV    S+ F      K  + +          +G      + + 
Sbjct: 128 REGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSK-------AFNNGQETPLIHLMS 180

Query: 146 GLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKS---LMRGLRPM 202
             T G   S   +PI  ++ R+Q     G  R++K   DC++ ++K +    L RGL   
Sbjct: 181 AATAGWATSTATNPIWMIKTRVQLDKA-GTTRKYKNSWDCLKTVLKSEGIYGLYRGLSAS 239

Query: 203 MLRAGHGLGCYFLTYEAL-----------IANEIKKGKDRSE-IASWKLCSYGSLSGVVL 250
            L +  G+   +L YE +             +E +  K R+E I  W  C     +GV  
Sbjct: 240 YLGSIEGI-LQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEW--CQRSGSAGVAK 296

Query: 251 WLA---IYPLDVVKSMIQTDTLRN--PRFKNSMKNVINHLYREQGISAFFKGFAPTMLRA 305
           ++A    YP +VV++ ++   + N  P++   +++    + +E+G+++ + G  P ++R 
Sbjct: 297 FIASIVTYPHEVVRTRLRQMPMENGKPKYTGLVQS-FRVIIKEEGLASMYSGLTPHLMRT 355

Query: 306 APVNGATFVTFELVMRLL 323
            P +   F T+ELV+RLL
Sbjct: 356 VPNSIIMFGTWELVIRLL 373

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 90/199 (45%), Gaps = 20/199 (10%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQ-----TSAKSVGALDIIRKLVKNEGVWAFYK 94
           L  +++    G +      P    K R+Q     T+ K   + D ++ ++K+EG++  Y+
Sbjct: 175 LIHLMSAATAGWATSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYR 234

Query: 95  GSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSR----GTQHRDGTLQLGQYYICGLTGG 150
           G     +G    + +Q+ + E MK   ++ +  +    G   +  T ++ ++  C  +G 
Sbjct: 235 GLSASYLGSIEGI-LQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEW--CQRSGS 291

Query: 151 V-VNSFLAS----PIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPM 202
             V  F+AS    P E VR RL+       + ++ G +   R ++KE+   S+  GL P 
Sbjct: 292 AGVAKFIASIVTYPHEVVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPH 351

Query: 203 MLRAGHGLGCYFLTYEALI 221
           ++R        F T+E +I
Sbjct: 352 LMRTVPNSIIMFGTWELVI 370

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/298 (23%), Positives = 125/298 (41%), Gaps = 28/298 (9%)

Query: 43  ILAGTCGGISQVIVGQPFDTTKVRMQ----TSAKSVGALDIIRKLVKNEGVWAFYKGSLI 98
           +  G  G IS+ +V  PF+  K+ +Q    T+A + G  D I ++ K E +   ++G+ +
Sbjct: 28  LAGGIAGAISRTVV-SPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGL 86

Query: 99  PIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLAS 158
             + V    +VQF V E  K+     +T    +  +   +L    +CG    VV ++   
Sbjct: 87  NCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCG-GCSVVATY--- 142

Query: 159 PIEHVRIRLQTQTGN------GNEREFKGPLDCIRKLVKEKS-------LMRGLRPMMLR 205
           P++ VR RL  QT N          +   P    + L K  +       L RG+ P  L 
Sbjct: 143 PLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLG 202

Query: 206 AGHGLGCYFLTYEAL--IANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSM 263
               +   F  YE L       + G      + +KL S G++SG V     YP D+++  
Sbjct: 203 IVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKL-SMGAISGGVAQTITYPFDLLRRR 261

Query: 264 IQTDTLRNPRF---KNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFEL 318
            Q   +         NS+ + +  + + +G   ++KG    + +  P    +++ +EL
Sbjct: 262 FQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 35/89 (39%), Gaps = 9/89 (10%)

Query: 44  LAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGAL--------DIIRKLVKNEGVWAFYKG 95
           +    GG++Q I   PFD  + R Q  A     L        D +  + K EG   +YKG
Sbjct: 240 MGAISGGVAQTIT-YPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKG 298

Query: 96  SLIPIVGVGACVSVQFGVNEAMKRFFREW 124
               +  V    +V + V E    + + W
Sbjct: 299 LTANLFKVVPSTAVSWLVYELTWDYMKRW 327

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/280 (22%), Positives = 110/280 (39%), Gaps = 23/280 (8%)

Query: 46  GTCGGISQVIVGQPFDTTKVRMQTSAKSVGAL-DIIRKLVKNEGVWAFYKGSLIPIVGVG 104
           G   GI   +V  P D  KVR+Q +      L  ++  ++ NEGV   Y G    ++   
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQC 79

Query: 105 ACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVR 164
              +V+FG  + +K              R+    +     C +  G +     +  + V 
Sbjct: 80  TYTTVRFGAYDLLK---------ENVIPREQLTNMAYLLPCSMFSGAIGGLAGNFADVVN 130

Query: 165 IRLQTQTG--NGNEREFKGPLDCIRKLVKE----KSLMRGLRPMMLRAGHGLGCYFLTYE 218
           IR+Q  +       R +K  +D + K+ +     K+L  G +P M+R         +TY+
Sbjct: 131 IRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYD 190

Query: 219 ALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDT-LRNPRFKNS 277
            +  N +    D     ++   +   L+G+V      P DV+K+ I   +    P  K  
Sbjct: 191 -VFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSGDHQPALK-- 247

Query: 278 MKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
              ++    R++G S  F+G+ P+  R  P     F   E
Sbjct: 248 ---ILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIE 284

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 76/182 (41%), Gaps = 9/182 (4%)

Query: 146 GLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLR 205
           G   G+  + +  P++  ++RLQ          F+  L+ I        L  GL   +LR
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAP-MPKPTLFRM-LESILANEGVVGLYSGLSAAVLR 77

Query: 206 AGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQ 265
                   F  Y+ L  N I + +  + +A    CS    SG +  LA    DVV   +Q
Sbjct: 78  QCTYTTVRFGAYDLLKENVIPR-EQLTNMAYLLPCSM--FSGAIGGLAGNFADVVNIRMQ 134

Query: 266 TDTLRNPRFKNSMKNVINHLYR----EQGISAFFKGFAPTMLRAAPVNGATFVTFELVMR 321
            D+      + + KN I+ +Y+    E G+   F G+ P M+R   +  +  VT+++   
Sbjct: 135 NDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYDVFKN 194

Query: 322 LL 323
            L
Sbjct: 195 YL 196

 Score = 31.6 bits (70), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 15/78 (19%), Positives = 36/78 (46%), Gaps = 4/78 (5%)

Query: 242 YGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPT 301
           YG  +G+   +  +PLD+ K  +Q   +  P     +++++ +    +G+   + G +  
Sbjct: 19  YGGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILAN----EGVVGLYSGLSAA 74

Query: 302 MLRAAPVNGATFVTFELV 319
           +LR        F  ++L+
Sbjct: 75  VLRQCTYTTVRFGAYDLL 92

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/283 (23%), Positives = 120/283 (42%), Gaps = 29/283 (10%)

Query: 46  GTCGGISQVIVGQPFDTTKVRMQTS-AKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVG 104
           G  GGI   +   P D  KVR+QT+ A     + +  ++++NEGV   Y G    I+   
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPKPTLVRMASQILRNEGVPGLYSGLTAAILRQC 74

Query: 105 ACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVR 164
              + +FGV + +K  +         ++ +  L L     C +  G V   + +P + V 
Sbjct: 75  TYTTARFGVYDFVKERYIP------KEYLNSMLYL---LPCSMFSGAVGGLIGNPADVVN 125

Query: 165 IRLQTQTGNGNE--REFKGPLDCIRKLVKEK---SLMRGLRPMMLRAGHGLGCYFLTYEA 219
           IR+Q  +    E  R +K   D + K+   +    L  G +P ++R         +TY+ 
Sbjct: 126 IRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVTYDI 185

Query: 220 ----LIANE-IKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRF 274
               L+ N  + K    +  AS        L+G+V      P DV+K+ +      +   
Sbjct: 186 AKNYLVQNVGLDKDNKSTHFAS------SLLAGLVATTVCSPADVIKTRVMN---AHKHS 236

Query: 275 KNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
            +S   ++    +++G S  F+G+ P+ +R  P     F+T E
Sbjct: 237 HDSAVRILLDAVKQEGPSFMFRGWLPSFVRLGPNTILIFLTVE 279

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 72/185 (38%), Gaps = 22/185 (11%)

Query: 149 GGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE-------KSLMRGLRP 201
           GG+V      P++  ++RLQT            P   + ++  +         L  GL  
Sbjct: 18  GGIVACVATHPLDLAKVRLQTA---------PAPKPTLVRMASQILRNEGVPGLYSGLTA 68

Query: 202 MMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVK 261
            +LR        F  Y+ +    I K    S +    L      SG V  L   P DVV 
Sbjct: 69  AILRQCTYTTARFGVYDFVKERYIPKEYLNSML---YLLPCSMFSGAVGGLIGNPADVVN 125

Query: 262 SMIQTDTLRNPRFKNSMKNVINHLYR---EQGISAFFKGFAPTMLRAAPVNGATFVTFEL 318
             +Q D+      + + KN  + LY+    +G++  F G+ P ++R   +  +  VT+++
Sbjct: 126 IRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVTYDI 185

Query: 319 VMRLL 323
               L
Sbjct: 186 AKNYL 190

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 4/78 (5%)

Query: 242 YGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPT 301
           YG   G+V  +A +PLD+ K  +QT     P  K ++  + + + R +G+   + G    
Sbjct: 14  YGGFGGIVACVATHPLDLAKVRLQTA----PAPKPTLVRMASQILRNEGVPGLYSGLTAA 69

Query: 302 MLRAAPVNGATFVTFELV 319
           +LR      A F  ++ V
Sbjct: 70  ILRQCTYTTARFGVYDFV 87

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 65.9 bits (159), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 76/317 (23%), Positives = 125/317 (39%), Gaps = 71/317 (22%)

Query: 59  PFDTTKVRMQ-----TSAKSVG---------------------ALDIIRKLVKNEGVWAF 92
           PFD  K R+Q     T  KS                          II  + + EG  + 
Sbjct: 70  PFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFRSL 129

Query: 93  YKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQ-----YYICGL 147
           +KG    +VGV    S+ F      K  +              TL  GQ     + +   
Sbjct: 130 FKGLGPNLVGVIPARSINFLTYGTTKDIYSR------------TLNNGQEAPWIHLLAAA 177

Query: 148 TGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKS---LMRGLRPMML 204
           T G   S + +PI  V+ RLQ        + +K  LDCI+ +VK +    L +GL    L
Sbjct: 178 TAGWATSTVTNPIWLVKTRLQLD--KAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSASYL 235

Query: 205 RAGHGLGCYFLTYEAL--------------IANEIKKGKDRSEIASWKLCSYGSLSGVVL 250
            +  G+  + L YE +              I  + K   D+  +  W  C     +G+  
Sbjct: 236 GSVEGILQWIL-YEQMKRIIKERSIEKFGHIHEDAKSTSDK--VKEW--CQRSGSAGLAK 290

Query: 251 WLA---IYPLDVVKSMIQTDTLRNPRFKNS-MKNVINHLYREQGISAFFKGFAPTMLRAA 306
           ++A    YP +VV++ ++     N + K + +      + +E+G+ + + G  P +LR  
Sbjct: 291 FVASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTV 350

Query: 307 PVNGATFVTFELVMRLL 323
           P +   F T+ELV++LL
Sbjct: 351 PNSIIMFGTWELVIKLL 367

>Kwal_14.2210
          Length = 315

 Score = 65.5 bits (158), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 72/301 (23%), Positives = 124/301 (41%), Gaps = 33/301 (10%)

Query: 46  GTCGGISQVIVGQPFDTTKVRMQ----TSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIV 101
           G  G +S+ +V  PF+  K+ +Q    T A + G    ++++   EGV    +G+ +  +
Sbjct: 25  GIAGAVSRTVV-SPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGNGLNCI 83

Query: 102 GVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIE 161
            +    +VQF V E  K   ++W      Q+ D  +      + G   G  +     P++
Sbjct: 84  RIFPYSAVQFLVYEFCK---KQWF----QQNPDTVVLNWHRLVSGALCGGCSVLATYPLD 136

Query: 162 HVRIRLQTQTGNGNEREF---------KGPLDCIRKLVKEK----SLMRGLRPMMLRAGH 208
            VR RL  QT N                G  + +RK   ++     L RG+ P  +    
Sbjct: 137 LVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVVP 196

Query: 209 GLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDT 268
            +   F  YE L    I    D +  + +KL S G++SG V     YP D+++   Q   
Sbjct: 197 YVALNFAVYEQL-REYIPASFDPASASLYKL-SIGAISGGVAQTITYPFDLLRRRFQVLA 254

Query: 269 LRNPRFKNSMKNVINHLY---REQGISAFFKGFAPTMLRAAPVNGATFVTFELV---MRL 322
           +         K+V + L    R +G   ++KG    + +  P    ++V +E V   M+L
Sbjct: 255 MGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYETVRDYMQL 314

Query: 323 L 323
           L
Sbjct: 315 L 315

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 81/200 (40%), Gaps = 33/200 (16%)

Query: 140 GQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNG--NEREFKGPLDCIRKLVKEKSLMR 197
           G  +  G   G V+  + SP E V+I LQ Q+     N   F+         VK+  L  
Sbjct: 18  GIAFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRA--------VKQVYLEE 69

Query: 198 GLRPMMLRAGHGLGCY---------FLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGV 248
           G+ P +LR G+GL C          FL YE       ++  D + + +W     G+L G 
Sbjct: 70  GV-PGLLR-GNGLNCIRIFPYSAVQFLVYEFCKKQWFQQNPD-TVVLNWHRLVSGALCGG 126

Query: 249 VLWLAIYPLDVVKSMIQTDTLRNPRFKNSMK----------NVINHLY-REQGISAFFKG 297
              LA YPLD+V++ +   T    R   +             ++   Y +E GI   ++G
Sbjct: 127 CSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRG 186

Query: 298 FAPTMLRAAPVNGATFVTFE 317
             PT +   P     F  +E
Sbjct: 187 VWPTSIGVVPYVALNFAVYE 206

>Scas_716.29
          Length = 316

 Score = 65.1 bits (157), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 71/314 (22%), Positives = 127/314 (40%), Gaps = 42/314 (13%)

Query: 35  DSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQ-----TSAKSVGALDIIRKLVKNE-G 88
           +  +V + ++AG+  G+    V  P DT K+R+Q     T     G L +++ ++ NE G
Sbjct: 18  EDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGG 77

Query: 89  VWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLT 148
           + +F+KG++   +        QF         F E      T   +G L   Q  + G  
Sbjct: 78  LRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGE------TSDMNGQL---QSLVVGAL 128

Query: 149 GGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGH 208
            G+ +SF++ P + +R R              G  + I  +       RG    M     
Sbjct: 129 AGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKE-IWNMEGIPGFFRGCTASMFTITL 187

Query: 209 GLGCYFLTYEA--LIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQT 266
                F TYE+  +  +E  K  D +    +   S  S+SGV   +  YPLD ++  IQ 
Sbjct: 188 SASILFGTYESIKIYCDEYSKESDYTNYLRY---SASSISGVTSKMVTYPLDTIRRRIQ- 243

Query: 267 DTLRNPRF--KNSMKNVINHLY----------------REQGISAFFKGFAPTMLRAAPV 308
             +RN  +   N    ++  +Y                R++G+ + ++G + ++ +  P 
Sbjct: 244 --VRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPS 301

Query: 309 NGATFVTFELVMRL 322
              +   +E VMRL
Sbjct: 302 TVVSLWAYETVMRL 315

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/255 (21%), Positives = 115/255 (45%), Gaps = 15/255 (5%)

Query: 80  IRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQL 139
           I  L +  G+ +FY G+ +  + V    S++FG  E  K+   +    + T+     L  
Sbjct: 265 IISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKD----LSK 320

Query: 140 GQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLM 196
              +I G   GV   F   PI+ ++ R+Q    N   +  K  +   +++  E   K   
Sbjct: 321 LSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLFY 380

Query: 197 RGLRPMML----RAGHGLGCYFLT---YEALIANEIKKGKDRSEIASWKLCSYGSLSGVV 249
           RG+   +L     A   LG + +    Y +  A ++ K ++  E+++  +   G+ SG  
Sbjct: 381 RGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTF 440

Query: 250 LWLAIYPLDVVKSMIQTD-TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPV 308
               +YP++++++ +Q   T  +P   +  ++V+    + +G    FKG  PT+ +  P 
Sbjct: 441 GATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPTLAKVCPA 500

Query: 309 NGATFVTFELVMRLL 323
              +++ +E + +L+
Sbjct: 501 VSISYLCYENLKKLM 515

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 39/192 (20%), Positives = 81/192 (42%), Gaps = 12/192 (6%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVG------ALDIIRKLVKNEGVWAFY 93
           L   +AG   G+       P DT K RMQ +  +         +   +++    G+  FY
Sbjct: 321 LSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLFY 380

Query: 94  KGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYIC--GLTGGV 151
           +G  + ++G+    ++  G    +K+++   + ++    ++  ++L    +   G   G 
Sbjct: 381 RGVTVGVLGIFPYAALDLGTFSMLKKWYIS-SKAKKLNKKEEDVELSNLVVLPMGAFSGT 439

Query: 152 VNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLRAGH 208
             + +  PI  +R RLQ Q    +   + G  D + K ++ +    L +GL P + +   
Sbjct: 440 FGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPTLAKVCP 499

Query: 209 GLGCYFLTYEAL 220
            +   +L YE L
Sbjct: 500 AVSISYLCYENL 511

 Score = 33.1 bits (74), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 46/100 (46%), Gaps = 19/100 (19%)

Query: 243 GSLSGVVLWLAIYPLDVVKSMI--QTD---TL---------RNP-----RFKNSMKNVIN 283
           G +SGV+      P D +K  +  +TD   TL         +NP     + ++ +   I 
Sbjct: 207 GGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVKAII 266

Query: 284 HLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
            LYR+ GI +F+ G     L+  P +   F +FE+  +L+
Sbjct: 267 SLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLM 306

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 119/295 (40%), Gaps = 33/295 (11%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTS---AKSVGALDIIRKLVKNEGVWAFYKGSLI 98
            +LAG   GI +  V  P D  K R+Q+S   A + G +  I K+   EG  A +KG   
Sbjct: 19  QLLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWKGVQS 78

Query: 99  PIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRD-GTLQLGQYYICGLTGGVVNSFLA 157
            I+G G   +V F           E++ S+    +D  T Q  +  I G+    V   L 
Sbjct: 79  VILGAGPAHAVYFAT--------YEFSKSKLIDPQDMHTHQPIKTAISGMAATTVADALM 130

Query: 158 SPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGL---RPMMLRAGHGLGCY- 213
           +P + ++ R+Q      N RE    +  + K +  K          P  L        + 
Sbjct: 131 NPFDVIKQRMQL-----NTRE---SVWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFN 182

Query: 214 FLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQ---TDTLR 270
           F  YE    +  K     +E   +  C  G LSG        PLD +K+++Q   ++T+ 
Sbjct: 183 FAIYE----SATKFMNPSNEYNPFIHCISGGLSGATCAAITTPLDCIKTVLQVRGSETVS 238

Query: 271 NPRFK--NSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
           N   K  N+ +   + +Y+  G   F +G  P ++   P    ++ ++E     L
Sbjct: 239 NEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYECAKHFL 293

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/185 (20%), Positives = 80/185 (43%), Gaps = 7/185 (3%)

Query: 139 LGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRG 198
           L    + G   G++   +  P++ ++ R+Q+ +     +     +  I       +L +G
Sbjct: 16  LHHQLLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWKG 75

Query: 199 LRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLD 258
           ++ ++L AG     YF TYE    +++   +D       K    G  +  V    + P D
Sbjct: 76  VQSVILGAGPAHAVYFATYE-FSKSKLIDPQDMHTHQPIKTAISGMAATTVADALMNPFD 134

Query: 259 VVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFEL 318
           V+K  +Q +T      + S+ +V  ++Y ++G +AF+  +  T++   P     F  +E 
Sbjct: 135 VIKQRMQLNT------RESVWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYES 188

Query: 319 VMRLL 323
             + +
Sbjct: 189 ATKFM 193

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 73/312 (23%), Positives = 133/312 (42%), Gaps = 61/312 (19%)

Query: 59  PFDTTKVRMQTSA------------------------KSVGALDIIRKLVKNEGVWAFYK 94
           PFD  K R+Q+                          ++VG   II+ +   EG  + +K
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVG---IIQNVYTQEGFRSLFK 125

Query: 95  GSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHR---DGTLQLGQYYICGLTGGV 151
           G    +VGV    S+ F            +  ++ T  R   DG      +++ G T G 
Sbjct: 126 GLGPNLVGVIPARSINFFT----------YGVTKDTASRLLNDGQEAPWIHFLAGATAGW 175

Query: 152 VNSFLASPIEHVRIRLQ-TQTGNGNEREFKGPLDCIRKLVKEKSLM---RGLRPMMLRAG 207
             S   +PI  V+ RLQ  +  +G  R +K   DC++ +++ + ++   +GL    L + 
Sbjct: 176 ATSTATNPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLGSV 235

Query: 208 HGLGCYFLTYEALI----ANEIKKGKDRSE--------IASWKLCSYGSLSGVVLWLAI- 254
             +  + L YE +        I++  D SE        +  W   S GS     L+ +I 
Sbjct: 236 ESILQWVL-YEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRS-GSAGAAKLFASIL 293

Query: 255 -YPLDVVKSMIQTDTLRNPRFKNS-MKNVINHLYREQGISAFFKGFAPTMLRAAPVNGAT 312
            YP +VV++ ++     N + K + +    + + +E+G ++ + G  P ++R  P +   
Sbjct: 294 TYPHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSIIM 353

Query: 313 FVTFELVMRLLG 324
           F T+ELV++LL 
Sbjct: 354 FGTWELVIKLLA 365

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 125/295 (42%), Gaps = 29/295 (9%)

Query: 49  GGISQVIV---GQPFDTTKVRMQTSAKSV----------GALDIIRKLVKNEGVWAFYKG 95
           GG+S  +      P +  K+ +Q   + +          G +D  ++  + EG+ +F++G
Sbjct: 18  GGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQEGIISFWRG 77

Query: 96  SLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSF 155
           +   ++      ++ F   + +K  F         +   G L  G     G+ GG+   F
Sbjct: 78  NTANVIRYFPTQALNFAFKDQIKAMFGFKKEEGYAKWFAGNLASG-----GIAGGLSLMF 132

Query: 156 LASPIEHVRIRLQTQ---TGNGNEREFKGPLDCIRKLVKEKS---LMRGLRPMMLRAGHG 209
           + S +++ R RL      +  G ER+F G +D  +K +       L RG  P ++     
Sbjct: 133 VYS-LDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGFLPSVIGIVVY 191

Query: 210 LGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTL 269
            G YF  Y++     +    + S IAS+ L   G +       A YPLD V+  +   + 
Sbjct: 192 RGLYFGLYDSCKPLLLTGSLEGSFIASFLL---GWVVTTGASTASYPLDTVRRRMMMTSG 248

Query: 270 RNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
           +  ++K +M + +  +   +G+S+ FKG    +LR     G   +  +L M L G
Sbjct: 249 QAVKYKGAM-DCLQKIVAAEGVSSLFKGCGANILRGVAGAGVISLYDQLQMILFG 302

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 83/181 (45%), Gaps = 30/181 (16%)

Query: 46  GTCGGISQVIVGQPFDTTKVRMQTSAKSV---------GALDIIRKLVKNEGVWAFYKGS 96
           G  GG+S + V    D  + R+   AKS          G +D+ +K + ++GV   Y+G 
Sbjct: 123 GIAGGLSLMFV-YSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGF 181

Query: 97  LIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVN--- 153
           L  ++G+     + FG+ ++ K                G+L+ G +    L G VV    
Sbjct: 182 LPSVIGIVVYRGLYFGLYDSCKPLLLT-----------GSLE-GSFIASFLLGWVVTTGA 229

Query: 154 SFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLRAGHGL 210
           S  + P++ VR R+   +G     ++KG +DC++K+V  +   SL +G    +LR   G 
Sbjct: 230 STASYPLDTVRRRMMMTSGQA--VKYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGA 287

Query: 211 G 211
           G
Sbjct: 288 G 288

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 91/201 (45%), Gaps = 34/201 (16%)

Query: 147 LTGGV---VNSFLASPIEHVRIRLQTQ-----TGNGNEREFKGPLDCIRKLVKEK---SL 195
           L GGV   V    ASPIE V++ +Q Q      G+ + R +KG +DC ++  +++   S 
Sbjct: 16  LMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHR-YKGIVDCFQRTARQEGIISF 74

Query: 196 MRGLRPMMLRAGHGLGCYFLTYEAL---IANEIKKG---KDRSEIASW---KLCSYGSLS 246
            RG    ++R       YF T +AL     ++IK     K     A W    L S G ++
Sbjct: 75  WRGNTANVIR-------YFPT-QALNFAFKDQIKAMFGFKKEEGYAKWFAGNLAS-GGIA 125

Query: 247 GVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYRE----QGISAFFKGFAPTM 302
           G +  + +Y LD  ++ +  D   + +      N +  +Y++     G++  ++GF P++
Sbjct: 126 GGLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGFLPSV 185

Query: 303 LRAAPVNGATFVTFELVMRLL 323
           +      G  F  ++    LL
Sbjct: 186 IGIVVYRGLYFGLYDSCKPLL 206

>Scas_379.2
          Length = 301

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 117/302 (38%), Gaps = 34/302 (11%)

Query: 35  DSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQ-TSAKSVG-ALDIIRKLVKNEGVWAF 92
           DS  +   +LAG   GI +  V  P D  K R+Q TSAKS    L  + K+   EG  A 
Sbjct: 19  DSAPLSHQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKISTAEGSLAL 78

Query: 93  YKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVV 152
           +KG    I+G G   +V F   E  K++  +          +  +Q  Q     L+G V 
Sbjct: 79  WKGVQSVILGAGPAHAVYFATYEYTKKYLID----------EKDMQTHQPLKTALSGTVA 128

Query: 153 N---SFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK--SLMRGLRPMMLRAG 207
                 L +P + ++ R+Q  T            +  +++ K +  S      P  L   
Sbjct: 129 TIAADALMNPFDTLKQRMQLNTNT-------TVWNVTKQIYKNEGFSAFYYSYPTTLAMN 181

Query: 208 HGLGCY-FLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQ- 265
                + F+ YE+          D + +     C  G LSG        PLD +K+++Q 
Sbjct: 182 IPFAAFNFMIYES-ATKFFNPTNDYNPLVH---CLSGGLSGATCAAITTPLDCIKTVLQV 237

Query: 266 ----TDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMR 321
               + +L+  +  N+ +     +Y+  G   F++G  P +    P     +  +E    
Sbjct: 238 RGSESVSLQVMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYECAKH 297

Query: 322 LL 323
            L
Sbjct: 298 FL 299

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 76/186 (40%), Gaps = 8/186 (4%)

Query: 139 LGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRG 198
           L    + G   G++   +  PI+ ++ R+Q+ +           +  I       +L +G
Sbjct: 23  LSHQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQ-MAKISTAEGSLALWKG 81

Query: 199 LRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLD 258
           ++ ++L AG     YF TYE      I + KD       K    G+++ +     + P D
Sbjct: 82  VQSVILGAGPAHAVYFATYEYTKKYLIDE-KDMQTHQPLKTALSGTVATIAADALMNPFD 140

Query: 259 VVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFEL 318
            +K  +Q +T        ++ NV   +Y+ +G SAF+  +  T+    P     F+ +E 
Sbjct: 141 TLKQRMQLNT------NTTVWNVTKQIYKNEGFSAFYYSYPTTLAMNIPFAAFNFMIYES 194

Query: 319 VMRLLG 324
             +   
Sbjct: 195 ATKFFN 200

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 67/306 (21%), Positives = 130/306 (42%), Gaps = 35/306 (11%)

Query: 41  KDILAGTCGGISQVIVGQPFDTTKVRMQTSA----KSVGA--LDIIRKLVKNEGVWAFYK 94
           K +LAG   G+    +  P DT K+R+Q +     K  G+  +++ R ++KNEG+ +F+K
Sbjct: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77

Query: 95  GSLIPIVGVGACVSVQFGVNE-AMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVN 153
           G+ IP    G+ + V +G  + +    F  + T  G + R  +L +G +       G+ +
Sbjct: 78  GN-IP----GSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAF------AGITS 126

Query: 154 SFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCY 213
           S ++ P + +R RL       +       +  I KL       +G    M          
Sbjct: 127 SIVSYPFDVLRTRL-VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIM 185

Query: 214 FLTYEALIANEIKKGKDRSEIASWKLC----SYGSLSGVVLWLAIYPLDVVKSMIQ---- 265
           F TYE +     +  K  +    W+L     S G++ GV+  +  +PL+ ++  +Q    
Sbjct: 186 FGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNS 245

Query: 266 ---TDTLRNPRFKNSMK-----NVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
                  R+     S K      +   + +++G+S+ ++G    + +  P    +F  +E
Sbjct: 246 KHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305

Query: 318 LVMRLL 323
             +  L
Sbjct: 306 TAIHYL 311

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 60/131 (45%), Gaps = 4/131 (3%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRM--QTSAKSVGALDIIRKLVKNEGVWAFYKGSL 97
           L  ++ G   GI+  IV  PFD  + R+       S+     +R + K EG+  F+KGS+
Sbjct: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSI 172

Query: 98  IPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLA 157
             +  +    S+ FG  E ++ +  E N      H+   L    +   G  GGV+   + 
Sbjct: 173 ASMTTITLTASIMFGTYETIRIYCDE-NEKTTAAHKKWELATLNHS-AGTIGGVIAKIIT 230

Query: 158 SPIEHVRIRLQ 168
            P+E +R R+Q
Sbjct: 231 FPLETIRRRMQ 241

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 50/102 (49%), Gaps = 4/102 (3%)

Query: 223 NEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPR-FKNSMKNV 281
           + ++KG++   +A+WK    G++SG++      P+D +K  +Q       + F + +  V
Sbjct: 6   DSLRKGQN---VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEV 62

Query: 282 INHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
              + + +GI +F+KG  P  L       A F ++ L  R L
Sbjct: 63  ARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL 104

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 62.8 bits (151), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 69/303 (22%), Positives = 124/303 (40%), Gaps = 39/303 (12%)

Query: 44  LAGTCGGISQVIVGQPFDTTKVRMQTSAK-SVGALDIIRK-------LVKNEGVWAFYKG 95
           +AG       V V  P +  K+RMQ   + S  A  + +        + KNEG+    KG
Sbjct: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG 86

Query: 96  SLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGT-----QHRDGTLQLGQYYICGLTGG 150
                  + A    Q G+N +   F+    +S        Q       +G     G   G
Sbjct: 87  -------LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASG 139

Query: 151 VVNSFLASPIEHVRIRLQTQT---GNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMML 204
           ++ + + SP+  V+ RLQ+ +     G +  + G  + +  + K    K L RG+   +L
Sbjct: 140 IIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAIL 199

Query: 205 RAGHG----LGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVV 260
           R G G    L  Y      L+ N++ K      + +       ++SG+ + + + P DV+
Sbjct: 200 RTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTA------STISGLGVAVVMNPWDVI 253

Query: 261 KSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVM 320
            + I     +   +K  +  ++  + R +G++A +KGFA  + R AP         E  M
Sbjct: 254 LTRIYNQ--KGDLYKGPIDCLVKTV-RIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTM 310

Query: 321 RLL 323
           +L+
Sbjct: 311 KLV 313

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 80/185 (43%), Gaps = 27/185 (14%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV---------GALDIIRKLVKNEGVWAF 92
           ++ +G   GI   ++G P    K R+Q+ ++ +         G  + +  + K EGV   
Sbjct: 131 NVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGL 190

Query: 93  YKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDG-TLQLGQYYICGLTGGV 151
           ++G    I+  GA  SVQ  +    K         +    +DG  L L    I GL   V
Sbjct: 191 FRGIDAAILRTGAGSSVQLPIYNTAKNIL-----VKNDLMKDGPALHLTASTISGLGVAV 245

Query: 152 VNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLR-AG 207
           V     +P + +  R+  Q G+     +KGP+DC+ K V+ +   +L +G    + R A 
Sbjct: 246 V----MNPWDVILTRIYNQKGD----LYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297

Query: 208 HGLGC 212
           H + C
Sbjct: 298 HTIMC 302

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 36/177 (20%), Positives = 79/177 (44%), Gaps = 17/177 (9%)

Query: 143 YICGLTGGVVNSFLASPIEHVRIRLQTQ--TGNGNEREFKGPLDCIRKLVKE---KSLMR 197
           ++ G     +   + +PIE ++IR+Q Q        + +K P+  +  + K    K L +
Sbjct: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQK 85

Query: 198 GLRPMMLRA----GHGLGCYFLTYEALIANEI-KKGKDRSEIASWKLCSY-GSLSGVVLW 251
           GL    +      G  LG Y     +L  N++    ++  ++ S  +  + G+ SG++  
Sbjct: 86  GLNAAYIYQIGLNGSRLGFYEPIRSSL--NQLFFPDQEPHKVQSVGVNVFSGAASGIIGA 143

Query: 252 LAIYPLDVVKSMIQTDT----LRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLR 304
           +   PL +VK+ +Q+ +    +        + N +  +++ +G+   F+G    +LR
Sbjct: 144 VIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILR 200

>Scas_582.7
          Length = 329

 Score = 62.8 bits (151), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 81/182 (44%), Gaps = 8/182 (4%)

Query: 139 LGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SL 195
           L    + G   G++      PI+ ++ R+Q+ T  G E+     +  I K+   +   +L
Sbjct: 36  LSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLAL 95

Query: 196 MRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIY 255
            +G++ ++L AG     YF TYE   A+ I   + R      K+   G+ + V     + 
Sbjct: 96  WKGVQSVILGAGPAHAVYFATYEFTKAHLIPDSQ-RETHQPIKVAVSGATATVASDFFMN 154

Query: 256 PLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVT 315
           P D +K  +Q   L+    K  + NV   +Y  +G+SAF+  +  T+    P     F+ 
Sbjct: 155 PFDTIKQRMQISDLK----KEKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNFMI 210

Query: 316 FE 317
           +E
Sbjct: 211 YE 212

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/306 (22%), Positives = 111/306 (36%), Gaps = 52/306 (16%)

Query: 43  ILAGTCGGISQVIVGQPFDTTKVRMQ------TSAKSVGALDIIRKLVKNEGVWAFYKGS 96
           +LAG   GI +     P D  K R+Q      T   S   +  I K+   EG  A +KG 
Sbjct: 40  LLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWKGV 99

Query: 97  LIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFL 156
              I+G G   +V F   E  K      ++ R T       Q  +  + G T  V + F 
Sbjct: 100 QSVILGAGPAHAVYFATYEFTKAHLIP-DSQRETH------QPIKVAVSGATATVASDFF 152

Query: 157 ASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLT 216
            +P + ++ R+Q                 I  L KEK      +   L    GL  ++ +
Sbjct: 153 MNPFDTIKQRMQ-----------------ISDLKKEKVYNVAKKIYNLE---GLSAFYYS 192

Query: 217 YEALIANEI-----------KKGKDRSEIASWK---LCSYGSLSGVVLWLAIYPLDVVKS 262
           Y   IA  I              K  + +  +     C  G +SG +      PLD +K+
Sbjct: 193 YPTTIAMNIPFAAFNFMIYESASKFFNPLHHYNPLIHCLCGGISGAIAAAVTTPLDCIKT 252

Query: 263 MIQTD-----TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
           +IQ       +L   +  N+ K   + +    G   F++G  P +L   P    ++  +E
Sbjct: 253 VIQIRGSSVVSLEVMKKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTAYE 312

Query: 318 LVMRLL 323
                L
Sbjct: 313 CAKHFL 318

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 78/193 (40%), Gaps = 18/193 (9%)

Query: 34  KDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTS-AKSVGALDIIRKLVKNEGVWAF 92
           +++ + +K  ++G    ++      PFDT K RMQ S  K     ++ +K+   EG+ AF
Sbjct: 130 RETHQPIKVAVSGATATVASDFFMNPFDTIKQRMQISDLKKEKVYNVAKKIYNLEGLSAF 189

Query: 93  YKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVV 152
           Y      I       +  F + E+  +FF   +      H +  +      +CG   G +
Sbjct: 190 YYSYPTTIAMNIPFAAFNFMIYESASKFFNPLH------HYNPLIHC----LCGGISGAI 239

Query: 153 NSFLASPIEHVRIRLQTQTGNGNERE-------FKGPLDCIRKLVKEKSLMRGLRPMMLR 205
            + + +P++ ++  +Q +  +    E       FK     I  +   K   RGL+P +L 
Sbjct: 240 AAAVTTPLDCIKTVIQIRGSSVVSLEVMKKANTFKKATSAILMVYGWKGFWRGLQPRILA 299

Query: 206 AGHGLGCYFLTYE 218
                   +  YE
Sbjct: 300 NMPATAISWTAYE 312

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 62.4 bits (150), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 118/298 (39%), Gaps = 25/298 (8%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQ-------TSAK-SVGALDIIRKLVKNEGVWAFY 93
             +AG       V V  PFD  K RMQ        +AK     +     + KNEG+    
Sbjct: 23  SFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQ 82

Query: 94  KGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVN 153
           KG     +   A    + G  E ++             H+     +G     G T GVV 
Sbjct: 83  KGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHK--VQHIGINVAAGATSGVVG 140

Query: 154 SFLASPIEHVRIRLQTQTGN---GNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAG 207
           +F+ SP+  V+ R+Q+ +     G +  +    + +  + +    K L RG+   MLR G
Sbjct: 141 AFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDAAMLRTG 200

Query: 208 HGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMI--Q 265
            G       Y  +  N + K    ++     L S  +++G  + +A+ P DVV + +  Q
Sbjct: 201 IGSAVQLPIYN-ICKNFLLKHDLMNDGTGLHLLS-STIAGFGVGVAMNPWDVVLTRVYNQ 258

Query: 266 TDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
              L +      +K V     R +G+SA +KGF   +LR  P         E  ++L+
Sbjct: 259 KGNLYSGPIDCFIKTV-----RNEGLSALYKGFGAQILRIGPHTVLCLTFMEQTLKLV 311

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 62.4 bits (150), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 70/301 (23%), Positives = 119/301 (39%), Gaps = 38/301 (12%)

Query: 39  VLKDILAGTCGGISQVIVGQPFDTTKVRMQTS-AKSVGA---LDIIRKLVKNEGVWAFYK 94
           +   ++AG   GI +  V  P D  K R+Q++ AKS+ A   L  I  +  +EG  A +K
Sbjct: 33  LYHQLIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAKNMLSQISHISTSEGTLALWK 92

Query: 95  GSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNS 154
           G    I+G G   +V FG  E  K+   + ++   T H   T       I G      + 
Sbjct: 93  GVQSVILGAGPAHAVYFGTYEFCKKNLID-SSDTQTHHPFKTA------ISGACATTASD 145

Query: 155 FLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLR------PMMLRAGH 208
            L +P + ++ R+Q  T              + +  K+     GL       P  L    
Sbjct: 146 ALMNPFDTIKQRIQLNTSAS-----------VWQTTKQIYQSEGLAAFYYSYPTTLVMNI 194

Query: 209 GLGCY-FLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMI--- 264
               + F+ YE+      K     +E      C  GS+SG        PLD +K+++   
Sbjct: 195 PFAAFNFVIYES----STKFLNPSNEYNPLIHCLCGSISGSTCAAITTPLDCIKTVLQIR 250

Query: 265 --QTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRL 322
             QT +L   R  ++     + +Y+  G   F++G+ P ++   P    ++  +E     
Sbjct: 251 GSQTVSLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYECAKHF 310

Query: 323 L 323
           L
Sbjct: 311 L 311

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 78/184 (42%), Gaps = 12/184 (6%)

Query: 144 ICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLR 200
           I G   G++   +  PI+ ++ R+Q+   N      K  L  I  +   +   +L +G++
Sbjct: 38  IAGAFAGIMEHSVMFPIDALKTRIQS--ANAKSLSAKNMLSQISHISTSEGTLALWKGVQ 95

Query: 201 PMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVV 260
            ++L AG     YF TYE    N I     ++    +K    G+ +       + P D +
Sbjct: 96  SVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTH-HPFKTAISGACATTASDALMNPFDTI 154

Query: 261 KSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVM 320
           K  IQ +T        S+      +Y+ +G++AF+  +  T++   P     FV +E   
Sbjct: 155 KQRIQLNT------SASVWQTTKQIYQSEGLAAFYYSYPTTLVMNIPFAAFNFVIYESST 208

Query: 321 RLLG 324
           + L 
Sbjct: 209 KFLN 212

>Kwal_23.4354
          Length = 343

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 125/282 (44%), Gaps = 36/282 (12%)

Query: 65  VRMQTS-AKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFRE 123
           VR +TS  +     D   K+ K EGV + ++G  I ++       V F   E+++     
Sbjct: 75  VRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLR----- 129

Query: 124 WNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPL 183
            + SR  Q +  TL      +CG    V+ +   +P+E  R RLQ+   +  +       
Sbjct: 130 -DKSR-LQDKYPTLNP---LMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAM-- 182

Query: 184 DCIRKLVKE----------KSLMRGLRPMMLR----AGHGLGCYFLTYEALIANEIKKGK 229
             I+ L+KE          K+L RGL   + R    +    GCY   Y++ ++ + +K  
Sbjct: 183 -MIKDLIKESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEF-YKSNVSIDSEKSI 240

Query: 230 DRSEIASWK--LCSY--GSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNV---I 282
             S  ++W   + S+  GS  G V  +  +P DV K+ +Q   L +   K   KN+   +
Sbjct: 241 VNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYL 300

Query: 283 NHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
           N + + +G++A + G  P +++ AP       T+E+  RL  
Sbjct: 301 NQMRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEVCKRLFS 342

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 8/90 (8%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQTS--------AKSVGALDIIRKLVKNEGVWA 91
           +   + G+ GG    ++  PFD  K RMQ +          S      + ++ K+EG+ A
Sbjct: 252 VNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAA 311

Query: 92  FYKGSLIPIVGVGACVSVQFGVNEAMKRFF 121
            Y G +  ++ +    ++     E  KR F
Sbjct: 312 LYTGLVPRVIKIAPSCAIMISTYEVCKRLF 341

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 75/310 (24%), Positives = 127/310 (40%), Gaps = 49/310 (15%)

Query: 43  ILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKG----SLI 98
           ++AG+  G+       P DT K+++Q +  +  A +++  ++K EG+  F+KG    S++
Sbjct: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-NVLINILKREGIRGFWKGNVPGSIM 77

Query: 99  PIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLG---QYYIC--GLTGGVVN 153
            I+  GA    QFG    +  F R            G L L    Q Y C  G   G+ +
Sbjct: 78  YIIYGGA----QFGSYTYIGSFLR------------GGLDLNISPQLYSCLVGSLAGMTS 121

Query: 154 SFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLM---RGLRPMMLRAGHGL 210
           S  + P + +R R    +    + +     D I  +   + LM    G    M+  G   
Sbjct: 122 SLASYPFDVLRTRFAANS----QGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNT 177

Query: 211 GCYFLTYEAL--IANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDT 268
              F  YE++     E  K  DR +  +      G +SG    LA +PLD V+  IQ   
Sbjct: 178 AIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRN 237

Query: 269 LRNPR------FKNSMKNVINHLYREQGIS--------AFFKGFAPTMLRAAPVNGATFV 314
             N         K+  K+  N  +   GIS        + ++G   +++++ P    +  
Sbjct: 238 SPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLW 297

Query: 315 TFELVMRLLG 324
           ++EL M  LG
Sbjct: 298 SYELFMNKLG 307

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 71/161 (44%), Gaps = 10/161 (6%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGAL----DIIRKLVKNEGVWAFYKG 95
           L   L G+  G++  +   PFD  + R   +A S G L    D I  +  +EG+  F+ G
Sbjct: 108 LYSCLVGSLAGMTSSLASYPFDVLRTRF--AANSQGQLIKLRDEIMAIWSHEGLMGFFSG 165

Query: 96  SLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSF 155
               ++ +G   ++ FGV E++K F  E   S+ +  RD    L +  + G   G  +  
Sbjct: 166 CGSSMINIGLNTAIMFGVYESIKIFTEE--RSKLSDRRDPFTLLNE--LAGPISGFTSKL 221

Query: 156 LASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLM 196
              P++ VR R+Q +     ER  +     I K  K +  +
Sbjct: 222 ATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFL 262

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 44/91 (48%), Gaps = 6/91 (6%)

Query: 233 EIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGIS 292
           E+++      GSLSG+     I PLD VK  +Q      P  KN+  NV+ ++ + +GI 
Sbjct: 12  EVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV----TPHNKNA--NVLINILKREGIR 65

Query: 293 AFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
            F+KG  P  +      GA F ++  +   L
Sbjct: 66  GFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL 96

>Scas_702.10
          Length = 302

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/279 (23%), Positives = 110/279 (39%), Gaps = 20/279 (7%)

Query: 46  GTCGGISQVIVGQPFDTTKVRMQTSAKSVGALD-IIRKLVKNEGVWAFYKGSLIPIVGVG 104
           G   GI   ++  P D  KVR+Q +      L  ++  +++NE V   Y G    ++   
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLGRMLTTILRNENVMGLYSGLSAAVLRQC 75

Query: 105 ACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVR 164
              +V+FG  + MK      N        D    L      G  GG+V +F     + V 
Sbjct: 76  TYTTVRFGAYDLMKE-----NLIPQGHINDMVYLLPCSMFSGAIGGLVGNF----ADVVN 126

Query: 165 IRLQTQTGNGNE--REFKGPLDCIRKLVKE----KSLMRGLRPMMLRAGHGLGCYFLTYE 218
           IR+Q  +    E  R ++  +D + K+       K+L+ G +P M+R         +TY+
Sbjct: 127 IRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQVVTYD 186

Query: 219 ALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSM 278
                 + K     +  S  L S   L+G+V      P DV+K+ I      +     S 
Sbjct: 187 VFKNYLVTKLSFDPKKNSTHL-SASLLAGLVATTICSPADVIKTRIMN---AHKTESESA 242

Query: 279 KNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
             ++    +++G S  F+G+ P   R  P     F   E
Sbjct: 243 IKILTSAIKKEGPSFMFRGWLPIFTRLGPFTMLIFFAIE 281

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 79/189 (41%), Gaps = 13/189 (6%)

Query: 136 TLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSL 195
           T Q+   +  G   G+    +  P++  ++RLQ       +      L  I +      L
Sbjct: 6   TKQIKYPWWYGGAAGIFACVMTHPLDLAKVRLQA--APLPKPTLGRMLTTILRNENVMGL 63

Query: 196 MRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSY--GSLSGVVLWLA 253
             GL   +LR        F  Y+ +  N I +G   +++     CS   G++ G+V   A
Sbjct: 64  YSGLSAAVLRQCTYTTVRFGAYDLMKENLIPQGHI-NDMVYLLPCSMFSGAIGGLVGNFA 122

Query: 254 IYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYR----EQGISAFFKGFAPTMLRAAPVN 309
               DVV   +Q D+   P  + + +N I+ +Y+    E GI     G+ P M+R   + 
Sbjct: 123 ----DVVNIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMT 178

Query: 310 GATFVTFEL 318
            +  VT+++
Sbjct: 179 ASQVVTYDV 187

 Score = 28.9 bits (63), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 39/88 (44%), Gaps = 6/88 (6%)

Query: 34  KDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAK--SVGALDIIRKLVKNEGVWA 91
           K+ST +   +LAG    +    +  P D  K R+  + K  S  A+ I+   +K EG   
Sbjct: 202 KNSTHLSASLLAG----LVATTICSPADVIKTRIMNAHKTESESAIKILTSAIKKEGPSF 257

Query: 92  FYKGSLIPIVGVGACVSVQFGVNEAMKR 119
            ++G L     +G    + F   E +K+
Sbjct: 258 MFRGWLPIFTRLGPFTMLIFFAIEQLKK 285

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 60.8 bits (146), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/252 (21%), Positives = 109/252 (43%), Gaps = 15/252 (5%)

Query: 83  LVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQY 142
           L +  G+ AFY G+ + ++ V    +++FG  E  KR          T    G L     
Sbjct: 243 LYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGET----GELSRLST 298

Query: 143 YICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSL---MRGL 199
           Y+ G  GG++  F   PI+ ++ R+Q    +   R     +   + + +E  L    RGL
Sbjct: 299 YVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGL 358

Query: 200 RPMMLRAGHGLGCYFLTYEALI-------ANEIKKGKDRSEIASWKLCSYGSLSGVVLWL 252
              +L           T+ AL        AN +   ++   +++  +   G+ SG V   
Sbjct: 359 GVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGAT 418

Query: 253 AIYPLDVVKSMIQTD-TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGA 311
            +YP++++++ +Q   T  +P   +  ++V     + +G+   +KG  PT+ +  P    
Sbjct: 419 VVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKVCPAVAI 478

Query: 312 TFVTFELVMRLL 323
           +++ +E + R +
Sbjct: 479 SYLCYENLKRAM 490

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 80/192 (41%), Gaps = 12/192 (6%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGA------LDIIRKLVKNEGVWAFY 93
           L   +AG  GGI       P DT K R+Q +            +   + + +  G+  FY
Sbjct: 296 LSTYVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFY 355

Query: 94  KGSLIPIVGVGACVSVQFGVNEAMKRFF--REWNTSRGTQHRDGTLQLGQYYICGLTGGV 151
           +G  + I+GV    ++  G   A+KR++  R  N + G    +  +        G   G 
Sbjct: 356 RGLGVGILGVFPYAALDLGTFSALKRWYITRRAN-ALGISENEVVMSNLVVLPMGAFSGT 414

Query: 152 VNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLRAGH 208
           V + +  PI  +R RLQ Q    +   + G  D  RK V+ +    L +GL P + +   
Sbjct: 415 VGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKVCP 474

Query: 209 GLGCYFLTYEAL 220
            +   +L YE L
Sbjct: 475 AVAISYLCYENL 486

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 35/83 (42%), Gaps = 6/83 (7%)

Query: 46  GTCGGISQVIVGQPFDTTKVRMQTSA------KSVGALDIIRKLVKNEGVWAFYKGSLIP 99
           G   G     V  P +  + R+Q         +  G  D+ RK V+ EG+   YKG +  
Sbjct: 409 GAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPT 468

Query: 100 IVGVGACVSVQFGVNEAMKRFFR 122
           +  V   V++ +   E +KR  R
Sbjct: 469 LAKVCPAVAISYLCYENLKRAMR 491

 Score = 32.7 bits (73), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 271 NPR-----FKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
           NPR      ++ +      LYR+ G+ AF+ G    +++  P +   F +FEL  R+L
Sbjct: 224 NPRADPAKIRSPLVKAATSLYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVL 281

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 70/340 (20%), Positives = 135/340 (39%), Gaps = 70/340 (20%)

Query: 39  VLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKS--------VGALDIIRKLVKNEGVW 90
           V++  LAG   G     +  P D  K+  QTS           VG  +  + +  N+G+ 
Sbjct: 18  VVRSGLAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIR 77

Query: 91  AFYKGSLIPIVGVGACVSVQFGVNEAMKRFF---REWNTSRGTQHRDGTLQLGQYYICGL 147
            F++G  + ++ +    +V+F   E ++      RE+  S   +   G+L          
Sbjct: 78  GFFQGHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYE-SHWRRLASGSL---------- 126

Query: 148 TGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKS------------- 194
             G+ + F+  P++  R+RL   T    E +     D ++ +  E +             
Sbjct: 127 -AGLCSVFITYPLDLTRVRLAYVT----EHKRVKLRDIVKTIYHEPASEGLTSHLLVPKW 181

Query: 195 ------LMRGLRPMMLRAGHGLGCYFLTYE--------ALIAN------------EIKKG 228
                   RG  P +L      G  F  ++        +L+A             E KK 
Sbjct: 182 FAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKL 241

Query: 229 KDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKN----SMKNVINH 284
           + ++ + +W     G LSG++   A YPL++++  +Q  TL   +  +    S+ ++   
Sbjct: 242 RQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARI 301

Query: 285 LYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
           +Y+E+G   FF G +   ++  P+   +F  +E +   LG
Sbjct: 302 IYQEKGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHLG 341

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 38/94 (40%), Gaps = 9/94 (9%)

Query: 34  KDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKS--------VGALDIIRKLVK 85
           K   R   +++AG   GI       P +  + R+Q S  S          ++  I +++ 
Sbjct: 244 KTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIY 303

Query: 86  NEGVW-AFYKGSLIPIVGVGACVSVQFGVNEAMK 118
            E  W  F+ G  I  + V   V+  F V E MK
Sbjct: 304 QEKGWRGFFVGLSIGYIKVTPMVACSFFVYERMK 337

>Kwal_33.14050
          Length = 314

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 66/311 (21%), Positives = 118/311 (37%), Gaps = 57/311 (18%)

Query: 43  ILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKN-----------EGVWA 91
           + AG   GI +  +  P D  K RMQ  + ++G+ +   KL  N           EG  A
Sbjct: 20  LAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMA 79

Query: 92  FYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGV 151
            +KG    I+G G   +V F   E  K +  +            T Q  +    G+   V
Sbjct: 80  LWKGVQSVILGAGPAHAVYFATYEMCKSYLID-------PQDFQTHQPLKTAASGIAATV 132

Query: 152 VNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLG 211
               L +P + ++ R+Q                 +R   K++  M  +   + R   GL 
Sbjct: 133 AADLLMNPFDTIKQRMQ-----------------LRTFSKDR--MWSVASRIYR-NEGLA 172

Query: 212 CYFLTYEALIANEIKKGKDRSEI--ASWKL------------CSYGSLSGVVLWLAIYPL 257
            +F +Y   IA  I        I  ++ K             C  G +SG        PL
Sbjct: 173 AFFYSYPTTIAMNIPFAAFNFAIYESATKFFNPENTYNPLIHCLCGGISGATCAAITTPL 232

Query: 258 DVVKSMIQ---TDTLRNPRFK--NSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGAT 312
           D +K+++Q   ++++ +P F+  ++     + + +  G S F++G  P ++   P    +
Sbjct: 233 DCIKTVLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATAIS 292

Query: 313 FVTFELVMRLL 323
           +  +E     L
Sbjct: 293 WTAYECAKHTL 303

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 70/187 (37%), Gaps = 18/187 (9%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGAL-DIIRKLVKNEGVWAFYKGSLI 98
           LK   +G    ++  ++  PFDT K RMQ    S   +  +  ++ +NEG+ AF+     
Sbjct: 121 LKTAASGIAATVAADLLMNPFDTIKQRMQLRTFSKDRMWSVASRIYRNEGLAAFFYSYPT 180

Query: 99  PIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLAS 158
            I       +  F + E+  +FF   NT     H           +CG   G   + + +
Sbjct: 181 TIAMNIPFAAFNFAIYESATKFFNPENTYNPLIH----------CLCGGISGATCAAITT 230

Query: 159 PIEHVRIRLQTQTGNG-------NEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLG 211
           P++ ++  LQ +               F      I K+       RGL+P ++       
Sbjct: 231 PLDCIKTVLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATA 290

Query: 212 CYFLTYE 218
             +  YE
Sbjct: 291 ISWTAYE 297

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 64/321 (19%), Positives = 122/321 (38%), Gaps = 50/321 (15%)

Query: 35  DSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAK---------------------S 73
           D+  +   ++AG   GI +  +  P D  K RMQ  ++                     +
Sbjct: 16  DTAPLSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGA 75

Query: 74  VGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFF---REWNTSRGT 130
              L  I ++   EG  A ++G    ++G G   +V F   E  K      +++NT +  
Sbjct: 76  GTLLQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPL 135

Query: 131 QHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLV 190
           +            + G+   V    L +P + ++ RLQ Q+ + +   ++   +    + 
Sbjct: 136 KTA----------VSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFN----IY 181

Query: 191 KEKSLMRGL--RPMMLRAGHGLGCY-FLTYEALIANEIKKGKDRSEIASWKLCSYGSLSG 247
           K +  M      P  L          F+ YE    +  K     +    W  C  G ++G
Sbjct: 182 KNEGPMAFFYSYPTTLAMNIPFAALNFVIYE----SSTKFFNPTNAYNPWIHCLCGGIAG 237

Query: 248 VVLWLAIYPLDVVKSMIQ---TDTLRNPRFK--NSMKNVINHLYREQGISAFFKGFAPTM 302
                   PLD +K+++Q   +DT+    FK  N+ K     +++  G   F++G  P +
Sbjct: 238 ATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRV 297

Query: 303 LRAAPVNGATFVTFELVMRLL 323
           +   P    ++ ++E    LL
Sbjct: 298 ISNIPATAISWTSYEFAKHLL 318

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 79/197 (40%), Gaps = 21/197 (10%)

Query: 33  AKD--STRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGA--LDIIRKLVKNEG 88
           AKD  + + LK  ++G    ++   +  PFDT K R+Q  +KS  +    +   + KNEG
Sbjct: 126 AKDFNTHQPLKTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFNIYKNEG 185

Query: 89  VWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLT 148
             AF+      +       ++ F + E+  +FF   N      H           +CG  
Sbjct: 186 PMAFFYSYPTTLAMNIPFAALNFVIYESSTKFFNPTNAYNPWIH----------CLCGGI 235

Query: 149 GGVVNSFLASPIEHVRIRLQTQTGNGNERE-------FKGPLDCIRKLVKEKSLMRGLRP 201
            G   + + +P++ ++  LQ +  +    E       FK     I +    K   RGL+P
Sbjct: 236 AGATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQP 295

Query: 202 MMLRAGHGLGCYFLTYE 218
            ++         + +YE
Sbjct: 296 RVISNIPATAISWTSYE 312

>Scas_558.2
          Length = 289

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 117/297 (39%), Gaps = 33/297 (11%)

Query: 37  TRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGS 96
           T  +  +L+G   G S  +V  P DT K R+Q                +N G    Y+G 
Sbjct: 4   TAFVMSLLSGAAAGTSTDLVFFPIDTLKTRLQAKGG----------FFQNGGYHGIYRGL 53

Query: 97  LIPIVGVGACVSVQFGVNEAMK-----RFFREWNTS--RGTQHRDGTLQLGQYYICGLTG 149
              +V      S+ F   ++MK        R  N+S  R     D  + +    I    G
Sbjct: 54  GSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHM----IASSMG 109

Query: 150 GVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHG 209
            +    +  P E ++ R Q  + N + + F+  L    +    ++L RG    ++R    
Sbjct: 110 ELAACLVRVPAEVIKQRTQVHSTNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREIPF 169

Query: 210 LGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKS--MIQTD 267
               F  YE +         +   +  WK    GS++G +      PLD +K+  M+  D
Sbjct: 170 TCIQFPLYEFMKKEWALYDNEVGHLKPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKD 229

Query: 268 TLRNPRFKNSMKNVINHLYREQGISAFFKGFAP-TMLRAAPVNGATFVTFELVMRLL 323
           ++        +K++I ++Y+E+G   FF G  P TM  +A   GA F+     M  +
Sbjct: 230 SI-------PIKSLIRNIYKEEGFKIFFSGIYPRTMWISA--GGAIFLGVYETMHFM 277

>Scas_687.15*
          Length = 328

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 73/327 (22%), Positives = 126/327 (38%), Gaps = 56/327 (17%)

Query: 37  TRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGS 96
           T V   ILAG+   + +  +  PF+  K   Q   ++VGA    +       +  ++ G 
Sbjct: 6   TDVPIQILAGSAAAVFETTLTYPFEFLKTGFQLHRRTVGA----KPFEALRPIKVYFAGC 61

Query: 97  LIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFL 156
               +      SV+F   +   +  R+ N  +     D  L+  +  + G+  G V S  
Sbjct: 62  TALNLSAIVKTSVRFATFDKACQILRDPNLPK-----DSLLKGPRLLLAGILTGAVESLC 116

Query: 157 ASPIEHVRI-----RLQTQTGNGNEREFKG-----------------------------P 182
             P E+V++      LQ       E+E  G                             P
Sbjct: 117 IIPFENVKVTMIENSLQLSESKPTEKEIAGTLKKKVTFHVAKPKQLSPQEQWRQVYSKYP 176

Query: 183 LDCIRKLVKEKSLMRGLR-------PMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIA 235
              I  +VKE  L RGLR       P + R        F  Y  L    I   +  +E+ 
Sbjct: 177 SSNIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTL-KQLISPTQPLNEVY 235

Query: 236 SWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFF 295
           ++ +  + S + V L     P+DVVK+ +Q+ T     +KNS+ N    ++ E+G+ + +
Sbjct: 236 AFGIGLFSSCAVVAL---TQPIDVVKTRMQSKTAHY-FYKNSL-NCAYRVFVEEGMVSLW 290

Query: 296 KGFAPTMLRAAPVNGATFVTFELVMRL 322
           KG+ P + +     G +F  ++ V  L
Sbjct: 291 KGWLPRLFKVGLSGGISFGVYQYVENL 317

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 118/301 (39%), Gaps = 35/301 (11%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQ----TSAKSVGALDIIRKLVKNEGVWAFYKG 95
           L  ++AG+  G+    V  P DT K+R Q    +  K  G L   R + + EGV A +KG
Sbjct: 25  LHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKG 84

Query: 96  SLIPIVGVGACV-SVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNS 154
           + +P   +     S+QFG    +       NT+  +    G          G   G+V+S
Sbjct: 85  N-VPASAMYVLYGSLQFGTYAWL-------NTAAASA---GLPPQAHSLAVGALAGLVSS 133

Query: 155 FLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYF 214
            L  P++ +R RL     + +    +     I          RG    +       G  F
Sbjct: 134 LLTYPLDLLRTRLVANR-SAHFFSLRRQARVIWDTEGPAGFFRGGAWAIAATTLTTGLIF 192

Query: 215 LTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQ-TDT----- 268
             YE         G        W   +    +G+V   A++PLD V+  +Q  D      
Sbjct: 193 GIYETCTIAADTYGLP------WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPF 246

Query: 269 -LRNPRFKNSMK-----NVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRL 322
             R+P   ++++      +  H+ R +GI++ +KG    + ++ P    T   ++  +RL
Sbjct: 247 FTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRL 306

Query: 323 L 323
           L
Sbjct: 307 L 307

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/329 (20%), Positives = 136/329 (41%), Gaps = 62/329 (18%)

Query: 39  VLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKS--------VGALDIIRKLVKNEGVW 90
           +++  LAG   G     +  P D  K+  QTS           +G ++  + +  N+GV 
Sbjct: 33  IVRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVR 92

Query: 91  AFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGG 150
            F++G    ++ +    +V+F   E ++      NT   ++  +   +     + G   G
Sbjct: 93  GFFQGHSATLLRIFPYAAVKFVAYEQIR------NTLIPSKEFESHWRR---LVSGSLAG 143

Query: 151 VVNSFLASPIEHVRIRLQTQT-------GNGNEREFKGPLDCIRKLVKEK---------- 193
           + + F+  P++ VR+RL  +T       G   ++ +K P      L+K            
Sbjct: 144 LCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASA--TLIKNDYIPNWFCHWC 201

Query: 194 SLMRGLRP----MMLRAG-----HGL------GCYFLTYEALIANEIK-----KGKDRSE 233
           +  RG  P    M+  AG     H L        +F  Y  L  +E       + K R  
Sbjct: 202 NFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRP 261

Query: 234 IASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTD-----TLRNPRFKNSMKNVINHLYRE 288
           + +W     G L+G+    A YP ++++  +Q       T+ + +F+ S+  + + +++E
Sbjct: 262 LRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQ-SISEIAHIIFKE 320

Query: 289 QGISAFFKGFAPTMLRAAPVNGATFVTFE 317
           +G+  FF G +   ++  P+   +F  +E
Sbjct: 321 RGVRGFFVGLSIGYIKVTPMVACSFFVYE 349

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 89/204 (43%), Gaps = 34/204 (16%)

Query: 146 GLTGGVVNS---FLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE-------KSL 195
           GL GG+  S    L +P++  RI++  QT N +  ++ G L  + +  K        +  
Sbjct: 37  GLAGGISGSCAKTLIAPLD--RIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGF 94

Query: 196 MRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIY 255
            +G    +LR        F+ YE  I N +   K+    + W+    GSL+G+      Y
Sbjct: 95  FQGHSATLLRIFPYAAVKFVAYEQ-IRNTLIPSKEFE--SHWRRLVSGSLAGLCSVFITY 151

Query: 256 PLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISA----------------FFKGFA 299
           PLD+V+  +  +T  + R K  +  +I  +Y+E   +                 F++G+ 
Sbjct: 152 PLDLVRVRLAYET-EHKRVK--LGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYV 208

Query: 300 PTMLRAAPVNGATFVTFELVMRLL 323
           PT+L   P  G +F   +L+  +L
Sbjct: 209 PTVLGMIPYAGVSFFAHDLLHDVL 232

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 41/97 (42%), Gaps = 14/97 (14%)

Query: 38  RVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGAL---------DIIRKLVKNEG 88
           R   ++++G   G++      PF+  + R+Q SA S   +         +I   + K  G
Sbjct: 263 RTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERG 322

Query: 89  VWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWN 125
           V  F+ G  I  + V   V+  F V E MK     WN
Sbjct: 323 VRGFFVGLSIGYIKVTPMVACSFFVYERMK-----WN 354

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 84/188 (44%), Gaps = 27/188 (14%)

Query: 39  VLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV---------GALDIIRKLVKNEGV 89
           V  ++ AG   GI   IVG P    K RMQ+ + ++            + +  + K EGV
Sbjct: 129 VAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGV 188

Query: 90  WAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGT-LQLGQYYICGLT 148
              ++G    I+  GA  SVQ  +    K F  + +       ++GT L L    + GL 
Sbjct: 189 LGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQNDI-----MKEGTALHLLSSTVTGLG 243

Query: 149 GGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLR 205
            G+V     +P + V  R+  Q GN     +KGP+DC+ K +K +   +L +G    + R
Sbjct: 244 VGIV----MNPWDVVLTRVYNQKGN----TYKGPIDCMFKTIKIEGIGALYKGFGAQLFR 295

Query: 206 -AGHGLGC 212
            A H + C
Sbjct: 296 IAPHTILC 303

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 123/303 (40%), Gaps = 35/303 (11%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTSAK-SVGALDIIRK-------LVKNEGVWAFY 93
             +AG       V V  PF+  K RMQ   + S     I R        + KNEGV    
Sbjct: 26  SFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEGVKGLQ 85

Query: 94  KGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVN 153
           +G +   V        + G  E ++    +        H+   + +      G T G++ 
Sbjct: 86  RGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVN--VTAGATSGIIG 143

Query: 154 SFLASPIEHVRIRLQTQTGN---GNEREFKGPLDCIRKLVKEKS---LMRGLRPMMLRAG 207
           + + SP+  V+ R+Q+ +     G +  +    + +  + K++    L RG+   +LR G
Sbjct: 144 AIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAILRTG 203

Query: 208 HG----LGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSM 263
            G    L  Y  T   L+ N+I K     E  +  L S  +++G+ + + + P DVV + 
Sbjct: 204 AGSSVQLPIYNTTKNFLLQNDIMK-----EGTALHLLS-STVTGLGVGIVMNPWDVVLTR 257

Query: 264 IQTDTLRNPRFKNSMKNVINHLYRE---QGISAFFKGFAPTMLRAAPVNGATFVTFELVM 320
           +           N+ K  I+ +++    +GI A +KGF   + R AP         E  M
Sbjct: 258 VYNQK------GNTYKGPIDCMFKTIKIEGIGALYKGFGAQLFRIAPHTILCLTFMEQTM 311

Query: 321 RLL 323
           +L+
Sbjct: 312 KLV 314

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 72/313 (23%), Positives = 135/313 (43%), Gaps = 40/313 (12%)

Query: 37  TRVLKDILAGTCGGISQVIVGQPFDTTKVR-----MQTSAKSVGALDIIRKLVKNEGVWA 91
           TR+  DI        ++ ++    +TT+ R     +Q +      + II  + + EG  +
Sbjct: 82  TRLQSDIYQNMYKSQAEALM---MNTTRPRIVNLTLQAATHFKETVSIIGNVYRQEGFRS 138

Query: 92  FYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGV 151
            +KG    +VGV    S+ F      K  + +          +G      + +   T G 
Sbjct: 139 LFKGLGPNLVGVIPARSINFFTYGTTKDIYSK-------AFNNGQEAPWIHLMAAATAGW 191

Query: 152 VNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKS---LMRGLRPMMLRAGH 208
             +   +PI  V+ R+Q     G  R +K   DC++ +++ +    L RGL    L +  
Sbjct: 192 ATATATNPIWMVKTRVQLDKA-GKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVE 250

Query: 209 GLGCYFLTYEALIANEIKK-------GKDRS------EIASWKLCSYGSLSGVVLWLA-- 253
           G+   +L YE L  + IKK         D S      +I  W  C     +G+  ++A  
Sbjct: 251 GI-LQWLLYEQL-KHLIKKRSIEKFGAHDESTMTTTDKIKQW--CQRSGGAGLAKFMASI 306

Query: 254 -IYPLDVVKSMIQTDTLRNPRFKNS-MKNVINHLYREQGISAFFKGFAPTMLRAAPVNGA 311
             YP +VV++ ++   L N + K + +      + +E+G+++ + G  P ++R  P +  
Sbjct: 307 VTYPHEVVRTRLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSII 366

Query: 312 TFVTFELVMRLLG 324
            F T+E+V++LL 
Sbjct: 367 MFGTWEVVIKLLS 379

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 39/87 (44%), Gaps = 27/87 (31%)

Query: 256 PLDVVKSMIQTDTLRN---------------PR-----------FKNSMKNVINHLYREQ 289
           P D+VK+ +Q+D  +N               PR           FK ++ ++I ++YR++
Sbjct: 76  PFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETV-SIIGNVYRQE 134

Query: 290 GISAFFKGFAPTMLRAAPVNGATFVTF 316
           G  + FKG  P ++   P     F T+
Sbjct: 135 GFRSLFKGLGPNLVGVIPARSINFFTY 161

>Kwal_27.12481
          Length = 304

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 69/309 (22%), Positives = 129/309 (41%), Gaps = 31/309 (10%)

Query: 34  KDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV--GALD--------IIRKL 83
           K S   +  ++ G    +S+     P +  K+ +Q   + +  G+LD          ++ 
Sbjct: 6   KQSNFAVDFLMGGVSAAVSKT-AAAPIERVKLLIQNQDEMIKQGSLDRRYTGIGECFKRT 64

Query: 84  VKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQ--LGQ 141
             NEG+ +F++G+   ++      ++ F   + +K  F       G +  +G  +   G 
Sbjct: 65  AANEGIASFWRGNTANVIRYFPTQALNFAFKDKIKAMF-------GFKKEEGYAKWFAGN 117

Query: 142 YYICGLTGGVVNSFLASPIEHVRIRLQTQTG---NGNEREFKGPLDCIRKLVKEKS---L 195
               G  GG+   F+ S +++ R RL   +     G ER+F G +D  +K +       L
Sbjct: 118 LASGGAAGGLSLMFVYS-LDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGL 176

Query: 196 MRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIY 255
            RG  P ++      G YF  Y++L    +    + S +AS+ L  +   +G     A Y
Sbjct: 177 YRGFLPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSFLASF-LLGWAVTTGAST--ASY 233

Query: 256 PLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVT 315
           PLD V+  +   + +  ++ N   +    +   +GI + FKG    +LR     G   + 
Sbjct: 234 PLDTVRRRMMMTSGQAVKY-NGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVISMY 292

Query: 316 FELVMRLLG 324
            +L M L G
Sbjct: 293 DQLQMILFG 301

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 62/273 (22%), Positives = 110/273 (40%), Gaps = 32/273 (11%)

Query: 68  QTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTS 127
           + +A+  G L+ +RK+ + EG+   ++G  I +V       V F   EA+          
Sbjct: 75  EPAARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEAL---------- 124

Query: 128 RGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQT-QTGNGNEREFKGPLDCI 186
           R        L +    +CG    ++ +   +P+E +R RLQ+       ER      D +
Sbjct: 125 RDNSPLASRLPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLL 184

Query: 187 RKLVKEKSLM------RGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWK-- 238
           R++  E S+M      +GL   + R       Y+ TYE        +       ++W   
Sbjct: 185 REMRHEVSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHF 244

Query: 239 LCSY--GSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRF-----------KNSMKNVINHL 285
           + S+  GS+ G V  L  +P DV K+ +Q       +               M + +N +
Sbjct: 245 IGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAI 304

Query: 286 YREQGISAFFKGFAPTMLRAAPVNGATFVTFEL 318
            + +GI A + G  P +++ AP       T+EL
Sbjct: 305 RKSEGIRALYTGLLPRVMKIAPSCAIMISTYEL 337

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 84/207 (40%), Gaps = 41/207 (19%)

Query: 149 GGVVNSFLASPIEHVRIRLQTQT-------------------------GNGNERE----F 179
           G +V S   +P++ VR+RL  Q                           N   RE     
Sbjct: 21  GSLVTSLFLTPLDVVRVRLHQQEMLPSCTCTGQLSKPAGKVFWQDECFANVGCREPAARL 80

Query: 180 KGPLDCIRKLVKEK---SLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIAS 236
           +G L+ +RK+ + +   +L RGL   ++ A      YF  YEAL  N       R  +A+
Sbjct: 81  QGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEALRDNS--PLASRLPVAN 138

Query: 237 WKLCSYGSLSGVVLWLAIYPLDVVKSMIQT-----DTLRNPRFKNSMKNVINHLYREQGI 291
             +C  G+ + ++    I PL+++++ +Q+     DT R       +   + H     G 
Sbjct: 139 PLVC--GAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEVSVMGY 196

Query: 292 SAFFKGFAPTMLRAAPVNGATFVTFEL 318
            A FKG   T+ R  P +   + T+E 
Sbjct: 197 RALFKGLEITLWRDVPFSAIYWGTYEF 223

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 37/92 (40%), Gaps = 16/92 (17%)

Query: 46  GTCGGISQVIVGQPFDTTKVRMQTSAKSV----------------GALDIIRKLVKNEGV 89
           G+ GG    ++  PFD  K RMQ +  S                 G    +  + K+EG+
Sbjct: 251 GSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGI 310

Query: 90  WAFYKGSLIPIVGVGACVSVQFGVNEAMKRFF 121
            A Y G L  ++ +    ++     E  K+FF
Sbjct: 311 RALYTGLLPRVMKIAPSCAIMISTYELSKKFF 342

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 81/189 (42%), Gaps = 24/189 (12%)

Query: 130 TQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKL 189
           ++ R  T  L    I G +GG+V++ +  P + ++ RLQ       + +       ++ +
Sbjct: 2   SEQRRATTHL----IGGFSGGLVSAIILQPFDLLKTRLQ-------QDKTSTLWKTLKSI 50

Query: 190 VKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSY------- 242
                L RG  P  +R   G   Y LT    I   I KGK+     S  L          
Sbjct: 51  ETPSQLWRGALPSCIRTSVGSAMY-LTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMF 109

Query: 243 -GSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPT 301
            G+++  +  L   P+ V+K   ++   +      S++   +H++R +G+  FF+GF  T
Sbjct: 110 SGAVTRALTGLITMPITVIKVRYESTLYQ----YTSLRYATSHIFRTEGLRGFFRGFGAT 165

Query: 302 MLRAAPVNG 310
            LR AP  G
Sbjct: 166 ALRDAPYAG 174

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/297 (20%), Positives = 112/297 (37%), Gaps = 24/297 (8%)

Query: 38  RVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSL 97
           R    ++ G  GG+   I+ QPFD  K R+Q    S     + + L   E     ++G+L
Sbjct: 6   RATTHLIGGFSGGLVSAIILQPFDLLKTRLQQDKTST----LWKTLKSIETPSQLWRGAL 61

Query: 98  IPIV--GVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSF 155
              +   VG+ + +   +N   +   +  NT          L + +    G     +   
Sbjct: 62  PSCIRTSVGSAMYLTM-LNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGL 120

Query: 156 LASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFL 215
           +  PI  +++R ++         +      I +    +   RG     LR     G Y L
Sbjct: 121 ITMPITVIKVRYESTLYQYTSLRYA--TSHIFRTEGLRGFFRGFGATALRDAPYAGLYML 178

Query: 216 TYE--------ALIANEIKKGKDR--SEIASWKLCSYGSLSGVVLWLAIY-PLDVVKSMI 264
            Y+         L +N +K   D   S  AS  +    + S  V+  +I  P D VK+ +
Sbjct: 179 FYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITAPFDTVKTRM 238

Query: 265 QTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMR 321
           Q +    P   +S  +   H+  ++ +   F G +  + R A   G  +  +E +++
Sbjct: 239 QLE----PAKFHSFTSTFWHIATKESVRNLFAGISLRLTRKAFSAGIAWGIYEEIVK 291

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 114/284 (40%), Gaps = 37/284 (13%)

Query: 59  PFDTTKVRMQT----SAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVN 114
           PF+  K R+Q     S +S   L ++ +  + +G  A Y G    +VG      V+F   
Sbjct: 30  PFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQGAGALYVGCPAFVVGNTCKAGVRFLGF 89

Query: 115 EAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLA-SPIEHVRIRL------ 167
           +A++R           Q   G L   +  + GL  G++ S LA +P E V+  L      
Sbjct: 90  DALRRAL---------QDERGALSGPRGMLAGLGAGLLESVLAVTPFEAVKTALIDDRQA 140

Query: 168 ----QTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHG----LGCYFLTYEA 219
                   G G  R +   L  +        L+    P+ LR         GCY    +A
Sbjct: 141 ARPRYQHNGRGAARNYALLLRELGLRGLYGGLV----PVALRQASNQAVRFGCYTQLKQA 196

Query: 220 LIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMK 279
           +             + S +    G+LSG+V   A  P+D VK+ +Q   L   R+ +++ 
Sbjct: 197 V--QRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQ--ALDAARYGSTV- 251

Query: 280 NVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
                + RE+G+ A ++G  P + R     G  F  +E ++ LL
Sbjct: 252 GCFRAVVREEGVRALWRGATPRLGRLVLSGGIVFTAYEKLLVLL 295

>Scas_718.24
          Length = 337

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 66/297 (22%), Positives = 123/297 (41%), Gaps = 33/297 (11%)

Query: 49  GGISQVIV---GQPFDTTKVRMQT----------SAKSVGALDIIRKLVKNEGVWAFYKG 95
           GG+S  +      P +  K+ +Q             K  G +D  R+  + EG+ +F++G
Sbjct: 49  GGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDCFRRTAQQEGIISFWRG 108

Query: 96  SLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQ--LGQYYICGLTGGVVN 153
           +   ++      ++ F   + +K  F       G +  DG  +   G     G  GG+  
Sbjct: 109 NTANVIRYFPTQALNFAFKDKIKLMF-------GFKKEDGYGKWFAGNLASGGAAGGLSL 161

Query: 154 SFLASPIEHVRIRLQTQTGN---GNEREFKGPLDCIRKLVKEKS---LMRGLRPMMLRAG 207
            F+ S ++  R RL   + +   G  R+F G +D  +K +K      L RG  P ++   
Sbjct: 162 LFVYS-LDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGII 220

Query: 208 HGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTD 267
              G YF  Y+++    +    + S +AS+ L   G +         YPLD V+  +   
Sbjct: 221 VYRGLYFGLYDSIKPVLLTGSLEGSFLASFLL---GWVVTTGASTCSYPLDTVRRKMMMT 277

Query: 268 TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
           + +  ++K +  +    +   +G+++ FKG    +LR     G   +  +L M L G
Sbjct: 278 SGQAVKYKGAF-DCFKKIVAAEGVASLFKGCGANILRGVAGAGVISMYDQLQMILFG 333

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 83/181 (45%), Gaps = 30/181 (16%)

Query: 46  GTCGGISQVIVGQPFDTTKVRMQTSAKSV---------GALDIIRKLVKNEGVWAFYKGS 96
           G  GG+S + V    D  + R+   +KS          G +D+ +K +K++GV   Y+G 
Sbjct: 154 GAAGGLSLLFV-YSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGF 212

Query: 97  LIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVN--- 153
           L  +VG+     + FG+ +++K                G+L+ G +    L G VV    
Sbjct: 213 LPSVVGIIVYRGLYFGLYDSIKPVLLT-----------GSLE-GSFLASFLLGWVVTTGA 260

Query: 154 SFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLRAGHGL 210
           S  + P++ VR ++   +G     ++KG  DC +K+V  +   SL +G    +LR   G 
Sbjct: 261 STCSYPLDTVRRKMMMTSGQA--VKYKGAFDCFKKIVAAEGVASLFKGCGANILRGVAGA 318

Query: 211 G 211
           G
Sbjct: 319 G 319

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 90/200 (45%), Gaps = 32/200 (16%)

Query: 147 LTGGV---VNSFLASPIEHVRIRLQTQT---GNGN-EREFKGPLDCIRKLVKEK---SLM 196
           L GGV   V    ASPIE V++ +Q Q      G  + ++KG +DC R+  +++   S  
Sbjct: 47  LMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDCFRRTAQQEGIISFW 106

Query: 197 RGLRPMMLRAGHGLGCYFLTYEAL---IANEIK---KGKDRSEIASW---KLCSYGSLSG 247
           RG    ++R       YF T +AL     ++IK     K       W    L S G+  G
Sbjct: 107 RGNTANVIR-------YFPT-QALNFAFKDKIKLMFGFKKEDGYGKWFAGNLASGGAAGG 158

Query: 248 VVLWLAIYPLDVVKSMIQTDTLRN----PRFKNSMKNVINHLYREQGISAFFKGFAPTML 303
           + L L +Y LD  ++ +  D+  +     R  N + +V     +  G++  ++GF P+++
Sbjct: 159 LSL-LFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGFLPSVV 217

Query: 304 RAAPVNGATFVTFELVMRLL 323
                 G  F  ++ +  +L
Sbjct: 218 GIIVYRGLYFGLYDSIKPVL 237

>Kwal_0.232
          Length = 274

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 64/290 (22%), Positives = 108/290 (37%), Gaps = 19/290 (6%)

Query: 35  DSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYK 94
           D +  +  +LAG   G S  +   P DT K R+Q +               N G    Y+
Sbjct: 2   DRSSFITSLLAGAAAGTSTDLFFFPIDTLKTRLQAAG----------GFFANGGYLGVYR 51

Query: 95  GSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNS 154
           G    +V      S+ F   + MK + R    +  T   D   +   +      G +   
Sbjct: 52  GLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITS-SDQVAETATHMFSSSAGEIAAC 110

Query: 155 FLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYF 214
            +  P E ++ R QT   + + +  K  L         ++L RG    ++R        F
Sbjct: 111 MVRVPAEVIKQRTQTHKSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTCIQF 170

Query: 215 LTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRF 274
             YE L       G  R ++A W+    G ++G +      PLDV+K+ +       P  
Sbjct: 171 PLYEFLKKQWAISG-GREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSHTSVP-- 227

Query: 275 KNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFV-TFELVMRLL 323
              + ++   +Y  +G   FF G  P  +  +   GA F+  +E V  +L
Sbjct: 228 ---VLHLARQIYATEGWKVFFSGVGPRTVWIS-AGGAIFLGVYETVHSIL 273

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 78/305 (25%), Positives = 124/305 (40%), Gaps = 51/305 (16%)

Query: 35  DSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYK 94
           DST  L  +++G   G S  +V  P DT K R+Q                 N G    Y+
Sbjct: 2   DST-FLASLVSGAAAGTSTDVVFFPIDTLKTRLQAKGG----------FFHNGGYRGIYR 50

Query: 95  GSLIPIVGVGACVSVQFGVNEAMKRFFR----EWNTSRGTQHRDGTLQLGQYYICGLTGG 150
           G    +V      S+ F   ++MK+  R     W  S      +   ++  + +    G 
Sbjct: 51  GLGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTAS------EQLAEVLTHMLSSSLGE 104

Query: 151 VVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE-------KSLMRGLRPMM 203
           +    +  P E ++ R QT   N +       L  +R ++++       + L RG    +
Sbjct: 105 MSACLVRVPAEVIKQRTQTHHTNSS-------LQTLRLILRDPTGEGVVRGLYRGWWTTI 157

Query: 204 LRAGHGLGCYFLTYEALIANEIKKGKDRSEI---ASWKLCSYGSLSGVVLWLAIYPLDVV 260
           +R        F  YE L     KK    +EI   ++W+    GSL+G +   A  PLDV+
Sbjct: 158 MREIPFTCIQFPLYEYLK----KKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVL 213

Query: 261 KSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP-TMLRAAPVNGATFV-TFEL 318
           K+ +     R P     M ++   L+RE+G   FF+G  P TM  +A   GA F+  +E 
Sbjct: 214 KTRMMLHERRVP-----MLHLARTLFREEGARVFFRGIGPRTMWISA--GGAIFLGVYEA 266

Query: 319 VMRLL 323
           V  L 
Sbjct: 267 VHSLF 271

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 56/255 (21%), Positives = 111/255 (43%), Gaps = 28/255 (10%)

Query: 75  GALDIIRKLVKNEGVWAFYKGSLIPIV-GVGACVSVQFGVNEAMKRFFREWNTSRGTQHR 133
              D I K+ K EG+   Y+G    ++ G     S  F  +   K +FR     +    +
Sbjct: 77  STFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFR----VKLINRK 132

Query: 134 DGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE- 192
           +      +  + G+     +    +PI  +  R QT+ G   + +F   L   +++ KE 
Sbjct: 133 NTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDF---LTVAKEIYKEQ 189

Query: 193 ---KSLMRGLR-PMMLRAGHGLGCYFLTYE----ALIANEIKKGKDR-----SEIASWKL 239
              K   +GL+  +ML     +   + +YE    AL   +    K       S+++ ++ 
Sbjct: 190 RSIKGFWKGLKVSLMLTINPSIT--YTSYEKLKDALFTTDTMNLKKELVDSSSQLSPYQN 247

Query: 240 CSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFA 299
            + G LS ++  +   PL + K+ +Q    RN    +S + V+ +LY+ +G+ +++KG +
Sbjct: 248 FTLGVLSKMISAIITMPLIISKAWLQ----RNGSNFSSFQQVLYYLYKNEGLRSWWKGLS 303

Query: 300 PTMLRAAPVNGATFV 314
           P + +   V G  F+
Sbjct: 304 PQLAKGVLVQGLLFM 318

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/103 (18%), Positives = 44/103 (42%), Gaps = 33/103 (32%)

Query: 234 IASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFK------------------ 275
           +AS++    G+++  +    +YPLD+VK+++QT   ++ + K                  
Sbjct: 1   MASFESALSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDI 60

Query: 276 ---------------NSMKNVINHLYREQGISAFFKGFAPTML 303
                          NS  + I  +Y+++GI   ++G   +++
Sbjct: 61  PPVPIKLNENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVM 103

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/308 (21%), Positives = 129/308 (41%), Gaps = 28/308 (9%)

Query: 34  KDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV----------GALDIIRKL 83
           K S  ++  ++ G    +S+     P +  K+ +Q   + +          G +D  ++ 
Sbjct: 5   KQSNFLINFMMGGVSAAVSKT-AAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRT 63

Query: 84  VKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRG-TQHRDGTLQLGQY 142
             +EGV +F++G+   ++      ++ F   + +K  F       G  +   G L  G  
Sbjct: 64  AASEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYAKWFAGNLASG-- 121

Query: 143 YICGLTGGVVNSFLASPIEHVRIRLQTQTGN---GNEREFKGPLDCIRKLVKEKS---LM 196
              G  GG+   F+ S +++ R RL   + +   G ER+F G +D  +K +       L 
Sbjct: 122 ---GAAGGLSLLFVYS-LDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLY 177

Query: 197 RGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYP 256
           RG  P ++      G YF  Y++L    +    + S IAS+ L  +   +G     A YP
Sbjct: 178 RGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGNLESSFIASF-LLGWAVTTGAST--ASYP 234

Query: 257 LDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTF 316
           LD V+  +   + +  ++  +  +    +   +G+ + FKG    +LR     G   +  
Sbjct: 235 LDTVRRRMMMTSGQAVKYDGAF-DAFRKIVAAEGVKSLFKGCGANILRGVAGAGVISLYD 293

Query: 317 ELVMRLLG 324
           +L + L G
Sbjct: 294 QLQLVLFG 301

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 72/326 (22%), Positives = 128/326 (39%), Gaps = 48/326 (14%)

Query: 34  KDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSA---KSVGALDIIRKLVKNEGVW 90
           +D + +   +++G  GG          DT K R Q +    K    +   R +   EGV 
Sbjct: 48  EDLSPIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVR 107

Query: 91  -AFYKGSLIPIVGVGACVSVQFGVNEAMKR-FFREWNTSRGTQHRDGTLQLGQYYICGLT 148
              Y G +  ++G     ++ FG  E  KR    +W  +    H             G  
Sbjct: 108 RGLYGGYMAAMLGSFPSAAIFFGTYEYTKRTMIEDWQINDTITHLS----------AGFL 157

Query: 149 GGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLD------CIRKLVKE---KSLMRGL 199
           G  ++SF+  P E ++ RLQ Q G  N   F+   +       I+ ++KE   +SL  G 
Sbjct: 158 GDFISSFVYVPSEVLKTRLQLQ-GRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGY 216

Query: 200 RPMMLRAGHGLGCYFLTYEAL----IANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIY 255
           +  + R        F  YE         E K G+D  E++       G+ +G +  +   
Sbjct: 217 KATLARDLPFSALQFAFYEKFRQLAFKIEQKDGRD-GELSIPNEILTGACAGGLAGIITT 275

Query: 256 PLDVVKSMIQTD----------TLRNPR--------FKNSMKNVINHLYREQGISAFFKG 297
           P+DVVK+ +QT           ++ +P           NS+   +  +Y+ +G+  FF G
Sbjct: 276 PMDVVKTRVQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSG 335

Query: 298 FAPTMLRAAPVNGATFVTFELVMRLL 323
             P  +  +  +    + +++ +R L
Sbjct: 336 VGPRFVWTSVQSSIMLLLYQMTLRGL 361

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 70/292 (23%), Positives = 115/292 (39%), Gaps = 23/292 (7%)

Query: 35  DSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYK 94
           DS+  L  + +G   G S  +   P DT K R+Q                 N G    Y+
Sbjct: 2   DSSSFLVSLASGAAAGTSTDLAFFPIDTLKTRLQAKG----------GFFANGGYKGVYR 51

Query: 95  GSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNS 154
           G    ++      S+ F   ++MK + +   +   T +      L   +   + G V   
Sbjct: 52  GLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSI-GEVSAC 110

Query: 155 FLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYF 214
            +  P E ++ R QT   N + + F   L         ++L RG    ++R        F
Sbjct: 111 LVRVPAEVIKQRTQTHKTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCIQF 170

Query: 215 LTYEALIANEIKK-GKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPR 273
             YE L     K+ G+D   +A W+    GS++G +      PLDV+K+ +       P 
Sbjct: 171 PLYEFLKKTWAKRNGQD--HVAPWQGSVCGSVAGAIAAATTTPLDVLKTRLMLSHKSIP- 227

Query: 274 FKNSMKNVINHLYREQGISAFFKGFAP-TMLRAAPVNGATFV-TFELVMRLL 323
               +  +  ++Y E+G   FF G  P TM  +A   GA F+  +E V  +L
Sbjct: 228 ----VAQLAKNIYAEEGFKVFFSGVGPRTMWISA--GGAIFLGVYETVHSIL 273

>Kwal_23.3965
          Length = 307

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/319 (21%), Positives = 126/319 (39%), Gaps = 44/319 (13%)

Query: 32  MAKDSTR------VLKDILAGTCGGISQVIVGQPFDTTKVRMQ----TSAKSVGALDIIR 81
           MA+D  R      V + ++AG   GIS  IV  P DT K+R+Q      A+  G L   +
Sbjct: 1   MAEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFK 60

Query: 82  KLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQ 141
           +LV+ EGV A +KG++  +       S QF     + +   +  +    Q   G      
Sbjct: 61  RLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSK--SQLPAQIHTG------ 112

Query: 142 YYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRG 198
             + G   G  ++  + P + +R R        + RE    L   +++ +    +   +G
Sbjct: 113 --MVGALSGTCSAIASYPCDVLRTRFIA----NHSRELSTMLSTAQEIWRHEGFRGFFKG 166

Query: 199 LRPMMLRAGHGLGCYFLTYEAL-IANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPL 257
           +   ++           TYE++ I  E +  +D S I   +  S   ++G+V    ++P+
Sbjct: 167 VSSSIVSIAVATSSILATYESVKIFCEQRPDRDSSVIQLLE-SSASVIAGIVSKTIVFPI 225

Query: 258 DVVKSMIQT---DTLRNPRFKNSMKNVINH------------LYREQGISAFFKGFAPTM 302
           D V+   Q      L +P   N                    +  ++G+ A + G+   +
Sbjct: 226 DTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGI 285

Query: 303 LRAAPVNGATFVTFELVMR 321
            ++ P    +   +E  +R
Sbjct: 286 AKSVPSTVVSLGVYEWCLR 304

 Score = 35.8 bits (81), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 46/101 (45%), Gaps = 4/101 (3%)

Query: 223 NEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVI 282
           + ++KG+   E+  ++    G LSG+   +   PLD +K  +Q   L N      +    
Sbjct: 4   DHLRKGQ---EVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQ-LANEAQYGGILVTF 59

Query: 283 NHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
             L R++G+ A +KG  P M          F ++ ++ +LL
Sbjct: 60  KRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL 100

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/298 (21%), Positives = 122/298 (40%), Gaps = 32/298 (10%)

Query: 47  TCGGISQVI---VGQPFDTTKVRMQTSAKSVGA--------LDIIRKLVKNEGVWAFYKG 95
           T GG++  I   V  P +  K+RMQ   + + A           +  + +NEG+    KG
Sbjct: 23  TAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKG 82

Query: 96  SLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSF 155
            +   +   A    + G  E ++    +  T    Q       +G     G   G++ + 
Sbjct: 83  LVAAYIYQIALNGSRLGFYEPIRAVMNK--TFYPDQESHKVQSVGINVFAGAASGIIGAV 140

Query: 156 LASPIEHVRIRLQTQTGN---GNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHG 209
           + SP+  V+ RLQ+ +     G +  + G  + ++ +      K L RG+   +LR G G
Sbjct: 141 MGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAG 200

Query: 210 ----LGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQ 265
               L  Y      L+ N+I +      + +       ++SG+ + + + P DV+ + I 
Sbjct: 201 SSVQLPIYNTAKNFLLRNDIMEDGPSLHLTA------STISGLGVAVVMNPWDVILTRIY 254

Query: 266 TDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
               +   +K  +  ++  + + +GI+A +KGF   + R  P         E  M+L+
Sbjct: 255 NQ--KGDLYKGPIDCLVKTV-KIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLV 309

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 81/185 (43%), Gaps = 27/185 (14%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV---------GALDIIRKLVKNEGVWAF 92
           ++ AG   GI   ++G P    K R+Q+ + ++         G  + ++ +   EGV   
Sbjct: 127 NVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGL 186

Query: 93  YKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDG-TLQLGQYYICGLTGGV 151
           ++G    I+  GA  SVQ  +    K F       R     DG +L L    I GL   V
Sbjct: 187 FRGIDAAILRTGAGSSVQLPIYNTAKNFLL-----RNDIMEDGPSLHLTASTISGLGVAV 241

Query: 152 VNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLRAG- 207
           V     +P + +  R+  Q G+     +KGP+DC+ K VK +   +L +G    + R G 
Sbjct: 242 V----MNPWDVILTRIYNQKGD----LYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293

Query: 208 HGLGC 212
           H + C
Sbjct: 294 HTILC 298

>Kwal_23.3529
          Length = 395

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 117/291 (40%), Gaps = 33/291 (11%)

Query: 56  VGQPFDTTKVRMQTSAKSVGALDII---RKLVKNEGVW-AFYKGSLIPIVGVGACVSVQF 111
           V    DT K R Q +  +    ++I   +K+   EG+    Y G    ++G     ++ F
Sbjct: 102 VMHSLDTVKTRQQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAIFF 161

Query: 112 GVNEAMKR-FFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQ 170
           G  E  KR    +W  +    H             GL+G +V+S +  P E ++ RLQ Q
Sbjct: 162 GTYELTKRKLIDDWGVNETLSH----------LTAGLSGDLVSSVVYVPSEVLKTRLQLQ 211

Query: 171 --------TGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEAL-- 220
                       N R  +  +  I +L   ++L  G +  + R        F  YE    
Sbjct: 212 GCYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQ 271

Query: 221 IANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQT--------DTLRNP 272
            A  ++      +++       G+ +G +  +   P+DV+K+ IQT        D+ R  
Sbjct: 272 WAFTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDSTRLV 331

Query: 273 RFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
           R +NS+   +  +YR +G   FF G  P  +  +  +    + +++ ++ L
Sbjct: 332 RIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLYQVTLKSL 382

>Kwal_27.11419
          Length = 298

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 86/187 (45%), Gaps = 22/187 (11%)

Query: 142 YYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRP 201
           ++I G  GG+ ++ +  P + ++ RLQ Q  + N       LD +R +     L +G  P
Sbjct: 10  HFIGGFVGGLTSAVILQPFDLLKTRLQ-QNKSSNL------LDVVRSIETPGQLWKGTLP 62

Query: 202 MMLRAGHGLGCYFLTYE---ALIANEIKKG---KDRSEIASWKLCSY-----GSLSGVVL 250
             LR   G   +  T     + IA++  KG   K+ S     +L  Y     G+++   +
Sbjct: 63  SALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAV 122

Query: 251 WLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNG 310
            +A  P+ V+K   ++ T+ N +   S+     H+YR +GI   F G   T++R AP  G
Sbjct: 123 GVATMPITVLKVRFES-TMYNYK---SLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAG 178

Query: 311 ATFVTFE 317
              + +E
Sbjct: 179 LYVLFYE 185

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 44 LAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSL 97
          + G  GG++  ++ QPFD  K R+Q + KS   LD++R +     +W   KG+L
Sbjct: 12 IGGFVGGLTSAVILQPFDLLKTRLQQN-KSSNLLDVVRSIETPGQLW---KGTL 61

>Scas_562.12
          Length = 300

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/283 (22%), Positives = 119/283 (42%), Gaps = 36/283 (12%)

Query: 43  ILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNE------GVWAFYKGS 96
           +L     GI ++ V  P DT   R+ ++   +G    + +++  E      G   F   +
Sbjct: 14  LLGSASAGILEIGVFHPVDTISKRLMSNHTKIGNSHELNRVIFREHFSEPLGKRLF---T 70

Query: 97  LIPIVGVGACVSV-----QFG----VNEAM-KRFFREWNTSRGTQHRDGTLQLGQYYICG 146
           L P +G  A   V     ++G     NE + K + ++++++ G +            + G
Sbjct: 71  LFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDSAFGEKTGKAMRSATAGSLIG 130

Query: 147 LTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRA 206
                +   +  P++ ++I+ QT     N   FKG      K++K++ +    R     A
Sbjct: 131 -----IGEIVLLPLDVLKIKRQT-----NPEAFKG--RGFVKILKDEGIFNLYRGWGWTA 178

Query: 207 G-HGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIY-PLDVVKSMI 264
             +  G + L      A E   G +    ASW      S+ G    L +  PLDV+K+ I
Sbjct: 179 ARNAPGSFALFGGNAFAKEYILGLEDYSQASWSQNFISSIVGASCSLIVSAPLDVIKTRI 238

Query: 265 QTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAP 307
           Q  +  NP    +   ++ + ++ +GI+AFFKG  P +L   P
Sbjct: 239 QNRSFDNPE---TGLTIVKNTFKNEGITAFFKGLTPKLLTTGP 278

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 41  KDILAGTCGGISQVIVGQPFDTTKVRMQTSA--KSVGALDIIRKLVKNEGVWAFYKGSLI 98
           ++ ++   G    +IV  P D  K R+Q  +       L I++   KNEG+ AF+KG   
Sbjct: 212 QNFISSIVGASCSLIVSAPLDVIKTRIQNRSFDNPETGLTIVKNTFKNEGITAFFKGLTP 271

Query: 99  PIVGVGACVSVQFGVNEAM 117
            ++  G  +   F + +++
Sbjct: 272 KLLTTGPKLVFSFALAQSL 290

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/305 (20%), Positives = 118/305 (38%), Gaps = 28/305 (9%)

Query: 37  TRVLKDILAGTCGGISQVIVGQPFDTTKVRMQT----------SAKSVGALDIIRKLVKN 86
           +  L D L G            P +  K+ +Q             K  G LD  ++    
Sbjct: 21  SNFLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQ 80

Query: 87  EGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQ-LGQYYIC 145
           EGV +F++G+   ++      ++ F   + +K  F       G +  +G  +        
Sbjct: 81  EGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMF-------GFKKEEGYAKWFAGNLAS 133

Query: 146 GLTGGVVNSFLASPIEHVRIRLQTQTGN---GNEREFKGPLDCIRKLVKEKS---LMRGL 199
           G   G ++      +++ R RL   + +   G  R+F G +D  +K +K      L RG 
Sbjct: 134 GGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGF 193

Query: 200 RPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDV 259
            P ++      G YF  Y++L    +    + S +AS+ L   G +         YPLD 
Sbjct: 194 LPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASFLL---GWVVTTGASTCSYPLDT 250

Query: 260 VKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELV 319
           V+  +   + +  ++  +  + +  +   +G+ + FKG    +LR     G   +  +L 
Sbjct: 251 VRRRMMMTSGQAVKYDGAF-DCLRKIVAAEGVGSLFKGCGANILRGVAGAGVISMYDQLQ 309

Query: 320 MRLLG 324
           M L G
Sbjct: 310 MILFG 314

>Scas_667.4
          Length = 308

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/307 (20%), Positives = 127/307 (41%), Gaps = 27/307 (8%)

Query: 34  KDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQT----------SAKSVGALDIIRKL 83
           K+S   +  ++ G    +++     P +  K+ +Q            +K  G ++  ++ 
Sbjct: 9   KESNFAIDFLMGGVSAAVAKT-AASPIERVKLLIQNQDEMIKQGSLDSKYKGIIECFQRT 67

Query: 84  VKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYY 143
            K EG+ AF++G+   ++      ++ F   + +K  F         +   G L  G   
Sbjct: 68  AKTEGIIAFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYGKWFAGNLASG--- 124

Query: 144 ICGLTGGVVNSFLASPIEHVRIRLQT---QTGNGNEREFKGPLDCIRKLVKEK---SLMR 197
             G  GG+   F+ S +++ R RL      +  G  R++KG +D  ++ +       L R
Sbjct: 125 --GAAGGLSLLFVYS-LDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYR 181

Query: 198 GLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPL 257
           G  P ++      G YF  Y++L    +    + S +AS+ L   G +       A YPL
Sbjct: 182 GFLPSVVGIIVYRGLYFGLYDSLKPAVLTGSLEGSFLASFLL---GWIVTTGASTASYPL 238

Query: 258 DVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
           D V+  +   + +  ++  +  +    +   +G+S+ FKG    +LR     G   +  +
Sbjct: 239 DTVRRRMMMTSGQAVKYDGAF-DCFRKVVAAEGVSSLFKGCGANILRGVAGAGVISMYDQ 297

Query: 318 LVMRLLG 324
           L M + G
Sbjct: 298 LQMIMFG 304

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 77/189 (40%), Gaps = 19/189 (10%)

Query: 142 YYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRP 201
           + + G  GG+ +     P++ ++ RLQ    +            +R++   + L RG  P
Sbjct: 11  HLVSGFFGGLASVCALQPLDLLKTRLQQAQASSLR-------SVLREVRTTRELWRGTLP 63

Query: 202 MMLRAGHGLGCYF--LTYEALIANEIKKGKDRSEIASWKLCSY-----GSLSGVVLWLAI 254
             LR   G   Y   L Y         + + RS +   +L SY     G+LS   + L  
Sbjct: 64  SALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLP-RLQSYQNLLTGALSRAAVGLVT 122

Query: 255 YPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFV 314
            P+ V+K   ++         N +     H++R +G   FFKG A T LR AP  G   +
Sbjct: 123 MPITVIKVRYESTLYAY----NGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVL 178

Query: 315 TFELVMRLL 323
            +E    +L
Sbjct: 179 LYEQAKEML 187

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 28/63 (44%)

Query: 59  PFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMK 118
           PFDT K RMQ  +  VG +  +R +V  E     + G  + +        + +G+ E + 
Sbjct: 230 PFDTIKTRMQLQSHPVGFVQTLRHIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEELL 289

Query: 119 RFF 121
           +  
Sbjct: 290 KLL 292

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 65/317 (20%), Positives = 127/317 (40%), Gaps = 50/317 (15%)

Query: 32  MAKDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWA 91
           M++ +  V   +++G  GG++ V   QP D  K R+Q  A++     ++R++     +W 
Sbjct: 1   MSEKAGGVPAHLVSGFFGGLASVCALQPLDLLKTRLQ-QAQASSLRSVLREVRTTRELW- 58

Query: 92  FYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGT-----LQLGQYYICG 146
             +G+L   +      S+   +  ++  + R    +RG++ R  +     LQ  Q  + G
Sbjct: 59  --RGTLPSALR----TSIGSALYLSLLNYSRS-ALARGSEARTRSSLLPRLQSYQNLLTG 111

Query: 147 LTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMM 203
                    +  PI  +++R ++         + G  +  R + +    +   +G     
Sbjct: 112 ALSRAAVGLVTMPITVIKVRYES-----TLYAYNGLAEATRHIWRSEGARGFFKGAAATT 166

Query: 204 LRAGHGLGCYFLTYE--------ALIANEIKKGKDRSEIASWKLCSYGS--LSGVVLWLA 253
           LR     G Y L YE        AL A  +  G D S     KL +  S  ++GV  +L+
Sbjct: 167 LRDAPYAGLYVLLYEQAKEMLPRALPATLL--GADESG----KLTAPASAMVNGVSAFLS 220

Query: 254 -------IYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAA 306
                    P D +K+ +Q  +  +P         + H+  E+     F G +  + R A
Sbjct: 221 ASLATTLTAPFDTIKTRMQLQS--HP---VGFVQTLRHIVCEERARTLFDGLSLRLCRKA 275

Query: 307 PVNGATFVTFELVMRLL 323
                 +  +E +++LL
Sbjct: 276 MSACIAWGIYEELLKLL 292

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 120/287 (41%), Gaps = 39/287 (13%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKG---S 96
           L  +L     GI ++ V  P DT   R+ ++   +G+   +  ++  E           +
Sbjct: 10  LARVLGSASAGILEIGVFHPVDTISKRLMSNHTKIGSSSQLNSVIFREHAAEPLSKRVFT 69

Query: 97  LIPIVGVGACVSV-----QFG----VNEAMKRFFR-EWNTSRGTQHRDGTLQLGQYYICG 146
           L P +G  A   +     ++G     NE + R F+ +++ + G +        G+     
Sbjct: 70  LFPGLGYAATYKILQRVYKYGGQPFANEFLNRNFKADFDNTFGEK-------TGKALRSA 122

Query: 147 LTGGVVN--SFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSL--MRGLRPM 202
             G ++     +  P++ ++I+ QT     N   FKG      K++K++ L   RG    
Sbjct: 123 TAGSMIGIGEIVLLPLDVLKIKRQT-----NPEAFKG--RGFVKILKDEGLGLYRGWGWT 175

Query: 203 MLRAGHGLGCYFLTYEALIANEIKKG-KDRSEIASWKLCSYGSLSGVVLWLAI-YPLDVV 260
             R  +  G + L      A E   G KD S+ A+W      S+ G    L I  PLDV+
Sbjct: 176 AAR--NAPGSFALFGGNAFAKEYILGLKDYSQ-ATWSQNFVSSIVGASASLIISAPLDVI 232

Query: 261 KSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAP 307
           K+ IQ     NP    S   ++ +  + +G SAFFKG  P +L   P
Sbjct: 233 KTRIQNKNFENPE---SGFTIVKNTLKNEGFSAFFKGLTPKLLTTGP 276

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 36/79 (45%), Gaps = 2/79 (2%)

Query: 41  KDILAGTCGGISQVIVGQPFDTTKVRMQTS--AKSVGALDIIRKLVKNEGVWAFYKGSLI 98
           ++ ++   G  + +I+  P D  K R+Q            I++  +KNEG  AF+KG   
Sbjct: 210 QNFVSSIVGASASLIISAPLDVIKTRIQNKNFENPESGFTIVKNTLKNEGFSAFFKGLTP 269

Query: 99  PIVGVGACVSVQFGVNEAM 117
            ++  G  +   F + + +
Sbjct: 270 KLLTTGPKLVFSFALAQTL 288

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/299 (21%), Positives = 120/299 (40%), Gaps = 37/299 (12%)

Query: 49  GGISQVIV---GQPFDTTKVRMQT----------SAKSVGALDIIRKLVKNEGVWAFYKG 95
           GG+S  I      P +  K+ +Q             K  G +D  ++  K EG+ +F++G
Sbjct: 19  GGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQEGLISFWRG 78

Query: 96  SLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYI----CGLTGGV 151
           +   ++      ++ F   + +K  F       G +  +G    G+++      G   G 
Sbjct: 79  NTANVIRYFPTQALNFAFKDKIKLMF-------GFKKEEG---YGKWFAGNLASGGAAGA 128

Query: 152 VNSFLASPIEHVRIRLQTQ---TGNGNEREFKGPLDCIRKLVKEKS---LMRGLRPMMLR 205
           ++      ++  R RL      +  G  R+F G  D  +K +K      L RG  P ++ 
Sbjct: 129 LSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVG 188

Query: 206 AGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQ 265
                G YF  +++L    +    D S +AS+ L   G +         YPLD V+  + 
Sbjct: 189 IVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLL---GWVVTTGASTCSYPLDTVRRRMM 245

Query: 266 TDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
             + +  ++ N   + +  +   +G+ + FKG    +LR+    G   +  +L M L G
Sbjct: 246 MTSGQAVKY-NGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVISMYDQLQMILFG 303

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 82/181 (45%), Gaps = 30/181 (16%)

Query: 46  GTCGGISQVIVGQPFDTTKVRMQTSAKSV---------GALDIIRKLVKNEGVWAFYKGS 96
           G  G +S + V    D  + R+   AKS          G  D+ +K +K++G+   Y+G 
Sbjct: 124 GAAGALSLLFV-YSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGF 182

Query: 97  LIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVN--- 153
           +  +VG+     + FG+ +++K                G+L  G +    L G VV    
Sbjct: 183 MPSVVGIVVYRGLYFGMFDSLKPLVLT-----------GSLD-GSFLASFLLGWVVTTGA 230

Query: 154 SFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLRAGHGL 210
           S  + P++ VR R+   +  G   ++ G +DC++K+V  +   SL +G    +LR+  G 
Sbjct: 231 STCSYPLDTVRRRMMMTS--GQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGA 288

Query: 211 G 211
           G
Sbjct: 289 G 289

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 88/206 (42%), Gaps = 30/206 (14%)

Query: 134 DGTLQLGQYYICGLTGGV---VNSFLASPIEHVRIRLQTQ---TGNGN-EREFKGPLDCI 186
           D   Q   + I  L GGV   +    ASPIE V+I +Q Q      G  ++++ G +DC 
Sbjct: 4   DAKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCF 63

Query: 187 RKLVKEKSLM---RGLRPMMLRAGHGLGCYFLTYEALIANE--------IKKGKDRSEIA 235
           ++  K++ L+   RG    ++R       YF T     A +         KK +   +  
Sbjct: 64  KRTAKQEGLISFWRGNTANVIR-------YFPTQALNFAFKDKIKLMFGFKKEEGYGKWF 116

Query: 236 SWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRN----PRFKNSMKNVINHLYREQGI 291
           +  L S G  +G +  L +Y LD  ++ +  D   +     R  N + +V     +  GI
Sbjct: 117 AGNLAS-GGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGI 175

Query: 292 SAFFKGFAPTMLRAAPVNGATFVTFE 317
           +  ++GF P+++      G  F  F+
Sbjct: 176 AGLYRGFMPSVVGIVVYRGLYFGMFD 201

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 77/185 (41%), Gaps = 16/185 (8%)

Query: 143 YICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLR-- 200
           ++ G  GG++       ++ V+ R   Q G  N  ++K  L   R +  E+   RGL   
Sbjct: 57  FLAGGVGGIIGDSAMHSLDTVKTR---QQGAPNVHKYKHMLQAYRTMFIEEGFRRGLYGG 113

Query: 201 --PMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLD 258
               ML +      +F TYE      I    D     ++   + G L          P +
Sbjct: 114 YCAAMLGSFPSAAIFFSTYEFTKRTMIN---DYHLNDTFSHLTAGFLGDFFSSFVYVPSE 170

Query: 259 VVKSMIQTD-TLRNPRFKN-----SMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGAT 312
           V+K+ +Q      NP F +     S++N I  +YR +G++A F G+  T+ R  P +   
Sbjct: 171 VLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLARDLPFSALQ 230

Query: 313 FVTFE 317
           F  +E
Sbjct: 231 FAFYE 235

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 95/260 (36%), Gaps = 30/260 (11%)

Query: 43  ILAGTCGGISQVIVGQPFDTTKVRMQTSA---KSVGALDIIRKLVKNEGV-WAFYKGSLI 98
            LAG  GGI         DT K R Q +    K    L   R +   EG     Y G   
Sbjct: 57  FLAGGVGGIIGDSAMHSLDTVKTRQQGAPNVHKYKHMLQAYRTMFIEEGFRRGLYGGYCA 116

Query: 99  PIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLAS 158
            ++G     ++ F   E  KR      T     H + T     +   G  G   +SF+  
Sbjct: 117 AMLGSFPSAAIFFSTYEFTKR------TMINDYHLNDTF---SHLTAGFLGDFFSSFVYV 167

Query: 159 PIEHVRIRLQTQ--------TGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGL 210
           P E ++ RLQ Q            N +  +  +  I +     +L  G +  + R     
Sbjct: 168 PSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLARDLPFS 227

Query: 211 GCYFLTYEALIANE-IKKGKD--RSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQT- 266
              F  YE       + +GKD  + +++       G+ +G +  +   PLDVVK+ +QT 
Sbjct: 228 ALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILTTPLDVVKTRVQTQ 287

Query: 267 -----DTLRNPRFKNSMKNV 281
                D   + + KN  K V
Sbjct: 288 LPSQIDISTDTKIKNVSKPV 307

>Kwal_26.7972
          Length = 358

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 66/332 (19%), Positives = 131/332 (39%), Gaps = 68/332 (20%)

Query: 34  KDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAK-----SVGALDIIR---KLVK 85
           + +  +L+  LAG   G     +  P D  K+  QTS       S   + +IR    +  
Sbjct: 22  RSAHYILRSGLAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINA 81

Query: 86  NEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFF---REWNTSRGTQHRDGTLQLGQY 142
           ++G+  FY+G    ++ +    +++F   E ++ F    +E+ T              + 
Sbjct: 82  HDGIRGFYQGHSATLIRIFPYAAIKFIAYEQIRHFMIPSKEYETH------------ARR 129

Query: 143 YICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKS-------- 194
              G   G+ + F+  P++ +R+RL   T    +R     L  I+++  E++        
Sbjct: 130 LASGSMAGLCSVFMTYPLDLIRVRLAYVT----DRSRIKMLPVIKQIYTERASESLTSKS 185

Query: 195 -----------LMRGLRPMMLRAGHGLGCYFLTYE---------AL-------IANE--- 224
                        RG  P +L      G  F  ++         AL       I++E   
Sbjct: 186 YVPRWFAHWCNFYRGFTPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELT 245

Query: 225 IKKGKDRSE-IASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKN--SMKNV 281
           I+  K  S  + +W     G L+G+    A YP ++++  +Q   +      N  ++ ++
Sbjct: 246 IRSKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDM 305

Query: 282 INHLYREQGISAFFKGFAPTMLRAAPVNGATF 313
           I  +Y+E+G   FF G +   ++  P+   +F
Sbjct: 306 IRIIYKERGWRGFFVGLSIGYIKVTPMVACSF 337

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 85/199 (42%), Gaps = 34/199 (17%)

Query: 146 GLTGGVVNS---FLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLR-- 200
           GL GG+  S    L +P++  RI++  QT N +  ++ G    + +     +   G+R  
Sbjct: 31  GLAGGIAGSCAKTLIAPLD--RIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGF 88

Query: 201 -----PMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIY 255
                  ++R        F+ YE +    I   +   E  + +L S GS++G+      Y
Sbjct: 89  YQGHSATLIRIFPYAAIKFIAYEQIRHFMIPSKE--YETHARRLAS-GSMAGLCSVFMTY 145

Query: 256 PLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISA----------------FFKGFA 299
           PLD+++  +   T R+ R K  M  VI  +Y E+   +                F++GF 
Sbjct: 146 PLDLIRVRLAYVTDRS-RIK--MLPVIKQIYTERASESLTSKSYVPRWFAHWCNFYRGFT 202

Query: 300 PTMLRAAPVNGATFVTFEL 318
           PT+L   P  G +F   +L
Sbjct: 203 PTVLGMIPYAGVSFFAHDL 221

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 47/105 (44%), Gaps = 13/105 (12%)

Query: 34  KDSTRVLK---DILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGAL-------DIIRKL 83
           K S+R LK   +++AG   G++      PF+  + R+Q S  S  ++       D+IR +
Sbjct: 250 KQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRII 309

Query: 84  VKNEGVWAFYKG---SLIPIVGVGACVSVQFGVNEAMKRFFREWN 125
            K  G   F+ G     I +  + AC   +   NE +  + R + 
Sbjct: 310 YKERGWRGFFVGLSIGYIKVTPMVACSFFRLRKNEVVSEYLRTYT 354

>Scas_717.20
          Length = 356

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 69/333 (20%), Positives = 131/333 (39%), Gaps = 66/333 (19%)

Query: 44  LAGTCGGISQVIVGQPFDTTKVRMQTS----AKSVGALDIIRKLVK----NEGVWAFYKG 95
           LAG   G     +  P D  K+  QTS     K  G+L  +++  K    N+G+  F++G
Sbjct: 37  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQG 96

Query: 96  SLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSF 155
             + ++ +    +V+F   E ++      NT   ++  +   +     + G   G+ + F
Sbjct: 97  HSVTLMRIFPYAAVKFVAYEQIR------NTLIPSKEYESHWRR---LMSGSLAGLCSVF 147

Query: 156 LASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKS-------------------LM 196
              P++ +R+RL   T    E +    L  ++ + KE +                     
Sbjct: 148 TTYPLDLIRVRLAYVT----EHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFY 203

Query: 197 RGLRPMMLRAGHGLGCYFLT---------------YEALIANEIKKGK-----DRSEIAS 236
           RG  P +L      G  F                 Y  L  +E ++ +      R  + +
Sbjct: 204 RGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERHFKHQRLPLRT 263

Query: 237 WKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLR-----NPRFKNSMKNVINHLYREQGI 291
           W     G L+G+    A YP ++++  +Q  TL      + RF+ S+  +   +Y+E+G 
Sbjct: 264 WAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQ-SISEIAKIIYKERGW 322

Query: 292 SAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
             FF G +   ++  P+   +F  +E +   LG
Sbjct: 323 RGFFVGLSIGYIKVTPMVACSFFVYERMKWHLG 355

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 89/206 (43%), Gaps = 38/206 (18%)

Query: 146 GLTGGVVNS---FLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPM 202
           GL GG+  S    L +P++  RI++  QT N +  ++ G L  +++  K   L  G+R  
Sbjct: 36  GLAGGISGSCAKTLIAPLD--RIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGF 93

Query: 203 MLRAGHGL---------GCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLA 253
               GH +            F+ YE  I N +   K+    + W+    GSL+G+     
Sbjct: 94  F--QGHSVTLMRIFPYAAVKFVAYEQ-IRNTLIPSKEYE--SHWRRLMSGSLAGLCSVFT 148

Query: 254 IYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISA----------------FFKG 297
            YPLD+++  +   T      + S+  ++  +Y+E   +                 F++G
Sbjct: 149 TYPLDLIRVRLAYVTEHK---RISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYRG 205

Query: 298 FAPTMLRAAPVNGATFVTFELVMRLL 323
           + PT+L   P  G +F   +L+  +L
Sbjct: 206 YTPTVLGMIPYAGVSFFAHDLLHDVL 231

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 39/90 (43%), Gaps = 9/90 (10%)

Query: 38  RVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGAL---------DIIRKLVKNEG 88
           R   ++L+G   G++      PF+  + R+Q S  SV  +         +I + + K  G
Sbjct: 262 RTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERG 321

Query: 89  VWAFYKGSLIPIVGVGACVSVQFGVNEAMK 118
              F+ G  I  + V   V+  F V E MK
Sbjct: 322 WRGFFVGLSIGYIKVTPMVACSFFVYERMK 351

 Score = 35.0 bits (79), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 41/226 (18%), Positives = 81/226 (35%), Gaps = 38/226 (16%)

Query: 33  AKDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQ--TSAKSVGALDIIRKLVKNEGV- 89
           +K+     + +++G+  G+  V    P D  +VR+   T  K +  L +++ + K     
Sbjct: 125 SKEYESHWRRLMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPAST 184

Query: 90  --------------WA-FYKGSLIPIVGVGACVSVQFGVNEAMKRFFRE----------- 123
                         W  FY+G    ++G+     V F  ++ +    +            
Sbjct: 185 TLEAKGYIPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLAL 244

Query: 124 ---WNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQT---GNGNER 177
                  R  +H+   L+     + G   G+ +   A P E +R RLQ  T       + 
Sbjct: 245 SESEQEERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDH 304

Query: 178 EFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGLGCYFLTYEAL 220
            F+   +  + + KE   +    GL    ++    + C F  YE +
Sbjct: 305 RFQSISEIAKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYERM 350

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 71/317 (22%), Positives = 126/317 (39%), Gaps = 56/317 (17%)

Query: 55  IVGQPFDTTKVRMQ-------------------TSAKSVG-----------ALDIIRKLV 84
           +V  PFD  K R+Q                   T  KS+             L II  + 
Sbjct: 68  VVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVY 127

Query: 85  KNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYI 144
           K EG  + +KG    +VGV    S+ F      K  +            +G      + +
Sbjct: 128 KQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMY-------AKAFNNGQETPMIHLM 180

Query: 145 CGLTGGVVNSFLASPIEHVRIRLQ-TQTGNGNEREFKGPLDCIRKLVKEKS---LMRGLR 200
              T G   +   +PI  ++ R+Q  + G  + R++K   DC++ +++ +    L +GL 
Sbjct: 181 AAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLS 240

Query: 201 PMMLRAGHGLGCYFLTYEAL-----------IANEIKKGKDRSE-IASW-KLCSYGSLSG 247
              L +  G+   +L YE +              + +  K  SE +  W +      L+ 
Sbjct: 241 ASYLGSVEGI-LQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGLAK 299

Query: 248 VVLWLAIYPLDVVKSMI-QTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAA 306
            V  +A YP +VV++ + QT      R    +      + +E+G+ + + G  P ++R  
Sbjct: 300 FVASIATYPHEVVRTRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTV 359

Query: 307 PVNGATFVTFELVMRLL 323
           P +   F T+E+V+RLL
Sbjct: 360 PNSIIMFGTWEIVIRLL 376

>Kwal_55.21106
          Length = 328

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 112/254 (44%), Gaps = 28/254 (11%)

Query: 76  ALDIIRKLVKNEGVWAFYKGSLIPIV-GVGACVSVQFGVNEAMKRFFREWNTSRGTQHRD 134
           +LD + K+ K +GV   Y+G    I+ G     S  F  +   K FFR +   RG   R 
Sbjct: 63  SLDALIKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFR-YKLLRG---RL 118

Query: 135 GTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKS 194
           G     +  + G+    V+    SPI  +  R QT T +G++  F+   + + ++  E++
Sbjct: 119 GKFSTPEELLLGIVAAAVSQIFTSPIGVISTRQQTST-SGSKGGFR---EVLHQIYSEQN 174

Query: 195 ----LMRGLRPMMLRAGHGLGCYFLTYEAL--IANEIKKGKDRS--------EIASWKLC 240
                 RG +  ++   +     F +YE L  I    K+  D +        +++  +  
Sbjct: 175 NITGFWRGFKVSLILTVNP-SITFASYEKLQDIFITSKRAVDENGQLLETSGQLSPRQNF 233

Query: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300
             G  S V+  L   PL V K+ +Q    R      S + V+ +LY+++G+ + +KG AP
Sbjct: 234 LLGVFSKVISTLITQPLIVSKAYLQ----RTGSNFQSFQQVLLYLYKQEGLISLWKGLAP 289

Query: 301 TMLRAAPVNGATFV 314
            + +   V G  F+
Sbjct: 290 QLSKGILVQGLLFM 303

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/97 (21%), Positives = 47/97 (48%), Gaps = 24/97 (24%)

Query: 244 SLSGVVLWLAIYPLDVVKSMIQTDT-------------------LRNPRFKNSMKNVINH 284
           SL+ VV    +YPLD+VK++IQT                     ++  R+K+S+  +I  
Sbjct: 15  SLANVV----VYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDALIK- 69

Query: 285 LYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMR 321
           +++ +G+   ++G   +++     + + F  + +V +
Sbjct: 70  IFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRK 106

>Scas_721.129
          Length = 323

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 83/189 (43%), Gaps = 27/189 (14%)

Query: 38  RVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV---------GALDIIRKLVKNEG 88
           +V  ++ AG   GI   ++G P    K RMQ+ + ++            + +  + + EG
Sbjct: 126 KVSINVAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEG 185

Query: 89  VWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGT-LQLGQYYICGL 147
               ++G    I+  GA  SVQ  +    K F  + +       +DG  L L    I GL
Sbjct: 186 FKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLKNDL-----MKDGPGLHLTASTISGL 240

Query: 148 TGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMML 204
              VV     +P + +  R+  Q GN     +KGP+DC  K V+ +   +L +G +  +L
Sbjct: 241 GVAVV----MNPWDVILTRIYNQKGN----LYKGPVDCFVKTVRTEGISALYKGFQAQIL 292

Query: 205 R-AGHGLGC 212
           R A H + C
Sbjct: 293 RIAPHTIIC 301

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/304 (21%), Positives = 123/304 (40%), Gaps = 41/304 (13%)

Query: 44  LAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRK--------LVKNEGVWAFYKG 95
           +AG       V    P +  K+RMQ   +       + +        + +NEG+    KG
Sbjct: 26  IAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIRGLQKG 85

Query: 96  SLIPIVGVGACVSVQFGVNEAMKRFFR----EWNTSRGTQHRDGTLQLGQYYIC-GLTGG 150
            +       A    Q G+N +   F+       N++         +Q     +  G + G
Sbjct: 86  LV-------AAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGASSG 138

Query: 151 VVNSFLASPIEHVRIRLQTQTGN---GNEREFKGPLDCIRKLVKE---KSLMRGLRPMML 204
           ++ + + SP+  V+ R+Q+ +     G +  ++   + +  + +    K L RG+   +L
Sbjct: 139 IIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAIL 198

Query: 205 RAGHG----LGCYFLTYEALIANEI-KKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDV 259
           R G G    L  Y      L+ N++ K G      AS       ++SG+ + + + P DV
Sbjct: 199 RTGAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTAS-------TISGLGVAVVMNPWDV 251

Query: 260 VKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELV 319
           + + I     +   +K  +   +  + R +GISA +KGF   +LR AP         E  
Sbjct: 252 ILTRIYNQ--KGNLYKGPVDCFVKTV-RTEGISALYKGFQAQILRIAPHTIICLTFMEQT 308

Query: 320 MRLL 323
           M+L+
Sbjct: 309 MKLV 312

 Score = 32.3 bits (72), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 82/178 (46%), Gaps = 19/178 (10%)

Query: 143 YICGLTGGVVNSFLASPIEHVRIRLQTQ--TGNGNEREFKGPLDCIRKLVKEKSLMRGLR 200
           +I G     +     +PIE V+IR+Q Q       ++ ++ P+  +  + + + + RGL+
Sbjct: 25  FIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGI-RGLQ 83

Query: 201 PMMLRA--------GHGLGCYFLTYEALIANEIKKGKDRSEIASWKL-CSYGSLSGVVLW 251
             ++ A        G  LG Y     AL  +     ++  +I    +  + G+ SG++  
Sbjct: 84  KGLVAAYIYQIGLNGSRLGFYEPIRNAL-NSTFYPNEESHKIQKVSINVAAGASSGIIGA 142

Query: 252 LAIYPLDVVKSMIQ--TDTLR---NPRFKNSMKNVINHLYREQGISAFFKGFAPTMLR 304
           +   PL +VK+ +Q  +D ++      ++N + N ++ + R +G    F+G    +LR
Sbjct: 143 VIGSPLFLVKTRMQSYSDAIKIGEQTHYRN-VWNGLSTIARTEGFKGLFRGIDAAILR 199

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 63/318 (19%), Positives = 125/318 (39%), Gaps = 48/318 (15%)

Query: 39  VLKDILAGTCGGISQVIVGQPFDTTKVRMQTS-------AKSVGALDIIRK-LVKNEGVW 90
           ++K  LAG   G     +  P D  K+  QTS       A S+G L    K ++ ++G  
Sbjct: 19  IVKSGLAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPR 78

Query: 91  AFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGG 150
            F++G    ++ +    +++F   E ++       T R   H    L        G   G
Sbjct: 79  GFFQGHSATLLRIFPYAAIKFIAYEQIRSVVIP--TWRHESHWRRLLS-------GSLAG 129

Query: 151 VVNSFLASPIEHVRIRLQ--TQTGNGNEREFKG------PLDCIRK------LVKEKSLM 196
           + + F+  P++ VR+RL   T+  +   R+         P + +RK           +  
Sbjct: 130 LCSVFVTYPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQWFAHWSNFY 189

Query: 197 RGLRPMMLRAGHGLGCYFLTYE--------------ALIANEIKKGKDRS-EIASWKLCS 241
           RG  P ++      G  F  ++              ++++       DR+  + +W    
Sbjct: 190 RGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQLV 249

Query: 242 YGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKN--SMKNVINHLYREQGISAFFKGFA 299
            G L+G+    A YP ++++  +Q   + +P  ++   +  +   +Y E G   FF G +
Sbjct: 250 AGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGWRGFFVGLS 309

Query: 300 PTMLRAAPVNGATFVTFE 317
              ++  P+   +F  +E
Sbjct: 310 IGYIKVTPMVACSFFIYE 327

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 83/198 (41%), Gaps = 33/198 (16%)

Query: 146 GLTGGVVNS---FLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVK-------EKSL 195
           GL GG+  S    L +P++  RI++  QT N    +F G +  + +  K        +  
Sbjct: 23  GLAGGIAGSCAKTLVAPLD--RIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGF 80

Query: 196 MRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIY 255
            +G    +LR        F+ YE + +  I   +  S    W+    GSL+G+      Y
Sbjct: 81  FQGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESH---WRRLLSGSLAGLCSVFVTY 137

Query: 256 PLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISA---------------FFKGFAP 300
           PLD+V+  +   T R+      ++ ++  +Y E+   A               F++G+ P
Sbjct: 138 PLDLVRVRLAYVTERH---DAKVRKIMACIYNERPSEALRKWYIPQWFAHWSNFYRGYTP 194

Query: 301 TMLRAAPVNGATFVTFEL 318
           T++   P  G +F   +L
Sbjct: 195 TVIGMIPYAGVSFFAHDL 212

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 3/80 (3%)

Query: 243 GSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVI---NHLYREQGISAFFKGFA 299
           G ++G      + PLD +K + QT   +  +F  SM  ++    ++    G   FF+G +
Sbjct: 26  GGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFFQGHS 85

Query: 300 PTMLRAAPVNGATFVTFELV 319
            T+LR  P     F+ +E +
Sbjct: 86  ATLLRIFPYAAIKFIAYEQI 105

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 79/177 (44%), Gaps = 12/177 (6%)

Query: 144 ICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLR 200
           + G   G++   L  PI+ ++ R+Q      N+    G +  I K+   +   +L +G++
Sbjct: 28  LAGAFAGIMEHSLMFPIDALKTRVQA--AGLNKAASTGMISQISKISTMEGSMALWKGVQ 85

Query: 201 PMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVV 260
            ++L AG     YF TYE   A  I   +D       K    G+++ +     + P D V
Sbjct: 86  SVILGAGPAHAVYFGTYEFCKARLISP-EDMQTHQPMKTALSGTIATIAADALMNPFDTV 144

Query: 261 KSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
           K  +Q DT  N R    + NV   +Y+ +G +AF+  +  T+    P     F+ +E
Sbjct: 145 KQRLQLDT--NLR----VWNVTKQIYQNEGFAAFYYSYPTTLAMNIPFAAFNFMIYE 195

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 113/296 (38%), Gaps = 34/296 (11%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTS----AKSVGALDIIRKLVKNEGVWAFYKGSL 97
            +LAG   GI +  +  P D  K R+Q +    A S G +  I K+   EG  A +KG  
Sbjct: 26  QLLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQISKISTMEGSMALWKGVQ 85

Query: 98  IPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRD-GTLQLGQYYICGLTGGVVNSFL 156
             I+G G   +V FG  E  K        +R     D  T Q  +  + G    +    L
Sbjct: 86  SVILGAGPAHAVYFGTYEFCK--------ARLISPEDMQTHQPMKTALSGTIATIAADAL 137

Query: 157 ASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGL---RPMMLRAGHGLGCY 213
            +P + V+ RLQ  T   N R +      + K + +           P  L        +
Sbjct: 138 MNPFDTVKQRLQLDT---NLRVWN-----VTKQIYQNEGFAAFYYSYPTTLAMNIPFAAF 189

Query: 214 -FLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQ-----TD 267
            F+ YE+  A++    ++        LC  G +SG        PLD +K+++Q     T 
Sbjct: 190 NFMIYES--ASKFFNPQNSYNPLIHCLC--GGISGATCAALTTPLDCIKTVLQVRGSETV 245

Query: 268 TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
           ++   +  N+       +    G   F++G  P ++   P    ++  +E     L
Sbjct: 246 SIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYECAKHFL 301

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 40/186 (21%), Positives = 74/186 (39%), Gaps = 18/186 (9%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIP 99
           +K  L+GT   I+   +  PFDT K R+Q    ++   ++ +++ +NEG  AFY      
Sbjct: 121 MKTALSGTIATIAADALMNPFDTVKQRLQLD-TNLRVWNVTKQIYQNEGFAAFYYSYPTT 179

Query: 100 IVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASP 159
           +       +  F + E+  +FF   N+     H           +CG   G   + L +P
Sbjct: 180 LAMNIPFAAFNFMIYESASKFFNPQNSYNPLIH----------CLCGGISGATCAALTTP 229

Query: 160 IEHVRIRLQTQTGNG-------NEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGC 212
           ++ ++  LQ +           +   F      I ++   K   RGL+P ++        
Sbjct: 230 LDCIKTVLQVRGSETVSIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAI 289

Query: 213 YFLTYE 218
            +  YE
Sbjct: 290 SWTAYE 295

 Score = 34.7 bits (78), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 45/103 (43%), Gaps = 1/103 (0%)

Query: 216 TYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFK 275
           T E  IA EI      S          G+ +G++    ++P+D +K+ +Q   L N    
Sbjct: 3   TSELSIAEEIDYEALPSHAPLHSQLLAGAFAGIMEHSLMFPIDALKTRVQAAGL-NKAAS 61

Query: 276 NSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFEL 318
             M + I+ +   +G  A +KG    +L A P +   F T+E 
Sbjct: 62  TGMISQISKISTMEGSMALWKGVQSVILGAGPAHAVYFGTYEF 104

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 115/280 (41%), Gaps = 30/280 (10%)

Query: 43  ILAGTCGGISQVIVGQPFDTTKVR-MQTSAKSVGALDIIRKLVKNEGVWAFYKG--SLIP 99
           +L     GI ++ V  P DT   R M    K      +   + ++    AF K   +L P
Sbjct: 14  LLGSASAGILEIGVFHPVDTISKRLMSNHTKITSGAQLNSVIFRDHAAEAFGKRVFTLFP 73

Query: 100 IVGVGACVSV-----QFG----VNEAM-KRFFREWNTSRGTQHRDGTLQLGQYYICGLTG 149
            +G  A   +     ++G     NE + K F ++++++ G    D T +  +    G   
Sbjct: 74  GLGYAAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAFG----DKTGKALRSATAGSLI 129

Query: 150 GVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAG-H 208
           G+    L  P++ ++I+ QT     N   FKG      K++K++ +    R     A  +
Sbjct: 130 GIGEIVLL-PLDVLKIKRQT-----NPEAFKG--RGFLKILKDEGIFNLYRGWGWTAARN 181

Query: 209 GLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAI-YPLDVVKSMIQTD 267
             G + L      A E   G      A+W      S+ G    L +  PLDV+K+ IQ  
Sbjct: 182 APGSFALFGGNAFAKEYILGLQDYSQATWSQNFISSIVGASASLIVSAPLDVIKTRIQNR 241

Query: 268 TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAP 307
              NP    S   ++ +  + +G +AFFKG  P +L   P
Sbjct: 242 NFDNPE---SGFKIVKNTLKNEGFTAFFKGLTPKLLTTGP 278

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 37/79 (46%), Gaps = 2/79 (2%)

Query: 41  KDILAGTCGGISQVIVGQPFDTTKVRMQTSA--KSVGALDIIRKLVKNEGVWAFYKGSLI 98
           ++ ++   G  + +IV  P D  K R+Q            I++  +KNEG  AF+KG   
Sbjct: 212 QNFISSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIVKNTLKNEGFTAFFKGLTP 271

Query: 99  PIVGVGACVSVQFGVNEAM 117
            ++  G  +   F + +++
Sbjct: 272 KLLTTGPKLVFSFALAQSL 290

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 78/181 (43%), Gaps = 30/181 (16%)

Query: 143 YICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPM 202
           +I G   G V+  + SP E V+I LQ Q+         G ++ + ++ KE+ +    R  
Sbjct: 15  FIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNH--GIINAVGQVYKEEGVAGLFR-- 70

Query: 203 MLRAGHGLGCY---------FLTYEALIAN--EIKKGKDRSEIASWKLCSYGSLSGVVLW 251
               G+GL C          F+ YE    +   +     + ++ +W+  S G+L G +  
Sbjct: 71  ----GNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSV 126

Query: 252 LAIYPLDVVKSMIQTDTLRNPRF-KNSMKNV----------INHLYREQGISAFFKGFAP 300
           LA YPLD+V++ +   T    +  K+  K++          +     E GI   ++G  P
Sbjct: 127 LATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRGIYP 186

Query: 301 T 301
           T
Sbjct: 187 T 187

 Score = 49.3 bits (116), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 82/171 (47%), Gaps = 20/171 (11%)

Query: 43  ILAGTCGGISQVIVGQPFDTTKVRMQ----TSAKSVGALDIIRKLVKNEGVWAFYKGSLI 98
           I  G  G +S+ +V  PF+  K+ +Q    TSA + G ++ + ++ K EGV   ++G+ +
Sbjct: 16  IAGGVAGAVSRTVV-SPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGL 74

Query: 99  PIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLAS 158
             V +    +VQF V E  K+     +   GT  ++  L   +     L GG+  S LA+
Sbjct: 75  NCVRIFPYSAVQFVVYEWCKKHIFHVD---GTVGKEQLLNWQRLSAGALCGGM--SVLAT 129

Query: 159 -PIEHVRIRLQTQTGN------GNEREFKGP---LDCIRKLVKEKSLMRGL 199
            P++ VR RL  QT N         ++   P    + + K  KE+  +RGL
Sbjct: 130 YPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGL 180

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 243 GSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTM 302
           G ++G V    + P + VK ++Q  +     + + + N +  +Y+E+G++  F+G     
Sbjct: 18  GGVAGAVSRTVVSPFERVKILLQVQS-STSAYNHGIINAVGQVYKEEGVAGLFRGNGLNC 76

Query: 303 LRAAPVNGATFVTFE 317
           +R  P +   FV +E
Sbjct: 77  VRIFPYSAVQFVVYE 91

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/273 (21%), Positives = 112/273 (41%), Gaps = 35/273 (12%)

Query: 75  GALDIIRKLVKNEGVWAFYKG-SLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHR 133
           G L+   K+ K EGV   ++G S+  ++ + A V            +F  +   R     
Sbjct: 112 GTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVV-----------YFTGYEYVRDRSPL 160

Query: 134 DGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQT----QTGNGNEREFKGPLDCIRKL 189
           +G        ICG     + +   +P+E ++ +LQ+       NG+   ++   + I+  
Sbjct: 161 NGLYPTINPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSE 220

Query: 190 VK----EKSLMRGLRPMMLRAGHGLGCYFLTYE---ALIANEIKKGKDRSEIASWKLCSY 242
           +      +++ +GL   + R       Y+ +YE     +A       D++    +   + 
Sbjct: 221 IAMRGVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNS 280

Query: 243 ---GSLSGVVLWLAIYPLDVVK-----SMIQTDTLRNPRFK----NSMKNVINHLYREQG 290
              G +SG +  +  +P DV K     S++    L N   K    N+M   +N++ + +G
Sbjct: 281 FLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEG 340

Query: 291 ISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
           I A + G AP + + AP       ++EL  RL 
Sbjct: 341 IGALYTGLAPRVAKIAPSCAIMISSYELTKRLF 373

 Score = 32.3 bits (72), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 38/195 (19%), Positives = 72/195 (36%), Gaps = 47/195 (24%)

Query: 130 TQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQ-----TGNGNEREFKGPLD 184
           T     TL + +  +    G ++ S + +P++ VRIRLQ Q      G  +  E      
Sbjct: 2   TDRPPATLTIQERMMSATVGSLLTSVILTPMDVVRIRLQQQQMLADCGCADISELDD--S 59

Query: 185 CIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGS 244
            +RK + E  + R                  T E L  +++    D      W+   + +
Sbjct: 60  KVRKRISEGGVRRN-----------------TLEQLRQSKVVNRIDTVPKIFWESTCFQN 102

Query: 245 LSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLR 304
           L+                       RN +F  +++     + + +G++  ++G + T+L 
Sbjct: 103 LN----------------------CRNQKFNGTLE-AFEKIAKFEGVTTLWRGISITLLM 139

Query: 305 AAPVNGATFVTFELV 319
           A P N   F  +E V
Sbjct: 140 AIPANVVYFTGYEYV 154

>Kwal_26.7653
          Length = 325

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 82/188 (43%), Gaps = 27/188 (14%)

Query: 39  VLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV---------GALDIIRKLVKNEGV 89
           V  ++++G   GI   I+G P    K RMQ+ + ++            + +  + + EG 
Sbjct: 130 VAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGF 189

Query: 90  WAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGT-LQLGQYYICGLT 148
              Y+G    I+  GA  SVQ  +    K F  + +       ++GT L L    + G  
Sbjct: 190 KGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDL-----MKEGTGLHLVASTVSGFG 244

Query: 149 GGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLR 205
            GVV     +P + +  R+  Q GN     +KGPLDC  K V+ +   +L +G    + R
Sbjct: 245 VGVV----MNPWDVILTRVYNQKGN----LYKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296

Query: 206 -AGHGLGC 212
            A H + C
Sbjct: 297 IAPHTILC 304

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/300 (21%), Positives = 125/300 (41%), Gaps = 33/300 (11%)

Query: 44  LAGTCGGISQVIVGQPFDTTKVRMQTSAK-SVGA-------LDIIRKLVKNEGVWAFYKG 95
           +AG       V V  P +  K RMQ   + S  A       +  ++ + KNEG+    KG
Sbjct: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88

Query: 96  -SLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNS 154
            S   I  +G   S + G  E ++    +        H+   + +    + G T G++ +
Sbjct: 89  LSCAYIYQIGLNGS-RLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN--VVSGATSGIIGA 145

Query: 155 FLASPIEHVRIRLQTQTGN---GNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGH 208
            + SP+  ++ R+Q+ +     G +  +    + +  + +    K L RG+   +LR G 
Sbjct: 146 IMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205

Query: 209 G----LGCYFLTYEALIANEI-KKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSM 263
           G    L  Y      L+ +++ K+G     +AS       ++SG  + + + P DV+ + 
Sbjct: 206 GSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVAS-------TVSGFGVGVVMNPWDVILTR 258

Query: 264 IQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
           +     +   +K  +   +  + R +GI A +KGF   + R AP         E  M+++
Sbjct: 259 VYNQ--KGNLYKGPLDCFVKTV-RIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVV 315

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 78/191 (40%), Gaps = 12/191 (6%)

Query: 139 LGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKL----VKEKS 194
           L    + G   G+    +  P++ ++ RLQ             P   +R+L     +E S
Sbjct: 18  LAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEGS 77

Query: 195 --LMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWL 252
             L +G++ ++L AG     YF TYE + +  I +    S+   +K    G+ + +    
Sbjct: 78  MVLWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTAFSGATATIAADA 137

Query: 253 AIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGAT 312
            + P DV+K  IQ +T        S+ +    +Y ++G  AF+  +  T+    P     
Sbjct: 138 LMNPFDVIKQRIQLNT------NISVWDTAKRIYSKEGFQAFYSSYPTTLAINIPFAAFN 191

Query: 313 FVTFELVMRLL 323
           F  ++   R  
Sbjct: 192 FGIYDTATRYF 202

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 62/306 (20%), Positives = 114/306 (37%), Gaps = 34/306 (11%)

Query: 35  DSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQT--SAKSVGALDIIRKLVKN------ 86
           D   +   ++AG   GI++  V  P D  K R+Q   +  + G   I   +++       
Sbjct: 14  DHAPLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISA 73

Query: 87  -EGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYIC 145
            EG    +KG    ++G G   +V F   E +K F  +  TS    H   T         
Sbjct: 74  QEGSMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTA------FS 127

Query: 146 GLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSL--MRGLRPMM 203
           G T  +    L +P + ++ R+Q  T            D  +++  ++         P  
Sbjct: 128 GATATIAADALMNPFDVIKQRIQLNTN-------ISVWDTAKRIYSKEGFQAFYSSYPTT 180

Query: 204 LRAGHGLGCYFLTYEALIANEIKKGKDRSEIAS-WKLCSYGSLSGVVLWLAIYPLDVVKS 262
           L     +   F  +   I +   +  + S + + +  C  G +SG        PLD +K+
Sbjct: 181 L----AINIPFAAFNFGIYDTATRYFNPSGVYNPFIHCLCGGISGAACAGLTTPLDCIKT 236

Query: 263 MIQ---TDTLRNPRFK--NSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
            +Q   ++ +    FK  ++ K     +Y+  G   F+ G  P +L   P    ++  +E
Sbjct: 237 ALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAISWTAYE 296

Query: 318 LVMRLL 323
                L
Sbjct: 297 FAKHFL 302

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 76/186 (40%), Gaps = 21/186 (11%)

Query: 141 QYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLR 200
            + I G  GG+ ++ +  P + ++ RLQ       +    G L  IR     K L RG  
Sbjct: 9   SHLIGGFVGGLTSAIVLQPFDLLKTRLQ----QNKDTTLWGTLKEIRS---PKQLWRGAL 61

Query: 201 PMMLRAGHGLGCYFLTYEALIANEIKKGKDRS---------EIASWKLCSYGSLSGVVLW 251
           P  LR   G   Y  T   +    + KGK ++         ++  ++  + G+ +  V+ 
Sbjct: 62  PSSLRTSIGSALYLSTLN-VFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVG 120

Query: 252 LAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGA 311
               P+ ++K   ++          S+     H+Y  +GI  FF G   T++R AP  G 
Sbjct: 121 FITMPITIIKVRYESTMYSY----KSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGL 176

Query: 312 TFVTFE 317
             + +E
Sbjct: 177 YVLLYE 182

 Score = 31.2 bits (69), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 43 ILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV--GALDIIR 81
          ++ G  GG++  IV QPFD  K R+Q +  +   G L  IR
Sbjct: 11 LIGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLWGTLKEIR 51

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 110/287 (38%), Gaps = 24/287 (8%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIP 99
           L  +L+G   G S  +V  P DT K R+Q                +N G    Y+G    
Sbjct: 6   LISLLSGAAAGTSTDLVFFPIDTLKTRLQAKG----------GFFRNGGYRGVYRGLGSA 55

Query: 100 IVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASP 159
           +V      S+ F   +  K   R +   RG         +  +      G +    +  P
Sbjct: 56  VVASAPGASLFFITYDTCKAETRGF--FRGLLPSSNVADVVTHMFSSSMGEIAACMVRVP 113

Query: 160 IEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEA 219
            E V+ R QT   + +    +  L         ++L RG    ++R        F  YE 
Sbjct: 114 AEVVKQRSQTHASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQFPLYEY 173

Query: 220 LIANEIKKGKDRSE-IASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSM 278
           +   ++    D S+ +  WK    GS++G +      PLD +K+ +       P     +
Sbjct: 174 M--KKVWAELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLMLCKKSIP-----L 226

Query: 279 KNVINHLYREQGISAFFKGFAP-TMLRAAPVNGATFV-TFELVMRLL 323
             +++ +Y+E+G   FF G  P TM  +A   GA F+  +E V  LL
Sbjct: 227 GTLVSTIYKEEGFKVFFSGVGPRTMWISA--GGAIFLGIYETVHSLL 271

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 70/333 (21%), Positives = 127/333 (38%), Gaps = 66/333 (19%)

Query: 39  VLKDILAGTCGGISQVIVGQPFD--TTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGS 96
           +L  I+AG+C  + Q  +  PF+   T +++  S  +    +++ +         ++ G 
Sbjct: 94  LLAPIVAGSCASVFQTTISYPFEFLKTGLQLHRSLPNAHPFNMMHQFK------YYFSGC 147

Query: 97  LIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFL 156
               VG       +F   E   +  ++   S  +    G   L    + G   G + S  
Sbjct: 148 AALNVGTLFKTVTRFTTFEKACQLLKD--PSSPSAFISGPRLL----MAGAITGFMESLW 201

Query: 157 ASPIEHVRI-----------RLQTQTGN------GNEREFKG------------------ 181
             P E+++            R Q +  +      G++RE +                   
Sbjct: 202 VVPFENIKTTMVENALVLSGRFQKEIEDKGKAETGSKREVRATFHKQTPGISPRERLFLH 261

Query: 182 ----PLDCIRKLVKEKSLMRGLR-------PMMLRAGHGLGCYFLTYEALIANEIKKGKD 230
               P       VKE  L RGLR       P + R        F TY +L    I   K 
Sbjct: 262 YEEHPTSRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSL-KQLISPNKP 320

Query: 231 RSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQG 290
            +E  ++ L   G +S   +     P+DV+K+ +Q+       +KNS+ N    ++ E+G
Sbjct: 321 LNEYYAFVL---GFISSCAVVAVTQPIDVIKTRMQSKYAW-ANYKNSL-NCAYRIFVEEG 375

Query: 291 ISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
           I  F+KG+AP +++     G +F  ++ V  L+
Sbjct: 376 IPKFWKGWAPRLMKVGLSGGVSFGVYQYVENLI 408

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 6/91 (6%)

Query: 38  RVLKDILAGTCGGISQ---VIVGQPFDTTKVRMQTS---AKSVGALDIIRKLVKNEGVWA 91
           + L +  A   G IS    V V QP D  K RMQ+    A    +L+   ++   EG+  
Sbjct: 319 KPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEEGIPK 378

Query: 92  FYKGSLIPIVGVGACVSVQFGVNEAMKRFFR 122
           F+KG    ++ VG    V FGV + ++   +
Sbjct: 379 FWKGWAPRLMKVGLSGGVSFGVYQYVENLIK 409

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 90/222 (40%), Gaps = 34/222 (15%)

Query: 133 RDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQ----TQTGNGNEREFKGPLDCIRK 188
           RD    L   + CG T  +V +   +P+E ++ RLQ    ++     +  FK  L   R 
Sbjct: 148 RDSYPSLNPLF-CGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRN 206

Query: 189 LVKE---KSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSE-IASWKLCSY-- 242
            ++    K L +GL   + R       Y+ +YE    N      D SE    W L     
Sbjct: 207 EIRSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNF---WIDFSEQCLRWNLSPNWD 263

Query: 243 --------GSLSGVVLWLAIYPLDVVKSMIQT---------DTLRNPRFKNSMKNVINHL 285
                   GS+SG    L  +P DV K+ +Q          +TL +P+ + S + +   L
Sbjct: 264 FFINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFL 323

Query: 286 Y---REQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
           Y   + +G  A + G  P +++ AP       T+EL  RL  
Sbjct: 324 YNIKQTEGYGALYTGLIPRVMKIAPSCAIMISTYELSKRLFA 365

 Score = 32.7 bits (73), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/99 (20%), Positives = 36/99 (36%), Gaps = 17/99 (17%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQTS-----------------AKSVGALDIIRK 82
           +   + G+  G S  ++  PFD  K RMQ +                   + G    +  
Sbjct: 266 INSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYN 325

Query: 83  LVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFF 121
           + + EG  A Y G +  ++ +    ++     E  KR F
Sbjct: 326 IKQTEGYGALYTGLIPRVMKIAPSCAIMISTYELSKRLF 364

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 80/168 (47%), Gaps = 21/168 (12%)

Query: 159 PIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLRAGHGL-GCY- 213
           PI+ V+ R+Q +    N    KG +   RK++ E+   +L+ G  P +L  G+ + G + 
Sbjct: 33  PIDVVKTRIQLEPTVYN----KGMVGSFRKIIAEEGAGALLTGFGPTLL--GYSIQGAFK 86

Query: 214 FLTYEALIANEIKK-GKDRSEIASWKLCSY-GSLSGVVLW--LAIYPLDVVKSMIQTDTL 269
           F  YE      I   G D +  A +K   Y GS +       +A+ PL+  +  +    +
Sbjct: 87  FGGYEVFKKFFIDTLGYDTA--ARYKNSVYIGSAAAAEFLADIALCPLEATRIRL----V 140

Query: 270 RNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
             P F N +    + + +E+G+ +F+ GF P + +  P N A F+ FE
Sbjct: 141 SQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFE 188

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 66/278 (23%), Positives = 105/278 (37%), Gaps = 34/278 (12%)

Query: 41  KDILAGT--CGGISQVIVGQPFDTTKVRMQ--TSAKSVGALDIIRKLVKNEGVWAFYKGS 96
           K  LAG   CG     +V  P D  K R+Q   +  + G +   RK++  EG  A   G 
Sbjct: 15  KFALAGAIGCGSTHSSMV--PIDVVKTRIQLEPTVYNKGMVGSFRKIIAEEGAGALLTGF 72

Query: 97  LIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFL 156
              ++G     + +FG  E  K+FF +            ++ +G              FL
Sbjct: 73  GPTLLGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGS--------AAAAEFL 124

Query: 157 AS----PIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLRAGHG 209
           A     P+E  RIRL +Q    N     G +    +++KE+   S   G  P++ +    
Sbjct: 125 ADIALCPLEATRIRLVSQPTFAN-----GLVGGFSRILKEEGVGSFYSGFTPILFKQIPY 179

Query: 210 LGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAI----YPLDVVKSMIQ 265
               FL +E            +  ++   L +   LSG+   LA      P D + S + 
Sbjct: 180 NIAKFLVFERASELYFSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSKVN 239

Query: 266 TDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTML 303
             T + P    S   ++  L ++ G    F G  PT L
Sbjct: 240 -KTSKAP--GQSTVGLLFQLAKQLGFVGSFAGL-PTRL 273

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 110/297 (37%), Gaps = 44/297 (14%)

Query: 56  VGQPFDTTKVRMQTSAKSVGALDII---RKLVKNEGVW-AFYKGSLIPIVGVGACVSVQF 111
           V    DT K R Q +   V    +I   R L   EGV    Y G    ++G     +V F
Sbjct: 70  VMHSLDTVKTRQQGAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAVFF 129

Query: 112 GVNEAMKR-FFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQ 170
           G  E +KR    EW       H             G  G + +S +  P E ++ RLQ Q
Sbjct: 130 GTYEWVKRQMINEWQIHETYSH----------LAAGFLGDLFSSVVYVPSEVLKTRLQLQ 179

Query: 171 TGNGNEREF------KGPLDCIRKLVKEK---SLMRGLRPMMLRAGHGLGCYFLTYEA-- 219
            G  N R F      +G  D +R +V+ +   +L  G +  + R        F  YE   
Sbjct: 180 -GCYNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFR 238

Query: 220 ----LIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQT--------- 266
               L+  +   G            S G L+G++      PLDVVK+ IQT         
Sbjct: 239 KWAFLLERKPVDGHLSFTAEVVTGASAGGLAGII----TTPLDVVKTRIQTQPRGSAGTP 294

Query: 267 DTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
           D     R   S+   +  + R +G+   F G  P  +  +  +    + ++  +R L
Sbjct: 295 DASAPARLNGSIFRSLLVVLRYEGLGGAFSGVGPRFIWTSIQSSIMLLLYQTALRTL 351

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 58/141 (41%), Gaps = 15/141 (10%)

Query: 41  KDILAGTCGGISQVIVGQPFDTTKVRMQ-----------TSAKSVGALDIIRKLVKNEGV 89
             + AG  G +   +V  P +  K R+Q           +     G  D +R +V+ EGV
Sbjct: 150 SHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGV 209

Query: 90  WAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTG 149
            A + G    +       ++QF   E     FR+W      +  DG L      + G + 
Sbjct: 210 SALFFGYKATLSRDLPFSALQFAFYER----FRKWAFLLERKPVDGHLSFTAEVVTGASA 265

Query: 150 GVVNSFLASPIEHVRIRLQTQ 170
           G +   + +P++ V+ R+QTQ
Sbjct: 266 GGLAGIITTPLDVVKTRIQTQ 286

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 116/284 (40%), Gaps = 32/284 (11%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVR-MQTSAKSVGALDIIRKLVKNEGVWAFYKG--S 96
           L  +L     GI ++ V  P DT   R M    K     ++ R + ++       K   +
Sbjct: 11  LARLLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHFSEPLGKRLFT 70

Query: 97  LIPIVGVGACVSV-----QFG----VNEAM-KRFFREWNTSRGTQHRDGTLQLGQYYICG 146
           L P +G  A   V     ++G     NE + K + ++++   G +            + G
Sbjct: 71  LFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAAAGSLIG 130

Query: 147 LTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRA 206
                +   +  P++ ++I+ QT     N   FKG      K+++++ L    R     A
Sbjct: 131 -----IGEIVLLPLDVLKIKRQT-----NPESFKG--RGFIKILRDEGLFNLYRGWGWTA 178

Query: 207 G-HGLGCYFLTYEALIANEIKKG-KDRSEIASWKLCSYGSLSGVVLWLAIY-PLDVVKSM 263
             +  G + L      A E   G KD S+ A+W      S+ G    L +  PLDV+K+ 
Sbjct: 179 ARNAPGSFALFGGNAFAKEYILGLKDYSQ-ATWSQNFISSIVGACSSLIVSAPLDVIKTR 237

Query: 264 IQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAP 307
           IQ     NP    S   ++ +  + +G++AFFKG  P +L   P
Sbjct: 238 IQNRNFDNPE---SGLRIVKNTLKNEGVTAFFKGLTPKLLTTGP 278

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 41  KDILAGTCGGISQVIVGQPFDTTKVRMQTSA--KSVGALDIIRKLVKNEGVWAFYKGSLI 98
           ++ ++   G  S +IV  P D  K R+Q          L I++  +KNEGV AF+KG   
Sbjct: 212 QNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKNTLKNEGVTAFFKGLTP 271

Query: 99  PIVGVGACVSVQFGVNEAM 117
            ++  G  +   F + +++
Sbjct: 272 KLLTTGPKLVFSFALAQSL 290

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 66/309 (21%), Positives = 130/309 (42%), Gaps = 31/309 (10%)

Query: 34  KDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV----------GALDIIRKL 83
           K S   +  ++ G    +S+     P +  K+ +Q   + +          G ++  ++ 
Sbjct: 6   KQSNFAIDFLMGGVSAAVSKT-AAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRT 64

Query: 84  VKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQ--LGQ 141
             +EGV +F++G+   ++      ++ F   + +K  F       G +  +G  +   G 
Sbjct: 65  AADEGVASFWRGNTANVIRYFPTQALNFAFKDKIKAMF-------GFKKEEGYAKWFAGN 117

Query: 142 YYICGLTGGVVNSFLASPIEHVRIRLQTQTGN---GNEREFKGPLDCIRKLVKEKS---L 195
               GL GG+   F+ S +++ R RL   + +   G ER+F G +D  +K +       L
Sbjct: 118 LASGGLAGGLSLLFVYS-LDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGL 176

Query: 196 MRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIY 255
            RG  P ++      G YF  Y++L    +    + S +AS+ L  +   +G     A Y
Sbjct: 177 YRGFLPSVVGIVVYRGLYFGLYDSLKPLLLTGSLENSFLASF-LLGWAVTTGAST--ASY 233

Query: 256 PLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVT 315
           PLD V+  +   + +  ++  +  +    +   +GI + FKG    +LR     G   + 
Sbjct: 234 PLDTVRRRMMMTSGQAVKYDGAF-DAFRKIVAAEGIKSLFKGCGANILRGVAGAGVISMY 292

Query: 316 FELVMRLLG 324
            +L + L G
Sbjct: 293 DQLQVILFG 301

>Kwal_47.19228
          Length = 281

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 72/148 (48%), Gaps = 8/148 (5%)

Query: 177 REFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIAS 236
           R+F   +  I +    +  ++G  P ++R        F TY +L    I   K  +E  +
Sbjct: 129 RQFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSL-KQMISPNKPLNEYYA 187

Query: 237 WKLCSYGSLSGVVLWLAIYPLDVVKSMIQTD-TLRNPRFKNSMKNVINHLYREQGISAFF 295
           + L   G +S   +     P+DV+K+ +Q+  T  N  +KNS+ N    ++ E+G + F+
Sbjct: 188 FAL---GFISSCAVVAVTQPIDVIKTRMQSKYTWSN--YKNSL-NCAYRIFVEEGFTKFW 241

Query: 296 KGFAPTMLRAAPVNGATFVTFELVMRLL 323
           KG+AP +++     G +F  ++ V  L+
Sbjct: 242 KGWAPRLMKVGLSGGVSFGVYQYVDNLM 269

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 43/101 (42%), Gaps = 6/101 (5%)

Query: 38  RVLKDILAGTCGGISQ---VIVGQPFDTTKVRMQ---TSAKSVGALDIIRKLVKNEGVWA 91
           + L +  A   G IS    V V QP D  K RMQ   T +    +L+   ++   EG   
Sbjct: 180 KPLNEYYAFALGFISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVEEGFTK 239

Query: 92  FYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQH 132
           F+KG    ++ VG    V FGV + +    +  N  +   H
Sbjct: 240 FWKGWAPRLMKVGLSGGVSFGVYQYVDNLMKAVNGQQEMSH 280

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/289 (21%), Positives = 115/289 (39%), Gaps = 35/289 (12%)

Query: 60  FDTTKVRMQTSAKSVGALDII---RKLVKNEGVW-AFYKGSLIPIVGVGACVSVQFGVNE 115
            DT K R Q +  +V   ++I   R ++  EG+    Y G    ++G     ++ F   E
Sbjct: 76  LDTVKTRQQGAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAAIFFATYE 135

Query: 116 AMKR-FFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNG 174
             KR    EW  +    H             G  G  ++SF+  P E ++ RLQ Q    
Sbjct: 136 YTKRKMIGEWGINETFSH----------LTAGFLGDFISSFVYVPSEVLKTRLQLQGRYN 185

Query: 175 NE-----REFKGPLDCIRKLVKEK---SLMRGLRPMMLRAGHGLGCYFLTYEAL--IANE 224
           N        +K   D +  +V+ +   +L  G +  + R     G  F  YE    +A  
Sbjct: 186 NPFFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFA 245

Query: 225 IKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTD----------TLRNPRF 274
           ++      +++       G+ +G +  +   PLDVVK+ IQT            L+    
Sbjct: 246 VENKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTL 305

Query: 275 KNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
            NS+   +  +Y+ +G++  F G  P  +  +  +    + +++ ++ L
Sbjct: 306 TNSITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLYQVALKTL 354

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/283 (20%), Positives = 118/283 (41%), Gaps = 26/283 (9%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV-GALDIIRKLVKNEGVWAFYKGSLI 98
           L   +AG+ GG + + V  P  T    +QT        L+ I+++    G+  ++ G   
Sbjct: 12  LAHAIAGSLGGAASIAVTYPLVTITTNLQTKENEARPKLETIKEIYNKNGIIGYFLGLES 71

Query: 99  PIVGVGACVSVQFGVNEAMKRFFREW--NTSRGTQHRDGTLQLGQYYICGLTGGVVNSFL 156
            + G+     V +        +F EW   T+R T      L   +  +     G + +  
Sbjct: 72  AVYGMATTNFVYY--------YFYEWCAKTAR-TLTTKQYLSTWESILASTIAGSMTAVA 122

Query: 157 ASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLT 216
           ++PI     R+       N    +  +D + K     +L+ GL+P ++   + +  Y + 
Sbjct: 123 SNPIWVANTRM--TVAKSNHSTLRTVIDIV-KTDGPLTLLNGLKPALVLVSNPIIQYTV- 178

Query: 217 YEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKS---MIQTDTLRNPR 273
           YE L    ++  + +    SW     G++  +      YP   +K+   ++Q D    P+
Sbjct: 179 YEQLKNLVLRLQRKKVLSPSWAFL-LGAIGKLAATGTTYPYITLKTRMHLMQND----PK 233

Query: 274 FKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTF 316
            + SM ++I  + ++ G+S  + G A  ++++  +  A F+ F
Sbjct: 234 HQKSMWSLIVEIVKKDGVSGLYNGVAVKLVQS--IMTAAFLFF 274

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/277 (21%), Positives = 116/277 (41%), Gaps = 32/277 (11%)

Query: 68  QTSAKSVGALDIIRKLVKNEGVWAFYKG-SLIPIVGVGACVSVQFGVNEAMKRFFREWNT 126
            +S K  G L+   K+   EG+ + ++G SL  ++ + A +            +F  +  
Sbjct: 97  NSSLKFNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMV-----------YFSGYEY 145

Query: 127 SRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNERE----FKGP 182
            R       T        CG    V  +   +P+E V+ +LQ+   +    +     K  
Sbjct: 146 IRDVSPIASTYPTLNPLFCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDL 205

Query: 183 LDCIRKLVK----EKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDR--SEIAS 236
           L+  R+ +K     ++L +GL   + R       Y+ +YE L    +     R  S+ A+
Sbjct: 206 LNETRQEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYE-LCKERLWLDSTRFASKDAN 264

Query: 237 W----KLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRN--PRFKNSMKNVINHL---YR 287
           W       + G +SG++  +  +P DV K+  Q   + N  P+  N  +N+   L   +R
Sbjct: 265 WVHFINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWR 324

Query: 288 EQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
            +G++A + G A  +++  P       ++E+  ++ G
Sbjct: 325 TEGLAALYTGLAARVIKIRPSCAIMISSYEISKKVFG 361

>Kwal_27.11626
          Length = 299

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 115/284 (40%), Gaps = 39/284 (13%)

Query: 43  ILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNE------GVWAFYKGS 96
           +L     GI ++ V  P DT   R+ ++   + +   +  ++  E      G   F   +
Sbjct: 13  VLGSASAGILEIGVFHPVDTVSKRLMSNHTKISSSAQLNSVIFREHAGEALGKRLF---T 69

Query: 97  LIPIVGVGACVSV-----QFG----VNEAMKRFFR-EWNTSRGTQHRDGTLQLGQYYICG 146
           L P +G  A   +     ++G     NE + + F+ +++ + G +            + G
Sbjct: 70  LFPGLGYAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFGEKTGKALRSATAGSLIG 129

Query: 147 LTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKS--LMRGLRPMML 204
                +   +  P++ ++I+ QT     N   FKG      K++K++   L RG      
Sbjct: 130 -----IGEIVLLPLDVLKIKRQT-----NPESFKG--RGFIKILKDEGFGLYRGWGWTAA 177

Query: 205 RAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAI-YPLDVVKSM 263
           R  +  G + L      A E   G      A+W      S+ G    L +  PLDV+K+ 
Sbjct: 178 R--NAPGSFALFGGNAFAKEYILGLKDYSSATWSQNFVSSIVGASASLIVSAPLDVIKTR 235

Query: 264 IQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAP 307
           IQ     NP    S   ++ +  + +GI+AFFKG  P +L   P
Sbjct: 236 IQNRHFDNPE---SGFRIVQNTLKNEGITAFFKGLTPKLLTTGP 276

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/190 (20%), Positives = 88/190 (46%), Gaps = 23/190 (12%)

Query: 38  RVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSL 97
           + L+   AG+  GI ++++  P D  K++ QT+ +S      I K++K+EG +  Y+G  
Sbjct: 117 KALRSATAGSLIGIGEIVL-LPLDVLKIKRQTNPESFKGRGFI-KILKDEG-FGLYRGWG 173

Query: 98  IPIVGVGACVSVQFGVNEAMKRF---FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNS 154
                        FG N   K +    ++++++  +Q+          ++  + G   + 
Sbjct: 174 WTAARNAPGSFALFGGNAFAKEYILGLKDYSSATWSQN----------FVSSIVGASASL 223

Query: 155 FLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLRAGHGLG 211
            +++P++ ++ R+Q +  +  E  F+     ++  +K +   +  +GL P +L  G  L 
Sbjct: 224 IVSAPLDVIKTRIQNRHFDNPESGFR----IVQNTLKNEGITAFFKGLTPKLLTTGPKLV 279

Query: 212 CYFLTYEALI 221
             F   ++LI
Sbjct: 280 FSFALAQSLI 289

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 79/175 (45%), Gaps = 30/175 (17%)

Query: 46  GTCGGISQVIVGQPFDTTKVRMQTSAKSV---------GALDIIRKLVKNEGVWAFYKGS 96
           G  GG+S + V    D  + R+   A+           G LD+ +K +K +G+   Y+G 
Sbjct: 126 GAAGGLSLLFV-YSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGF 184

Query: 97  LIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVN--- 153
           +  ++G+     + FG+ ++ K                G L+ G +    L G V+    
Sbjct: 185 VPSVLGIIVYRGLYFGLYDSFKPVLLT-----------GALE-GSFVASFLLGWVITMGA 232

Query: 154 SFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLR 205
           S  + P++ VR R+   +  G   ++ G LDC+RK+V+++   SL +G    + R
Sbjct: 233 STASYPLDTVRRRMMMTS--GQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFR 285

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 90/210 (42%), Gaps = 33/210 (15%)

Query: 132 HRDGTLQLGQYYICGLTGGVVNSFL---ASPIEHVRIRLQTQ-----TGNGNEREFKGPL 183
           H +   Q   + +  L GGV  +     A+PIE V++ +Q Q      G+ + R +KG L
Sbjct: 3   HTETQTQQSHFGVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTR-YKGIL 61

Query: 184 DCIRKLVKEK---SLMRGLRPMMLRAGHGLGCYFLT------YEALIANEIKKGKDRSEI 234
           DC ++    +   S  RG    +LR       YF T      ++  I + +   ++R   
Sbjct: 62  DCFKRTATHEGIVSFWRGNTANVLR-------YFPTQALNFAFKDKIKSLLSYDRERDGY 114

Query: 235 ASW---KLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTL----RNPRFKNSMKNVINHLYR 287
           A W    L S G+  G+ L L +Y LD  ++ +  D       + R  N + +V     +
Sbjct: 115 AKWFAGNLFSGGAAGGLSL-LFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLK 173

Query: 288 EQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
             G+   ++GF P++L      G  F  ++
Sbjct: 174 TDGLLGLYRGFVPSVLGIIVYRGLYFGLYD 203

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/273 (22%), Positives = 106/273 (38%), Gaps = 32/273 (11%)

Query: 36  STRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAK-SVGALDIIRKLVKNEGVWAFYK 94
           +T  L  I+A  CG     I   P D  K R+Q + K     L   RK++ NEG    Y 
Sbjct: 19  ATCTLGGIIA--CGPTHSSIT--PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYT 74

Query: 95  GSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNS 154
           G     VG     + ++G  E  K  +  W +   T           Y +   T   +  
Sbjct: 75  GFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVT----------VYLMASATAEFLAD 124

Query: 155 FLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE----KSLMRGLRPMMLRAGHGL 210
            +  P E ++++ QT             +D  +K+  E    K+  +G+ P+  R     
Sbjct: 125 IMLCPFEAIKVKQQTTMPPFCNNV----VDGWKKMYAESGGMKAFYKGIVPLWCRQIPYT 180

Query: 211 GCYFLTYEAL---IANEIKKGKDRSEIASWKLCSY--GSLSGVVLWLAIYPLDVVKSMIQ 265
            C F ++E +   I + + K K+          S+  G L+G++     +P DV+ S I 
Sbjct: 181 MCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKIN 240

Query: 266 TDTLRNPRFKNSMKNVINHLYREQGISAFFKGF 298
           ++   N     SM      +Y++ G +  + G 
Sbjct: 241 SERKAN----ESMSVASKRIYQKIGFTGLWNGL 269

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 79/200 (39%), Gaps = 29/200 (14%)

Query: 130 TQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKL 189
           T+    T  LG    CG T   +     +P++ V+ RLQ      N + +   L   RK+
Sbjct: 14  TKEFYATCTLGGIIACGPTHSSI-----TPLDLVKCRLQV-----NPKLYTSNLQGFRKI 63

Query: 190 VKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEI-ASW---KLCSYGSL 245
           +  +   +           G G  F+ Y    A +    +    + +SW    +  Y   
Sbjct: 64  IANEGWKK--------VYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMA 115

Query: 246 SGVVLWLA---IYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQG-ISAFFKGFAPT 301
           S    +LA   + P + +K   QT     P F N++ +    +Y E G + AF+KG  P 
Sbjct: 116 SATAEFLADIMLCPFEAIKVKQQTTM---PPFCNNVVDGWKKMYAESGGMKAFYKGIVPL 172

Query: 302 MLRAAPVNGATFVTFELVMR 321
             R  P     F +FE +++
Sbjct: 173 WCRQIPYTMCKFTSFEKIVQ 192

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 66/152 (43%), Gaps = 15/152 (9%)

Query: 159 PIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKS--LMRGLRPMMLRAGHGLGCYFLT 216
           P++ ++I+ QT     N   FKG      K++K++   L RG      R  +  G + L 
Sbjct: 138 PLDVLKIKRQT-----NPESFKG--RGFLKIIKDEGFGLYRGWGWTAAR--NAPGSFALF 188

Query: 217 YEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAI-YPLDVVKSMIQTDTLRNPRFK 275
                A E   G      A+W      S+ G    L +  PLDV+K+ IQ     NP   
Sbjct: 189 GGNAFAKEYILGLKDYGQATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPE-- 246

Query: 276 NSMKNVINHLYREQGISAFFKGFAPTMLRAAP 307
            S   +I +  + +G +AFFKG  P +L   P
Sbjct: 247 -SGFKIIKNTLKNEGFTAFFKGLTPKLLTTGP 277

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 85/190 (44%), Gaps = 23/190 (12%)

Query: 38  RVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSL 97
           + L+   AG+  GI ++++  P D  K++ QT+ +S      + K++K+EG +  Y+G  
Sbjct: 118 KALRSATAGSLIGIGEIVL-LPLDVLKIKRQTNPESFKGRGFL-KIIKDEG-FGLYRGWG 174

Query: 98  IPIVGVGACVSVQFGVNEAMKRF---FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNS 154
                        FG N   K +    +++  +  +Q+          ++  + G   + 
Sbjct: 175 WTAARNAPGSFALFGGNAFAKEYILGLKDYGQATWSQN----------FVSSIVGASASL 224

Query: 155 FLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLRAGHGLG 211
            +++P++ ++ R+Q +  +  E  FK     I+  +K +   +  +GL P +L  G  L 
Sbjct: 225 IVSAPLDVIKTRIQNRNFDNPESGFK----IIKNTLKNEGFTAFFKGLTPKLLTTGPKLV 280

Query: 212 CYFLTYEALI 221
             F   + LI
Sbjct: 281 FSFALAQTLI 290

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 2/83 (2%)

Query: 41  KDILAGTCGGISQVIVGQPFDTTKVRMQTSA--KSVGALDIIRKLVKNEGVWAFYKGSLI 98
           ++ ++   G  + +IV  P D  K R+Q            II+  +KNEG  AF+KG   
Sbjct: 211 QNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIIKNTLKNEGFTAFFKGLTP 270

Query: 99  PIVGVGACVSVQFGVNEAMKRFF 121
            ++  G  +   F + + +   F
Sbjct: 271 KLLTTGPKLVFSFALAQTLIPIF 293

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 111/284 (39%), Gaps = 40/284 (14%)

Query: 50  GISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSV 109
           GI Q I  +P   T  +     +   ALD+I K+ +NEG    Y G    ++G       
Sbjct: 65  GIQQ-IKPKPEPPTATKESLEQRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFS 123

Query: 110 QFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQT 169
            F     ++R +      +G   R  T++     +  +     +    +PI  V  + QT
Sbjct: 124 YFFWYTLIRRHYFRVKKVKGEAARFSTIE---ELLLSMLAAATSQLFTNPINIVSTKQQT 180

Query: 170 QTGNGNEREFKGPLDCIRKLVKEK------------SLMRGLRPMMLRA-GHGLG--CYF 214
           + G   +  FK     I K V ++            SL+  + P +  A    L    Y 
Sbjct: 181 RRGLEGDNSFK----AIAKEVYDEDGITGFWKSLKVSLVLTINPSITYASAEKLKDILYH 236

Query: 215 LTYEALIAN----EIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLR 270
           + + A   N    ++K G++            G LS ++     +PL V K+ +Q    R
Sbjct: 237 VEWNAKDLNDSSLQLKPGQN---------FLIGVLSKIISTCLTHPLIVAKASLQ----R 283

Query: 271 NPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFV 314
           +     S + V+ +LYR +G  A +KG  P + +   V G  F+
Sbjct: 284 SSSKFTSFQEVLTYLYRHEGAHALWKGLLPQLTKGVIVQGLLFM 327

 Score = 28.5 bits (62), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 234 IASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTD 267
           +AS +    G++S     LA+YPLD+ K++IQT 
Sbjct: 1   MASLENAFVGAVSSGFANLAVYPLDLAKTVIQTQ 34

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 112/275 (40%), Gaps = 29/275 (10%)

Query: 40  LKDILAGTCGGISQVI-VGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLI 98
             +IL G    + +V  +GQP +  K  M  + +S    + I+ +    GV+ FY+G LI
Sbjct: 18  FSNILLGAGLNMCEVTTLGQPLEVIKTTMAAN-RSFSFFNAIKHVWSRGGVFGFYQG-LI 75

Query: 99  PIVGVGACVS---VQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSF 155
           P   + A      + F   E+  +F            R G    G   + G+TGGV  ++
Sbjct: 76  PWAWIEASTKGAVLLFVSAESEYQF-----------KRMGLSNFGSGIMGGVTGGVAQAY 124

Query: 156 LA----SPIEHVRIRLQTQTGNGN-EREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGL 210
           L     + ++ V I  +   G G   +   G    I K    K + +G+  + +R     
Sbjct: 125 LTMGFCTCMKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDGIKGINKGVNAVAIRQMTNW 184

Query: 211 GCYF----LTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQT 266
           G  F    L  E +     K   D    A  K+ +     G+  W    P++V++  +Q+
Sbjct: 185 GSRFGFSRLVEEGIRNATGKTNPDDKLTALEKIAASAIGGGLSAWNQ--PIEVIRVEMQS 242

Query: 267 DTLRNPRFKN-SMKNVINHLYREQGISAFFKGFAP 300
                 R KN ++ +   ++Y+  GI   ++G AP
Sbjct: 243 KKEDPNRPKNLTVSSAFKYIYQSSGIKGLYRGVAP 277

>Kwal_33.15597
          Length = 305

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 81/168 (48%), Gaps = 21/168 (12%)

Query: 159 PIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLRAGHGL-GCY- 213
           PI+ V+ R+Q +    N    KG +   ++++  +   +L+ G  P +L  G+ L G + 
Sbjct: 33  PIDVVKTRIQLEPTVYN----KGMISSFKQIISSEGAGALLTGFGPTLL--GYSLQGSFK 86

Query: 214 FLTYEALIANEIKK-GKDRSEIASWKLCSYGSLSGVVLW---LAIYPLDVVKSMIQTDTL 269
           F  YE      I   G D++   ++K   Y   + +  +   +A+ PL+  +  +    +
Sbjct: 87  FGGYEVFKKLFIDTLGYDQA--VNYKNSIYIGSAAIAEFFADIALCPLEATRIRL----V 140

Query: 270 RNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
             P F N +    + + +E+G+S+F+ GF P + +  P N A F+ FE
Sbjct: 141 SQPTFANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIAKFLVFE 188

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 2/80 (2%)

Query: 42  DILAGTCGGISQVIVGQPFDT--TKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIP 99
           ++L+G   G++  IV QP DT  +KV     A     + ++ +L K  G    + G    
Sbjct: 213 NLLSGLTAGLAAAIVSQPADTLLSKVNKAKKAPGQSTIGLLGQLAKELGFVGSFAGLPTR 272

Query: 100 IVGVGACVSVQFGVNEAMKR 119
           +V VG   S+QFG+  ++K+
Sbjct: 273 LVMVGTLTSLQFGIYGSLKK 292

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 70/172 (40%), Gaps = 18/172 (10%)

Query: 41  KDILAGT--CGGISQVIVGQPFDTTKVRMQ--TSAKSVGALDIIRKLVKNEGVWAFYKGS 96
           K  LAG   CG     +V  P D  K R+Q   +  + G +   ++++ +EG  A   G 
Sbjct: 15  KFALAGAIGCGTTHSAMV--PIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGF 72

Query: 97  LIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFL 156
              ++G     S +FG  E  K+ F +        +   ++ +G   I      +     
Sbjct: 73  GPTLLGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIA---- 128

Query: 157 ASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLR 205
             P+E  RIRL +Q    N     G +    +++KE+   S   G  P++ +
Sbjct: 129 LCPLEATRIRLVSQPTFAN-----GLVGGFSRILKEEGLSSFYNGFTPILFK 175

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 87/202 (43%), Gaps = 30/202 (14%)

Query: 146 GLTGGVVNSF---LASPIEHVRIRLQTQTGNGNER--EFKGPLDC---IRKLVKEKSLMR 197
           GL GGV  S    L +P++ ++I  QT   +  +    F+G L+    I    + + + +
Sbjct: 57  GLAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQ 116

Query: 198 GLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPL 257
           G    +LR        F+ YE  I N I   K+  E    +LCS GSL+G+      YPL
Sbjct: 117 GHSATLLRIFPYAAVKFIAYEQ-IRNVIIPSKEY-ETHFRRLCS-GSLAGLCSVFCTYPL 173

Query: 258 DVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISA----------------FFKGFAPT 301
           D+++  +   T  +   K  +  ++  +Y E    A                F++G+ PT
Sbjct: 174 DLIRVRLAYVTEHH---KVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRGYIPT 230

Query: 302 MLRAAPVNGATFVTFELVMRLL 323
           ++   P  G +F   +L   +L
Sbjct: 231 VIGMIPYAGVSFFAHDLFHDIL 252

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 46/97 (47%), Gaps = 4/97 (4%)

Query: 231 RSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNP---RFKNSMKNVINHLYR 287
           R  + +W     G L+G+    A YP ++++  +Q   + NP   +F  SM  +   ++ 
Sbjct: 285 RIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKF-TSMSEMAKIIFH 343

Query: 288 EQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
           E+G   FF G +   ++  P+   +F  +E +   +G
Sbjct: 344 ERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWYMG 380

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 7/86 (8%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTSA------KSVGALDIIRKLVKNEGVW-AFYK 94
           ++LAG   G++      PF+  + R+Q  A          ++  + K++ +E  W  F+ 
Sbjct: 293 ELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERGWRGFFV 352

Query: 95  GSLIPIVGVGACVSVQFGVNEAMKRF 120
           G  I  + V   V+  F V E MK +
Sbjct: 353 GLSIGYIKVTPMVACSFFVYERMKWY 378

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 72/170 (42%), Gaps = 25/170 (14%)

Query: 159 PIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLRAGHGLGCYFL 215
           PI+ V+ R+Q +      +   G +   RK+V E+   +L+ G  P +L  G+ +   F 
Sbjct: 35  PIDVVKTRIQLEP----LKYSSGMVGSFRKIVGEEGAAALLTGFGPTLL--GYSMQGAF- 87

Query: 216 TYEALIANEIKKGKDRSEIASWKLCSY--------GSLSGVVLWLAIYPLDVVKSMIQTD 267
                   E+ K      +     C Y         +++     +A+ PL+  +  +   
Sbjct: 88  ---KFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLEATRIRL--- 141

Query: 268 TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
            +  P F N +      + +E+GI +F+ GF P + +  P N A FV FE
Sbjct: 142 -VSQPTFANGLVGGFARILKEEGIGSFYNGFTPILFKQIPYNIAKFVVFE 190

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 70/177 (39%), Gaps = 28/177 (15%)

Query: 41  KDILAGT--CGGISQVIVGQPFDTTKVRMQTSA--KSVGALDIIRKLVKNEGVWAFYKGS 96
           K  LAG   CG     +V  P D  K R+Q      S G +   RK+V  EG  A   G 
Sbjct: 17  KFALAGAIGCGATHSAMV--PIDVVKTRIQLEPLKYSSGMVGSFRKIVGEEGAAALLTGF 74

Query: 97  LIPIVGVGACVSVQFGVNEAMKRFFRE-WNTSRGTQHRD----GTLQLGQYYICGLTGGV 151
              ++G     + +FG  E  K+ F +        Q+R     G+  + +++        
Sbjct: 75  GPTLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFF-------- 126

Query: 152 VNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLR 205
                  P+E  RIRL +Q    N     G +    +++KE+   S   G  P++ +
Sbjct: 127 -ADIALCPLEATRIRLVSQPTFAN-----GLVGGFARILKEEGIGSFYNGFTPILFK 177

>Scas_673.17
          Length = 314

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 85/202 (42%), Gaps = 20/202 (9%)

Query: 126 TSRGTQHRDGTLQLGQYYICGLTG----GVVNSFLASPIEHVRIRLQTQTGNGNEREFKG 181
           T+    H+        Y+   L G    G  +S L  P++ V+ R+Q +    N    KG
Sbjct: 4   TTTTDAHKIPDYAASDYFKFALAGAIGCGTTHSSLV-PVDVVKTRIQLEPTVYN----KG 58

Query: 182 PLDCIRKLVKEK---SLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWK 238
            +   +K++ ++   +L+ G  P +L         F  YE      I      + +  +K
Sbjct: 59  MVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAV-HYK 117

Query: 239 LCSYGSLSGVVLWLA---IYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFF 295
              Y   + V  +LA   + PL+  +  +    +  P F N +    + + +E+G+ +F+
Sbjct: 118 NSVYMGSAAVAEFLADIALCPLEATRIRL----VSQPTFANGLVGGFSRILKEEGVGSFY 173

Query: 296 KGFAPTMLRAAPVNGATFVTFE 317
            GF P + +  P N A F+ FE
Sbjct: 174 SGFTPILFKQIPYNIAKFLVFE 195

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 73/181 (40%), Gaps = 26/181 (14%)

Query: 36  STRVLKDILAGT--CGGISQVIVGQPFDTTKVRMQ--TSAKSVGALDIIRKLVKNEGVWA 91
           ++   K  LAG   CG     +V  P D  K R+Q   +  + G +   +K++ +EG  A
Sbjct: 17  ASDYFKFALAGAIGCGTTHSSLV--PVDVVKTRIQLEPTVYNKGMVGSFKKIIADEGAGA 74

Query: 92  FYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGV 151
              G    ++G     + +FG  E  K+   +        H   ++ +G           
Sbjct: 75  LLTGFGPTLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGS--------AA 126

Query: 152 VNSFLAS----PIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMML 204
           V  FLA     P+E  RIRL +Q    N     G +    +++KE+   S   G  P++ 
Sbjct: 127 VAEFLADIALCPLEATRIRLVSQPTFAN-----GLVGGFSRILKEEGVGSFYSGFTPILF 181

Query: 205 R 205
           +
Sbjct: 182 K 182

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 2/87 (2%)

Query: 35  DSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVG--ALDIIRKLVKNEGVWAF 92
           D T    ++L+G   G +   V QP DT   ++  + K+ G   + ++ +L K  GV   
Sbjct: 213 DMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGVIGS 272

Query: 93  YKGSLIPIVGVGACVSVQFGVNEAMKR 119
           + G    ++ VG   S+QF +  ++K 
Sbjct: 273 FAGLPTRLIMVGTLTSLQFAIYGSLKN 299

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 86/190 (45%), Gaps = 26/190 (13%)

Query: 142 YYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRP 201
           + I G  GG+ ++    P++ ++ R Q QT  G   +       ++ L     L RG  P
Sbjct: 7   HLIGGFAGGLSSAVALQPLDLLKTRFQ-QTKGGTLWQ------TVKSLDTPWQLWRGTLP 59

Query: 202 MMLRAGHGLGCYF----LTYEAL-------IANEIKKGKDRS--EIASWKLCSYGSLS-G 247
             +R   G   Y     L   AL        A+ +  GK  +  +++ ++    G+ + G
Sbjct: 60  SAIRTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARG 119

Query: 248 VVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAP 307
            V ++ + P+ ++K   ++ TL N +   S+      +  ++GI  FF+GF PT LR AP
Sbjct: 120 TVGYITM-PITIIKVRYES-TLYNYK---SIAEAAKSIAAQEGIRGFFRGFGPTCLRDAP 174

Query: 308 VNGATFVTFE 317
            +G   + +E
Sbjct: 175 YSGLYVLLYE 184

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 60/307 (19%), Positives = 120/307 (39%), Gaps = 48/307 (15%)

Query: 43  ILAGTCGGISQVIVGQPFDTTKVRMQ-----TSAKSVGALDIIRKLVKNEGVWAFYKGSL 97
           ++ G  GG+S  +  QP D  K R Q     T  ++V +LD           W  ++G+L
Sbjct: 8   LIGGFAGGLSSAVALQPLDLLKTRFQQTKGGTLWQTVKSLDT---------PWQLWRGTL 58

Query: 98  IPIV--GVGACV---SVQFGVNEAMKRFFREWNTSRG--TQHRDGTLQLGQY--YICGLT 148
              +   VG+ +   S+        KR  ++++T+    T       QL  Y   + G  
Sbjct: 59  PSAIRTSVGSALYLSSLNLMRTALAKR--KQFDTADSVVTGKSSNLPQLSMYENLVTGAF 116

Query: 149 GGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSL---MRGLRPMMLR 205
                 ++  PI  +++R ++   N     +K   +  + +  ++ +    RG  P  LR
Sbjct: 117 ARGTVGYITMPITIIKVRYESTLYN-----YKSIAEAAKSIAAQEGIRGFFRGFGPTCLR 171

Query: 206 AGHGLGCYFLTYEAL-----------IANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAI 254
                G Y L YE L           +     +G+  +  ++    +   LS  +     
Sbjct: 172 DAPYSGLYVLLYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVT 231

Query: 255 YPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFV 314
            P D +K+ +Q +  +   F +++  ++    +E  I   F G +  + R A   G  + 
Sbjct: 232 APFDTIKTRMQLEPTKFKTFWSTLTTIVT---QEHPIK-IFSGLSMRLTRKALSAGIAWG 287

Query: 315 TFELVMR 321
            +E +++
Sbjct: 288 IYEELIK 294

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 68/292 (23%), Positives = 114/292 (39%), Gaps = 22/292 (7%)

Query: 35  DSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYK 94
           DS   +  +++G   G S  +   P DT K R+Q                 N G    Y+
Sbjct: 2   DSQMFIASLVSGAAAGTSTDLAFFPIDTLKTRLQAKG----------GFFANGGYKGVYR 51

Query: 95  GSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNS 154
           G    +V      S+ F   ++MK + R        +  D T     + +    G +   
Sbjct: 52  GLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEISAC 111

Query: 155 FLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYF 214
            +  P E ++ R QT   N + +  +  L         ++L RG    ++R        F
Sbjct: 112 MVRVPAEVIKQRTQTHRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIPFTCIQF 171

Query: 215 LTYEALIANEIK-KGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPR 273
             YE +     + +GK+R+  A W+    G ++G +   A  PLDV+K+ I         
Sbjct: 172 PLYEYMKKRWAEVQGKERA--APWQGSVCGCIAGGIAAAATTPLDVLKTRIMLH-----H 224

Query: 274 FKNSMKNVINHLYREQGISAFFKGFAP-TMLRAAPVNGATFV-TFELVMRLL 323
              S  ++   + +E+G+  FF G  P TM  +A   GA F+  +E V  L 
Sbjct: 225 KSVSALHLAKTMLQEEGVKVFFSGVGPRTMWISA--GGAIFLGVYETVHSLF 274

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 77/169 (45%), Gaps = 23/169 (13%)

Query: 159 PIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMML----RAGHGLG 211
           PI+ V+ R+Q +    N    KG +   ++++  +   +L+ G  P +L    +     G
Sbjct: 37  PIDVVKTRIQLEPTVYN----KGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKFG 92

Query: 212 CYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLR- 270
            Y +  +  I N    G D +  + +K   Y   + +  +LA    D+    ++   +R 
Sbjct: 93  GYEVFKKFFIDN---LGYDTA--SRYKNSVYMGSAAMAEFLA----DIALCPLEATRIRL 143

Query: 271 --NPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
              P+F N +    + + +E+GI +F+ GF P + +  P N A F+ FE
Sbjct: 144 VSQPQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFE 192

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 46/86 (53%), Gaps = 2/86 (2%)

Query: 35  DSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVG--ALDIIRKLVKNEGVWAF 92
            ++  L ++L+G   G++  IV QP DT   ++  + K+ G   + ++ +L K  G +  
Sbjct: 210 STSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQSTVGLLAQLAKQLGFFGS 269

Query: 93  YKGSLIPIVGVGACVSVQFGVNEAMK 118
           + G    +V VG   S+QFG+  ++K
Sbjct: 270 FAGLPTRLVMVGTLTSLQFGIYGSLK 295

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 116/284 (40%), Gaps = 44/284 (15%)

Query: 40  LKDILAGT--CGGISQVIVGQPFDTTKVRMQ--TSAKSVGALDIIRKLVKNEGVWAFYKG 95
           +K  LAG   CG     +V  P D  K R+Q   +  + G +   ++++  EG  A   G
Sbjct: 18  MKFALAGAIGCGSTHSSMV--PIDVVKTRIQLEPTVYNKGMVGSFKQIIAGEGAGALLTG 75

Query: 96  SLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHR-DGTLQLGQYYICGLTGGVVNS 154
               ++G     + +FG  E  K+FF + N    T  R   ++ +G           +  
Sbjct: 76  FGPTLLGYSIQGAFKFGGYEVFKKFFID-NLGYDTASRYKNSVYMGS--------AAMAE 126

Query: 155 FLAS----PIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLRAG 207
           FLA     P+E  RIRL +Q    N     G +    +++KE+   S   G  P++ +  
Sbjct: 127 FLADIALCPLEATRIRLVSQPQFAN-----GLVGGFSRILKEEGIGSFYSGFTPILFKQI 181

Query: 208 HGLGCYFLTYEALIANEIKKG--KDRSEIASWKLCSYGSLSGVVLWLAIY----PLDVVK 261
                 FL +E   A+E   G    + +++S        LSG+   LA      P D + 
Sbjct: 182 PYNIAKFLVFER--ASEFYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLL 239

Query: 262 SMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFA--PTML 303
           S +   T + P    S   ++  L ++ G   FF  FA  PT L
Sbjct: 240 SKVN-KTKKAP--GQSTVGLLAQLAKQLG---FFGSFAGLPTRL 277

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 86/188 (45%), Gaps = 25/188 (13%)

Query: 141 QYYICGLTG-GVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLM 196
           ++ + G  G G+ +S +  PI+ V+ R+Q +    N    KG +   ++++  +   +L+
Sbjct: 15  KFALAGAIGCGITHSSMV-PIDVVKTRIQLEPTVYN----KGMVSSFKQIISSEGAGALL 69

Query: 197 RGLRPMML----RAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLW- 251
            G  P +L    +     G Y L  +  I N    G D +   ++K   Y   + +  + 
Sbjct: 70  TGFGPTLLGYSLQGSFKFGGYELFKKLAIDN---MGYDNA--VNYKNTIYIGSAAIAEFF 124

Query: 252 --LAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVN 309
             +A+ PL+  +  +    +  P F N +    + + +E+G+ +F+ GF P + +  P N
Sbjct: 125 ADIALCPLEATRIRL----VSQPTFANGLFGGFSRILKEEGVGSFYNGFTPILFKQIPYN 180

Query: 310 GATFVTFE 317
            A F  FE
Sbjct: 181 IAKFFVFE 188

 Score = 35.0 bits (79), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 46/92 (50%), Gaps = 7/92 (7%)

Query: 232 SEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTD-TLRNPRFKNSMKNVINHLYREQG 290
           S+ A + L   G++   +   ++ P+DVVK+ IQ + T+ N    +S K +I+     +G
Sbjct: 11  SDYAKFALA--GAIGCGITHSSMVPIDVVKTRIQLEPTVYNKGMVSSFKQIIS----SEG 64

Query: 291 ISAFFKGFAPTMLRAAPVNGATFVTFELVMRL 322
             A   GF PT+L  +      F  +EL  +L
Sbjct: 65  AGALLTGFGPTLLGYSLQGSFKFGGYELFKKL 96

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 69/171 (40%), Gaps = 16/171 (9%)

Query: 41  KDILAGTCG-GISQVIVGQPFDTTKVRMQ--TSAKSVGALDIIRKLVKNEGVWAFYKGSL 97
           K  LAG  G GI+   +  P D  K R+Q   +  + G +   ++++ +EG  A   G  
Sbjct: 15  KFALAGAIGCGITHSSM-VPIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGAGALLTGFG 73

Query: 98  IPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLA 157
             ++G     S +FG  E  K+   +        +   T+ +G   I      +      
Sbjct: 74  PTLLGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIA----L 129

Query: 158 SPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLR 205
            P+E  RIRL +Q    N     G      +++KE+   S   G  P++ +
Sbjct: 130 CPLEATRIRLVSQPTFAN-----GLFGGFSRILKEEGVGSFYNGFTPILFK 175

>Scas_705.9
          Length = 323

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 63/298 (21%), Positives = 118/298 (39%), Gaps = 30/298 (10%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQ--TSAKSVGAL-----------DIIRKLVK- 85
           L+  + G        ++  P D  K  +Q  T AK    L           ++IR L++ 
Sbjct: 4   LESAITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRI 63

Query: 86  --NEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRD-GTLQLGQY 142
               G+   Y+G    +          F     ++R +      R TQ R   ++   + 
Sbjct: 64  FRKRGLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINSISTVEE 123

Query: 143 YICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCI--RKLVKEKSLMRGLR 200
            I G+    +   + +PIE +  + QT T + +  +F   L  I      K  S  +G +
Sbjct: 124 LIVGVGAAALTQVVNNPIEVILTKQQT-TDDKDNVDFYSVLKQIYVESNGKLSSYWKGFK 182

Query: 201 PMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCS-----YGSLSGVVLWLAIY 255
             ++   +     F  Y+      +K+  +  +  S +L        G+L+ ++  +   
Sbjct: 183 VSLILTVNP-SITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGALAKIISTIITQ 241

Query: 256 PLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATF 313
           PL V K  +Q     N +FK+  + V+ +LY+E+G+ A +KG  P + +   V G  F
Sbjct: 242 PLIVAKVSLQRS---NSKFKH-FEEVLRYLYKEEGVLALWKGVGPQLTKGVLVQGLVF 295

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 79/168 (47%), Gaps = 21/168 (12%)

Query: 159 PIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLRAGHGL-GCY- 213
           PI+ V+ R+Q +    N    KG +   ++++  +   +L+ G  P +L  G+ L G + 
Sbjct: 33  PIDVVKTRIQLEPTVYN----KGMISSFKQIISSEGAGALLTGFGPTLL--GYSLQGSFK 86

Query: 214 FLTYEALIANEIKK-GKDRSEIASWKLCSYGSLSGVVLW---LAIYPLDVVKSMIQTDTL 269
           F  YE      I   G D++   ++K   Y   + +  +   +A+ PL+  +  +    +
Sbjct: 87  FGGYEVFKKLFIDVLGYDQA--VNYKNSIYIGSAAIAEFFADIALCPLEATRIRL----V 140

Query: 270 RNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317
             P F N +    + + +E+G  +F+ GF P + +  P N A F+ FE
Sbjct: 141 SQPTFANGLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIAKFLVFE 188

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 61/274 (22%), Positives = 104/274 (37%), Gaps = 26/274 (9%)

Query: 41  KDILAGT--CGGISQVIVGQPFDTTKVRMQ--TSAKSVGALDIIRKLVKNEGVWAFYKGS 96
           K  LAG   CG     +V  P D  K R+Q   +  + G +   ++++ +EG  A   G 
Sbjct: 15  KFALAGAIGCGTTHSAMV--PIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGF 72

Query: 97  LIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFL 156
              ++G     S +FG  E  K+ F +        +   ++ +G   I      +     
Sbjct: 73  GPTLLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIA---- 128

Query: 157 ASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLRAGHGLGCY 213
             P+E  RIRL +Q    N     G +    +++KE+   S   G  P++ +        
Sbjct: 129 LCPLEATRIRLVSQPTFAN-----GLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIAK 183

Query: 214 FLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIY----PLDVVKSMIQTDTL 269
           FL +E            +  +++        LSG+   LA      P D + S +   T 
Sbjct: 184 FLVFERAAEVYFGMAGPKESLSTASTTGINLLSGLTAGLAAAIVSQPADTLLSKVN-KTK 242

Query: 270 RNPRFKNSMKNVINHLYREQGISAFFKGFAPTML 303
           + P    S   ++  L ++ G    F G  PT L
Sbjct: 243 KAP--GQSTIGLLAQLAKQLGFVGSFAGL-PTRL 273

>Scas_669.6
          Length = 373

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 63/300 (21%), Positives = 107/300 (35%), Gaps = 47/300 (15%)

Query: 61  DTTKVRMQ---TSAKSVGALDIIRKLVKNEGVW-AFYKGSLIPIVGVGACVSVQFGVNEA 116
           DT K R Q    + K        R +   EG+    Y G    ++G     ++ FG  E 
Sbjct: 73  DTVKTRQQGAPMTPKYKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFGTYEW 132

Query: 117 MKR-FFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQ----- 170
            KR    +   +    H             GL G  V+SF+  P E ++ RLQ Q     
Sbjct: 133 CKRKMIGDLGFNDTVSHLS----------AGLLGDFVSSFVYVPSEVLKTRLQLQGRVNN 182

Query: 171 ---TGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIK- 226
                  N R  +  +  I      K+L  G +  + R        F  YE       K 
Sbjct: 183 PFFQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQTAFKL 242

Query: 227 --KGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLR-NPR---------- 273
             K   +  ++       G+++G +  +   P+DV+K+ +QT     NP           
Sbjct: 243 EKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQADINPNSATTVGAISA 302

Query: 274 ----------FKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
                       NS+   +  +Y+ +G+  FF G  P  +  +  +    + +++ +RLL
Sbjct: 303 KTNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFVWTSVQSSIMLLLYQMTLRLL 362

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 69/144 (47%), Gaps = 9/144 (6%)

Query: 183 LDCIRKLVKEK---SLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKL 239
              +R++V+ +   +  +G  P + R        F TY  L    I   K  SE  ++ +
Sbjct: 194 FTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTL-KQMISPNKPLSEYYAFGI 252

Query: 240 CSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFA 299
             + S + V L     P+DVVK+ +Q+    +  ++NS+ N +   + E+G+++ +KG+ 
Sbjct: 253 GVFSSCAVVAL---TQPIDVVKTRMQSKYTWS-LYRNSL-NCVYRTFIEEGLTSLWKGWV 307

Query: 300 PTMLRAAPVNGATFVTFELVMRLL 323
           P + +     G +F  ++ V  L+
Sbjct: 308 PRLFKVGLSGGVSFGVYQYVDNLM 331

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 65/153 (42%), Gaps = 24/153 (15%)

Query: 73  SVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQH 132
           S      +R++V+  G   F++GS+  I       +V+F     +K            Q 
Sbjct: 190 STNIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLK------------QM 237

Query: 133 RDGTLQLGQYYICGLTGGVVNS----FLASPIEHVRIRLQTQTGNGNEREFKGPLDCI-R 187
                 L +YY  G+  GV +S     L  PI+ V+ R+Q++        ++  L+C+ R
Sbjct: 238 ISPNKPLSEYYAFGI--GVFSSCAVVALTQPIDVVKTRMQSKY---TWSLYRNSLNCVYR 292

Query: 188 KLVKE--KSLMRGLRPMMLRAGHGLGCYFLTYE 218
             ++E   SL +G  P + + G   G  F  Y+
Sbjct: 293 TFIEEGLTSLWKGWVPRLFKVGLSGGVSFGVYQ 325

 Score = 32.0 bits (71), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 37/90 (41%), Gaps = 3/90 (3%)

Query: 46  GTCGGISQVIVGQPFDTTKVRMQ---TSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVG 102
           G     + V + QP D  K RMQ   T +    +L+ + +    EG+ + +KG +  +  
Sbjct: 253 GVFSSCAVVALTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLFK 312

Query: 103 VGACVSVQFGVNEAMKRFFREWNTSRGTQH 132
           VG    V FGV + +          R   H
Sbjct: 313 VGLSGGVSFGVYQYVDNLMLSMQYERSLGH 342

>Scas_328.1
          Length = 227

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 66/164 (40%), Gaps = 46/164 (28%)

Query: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120
           D   ++     K  G LD+ +K +  +GV   Y+G L  +VG+     + FG+ +++K  
Sbjct: 67  DAKSIKSGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPV 126

Query: 121 FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLAS----------------PIEHVR 164
                                     LTG   N+FL S                P++ VR
Sbjct: 127 L-------------------------LTGSFENAFLPSFLLGWAVTISASTTSYPLDTVR 161

Query: 165 IRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLR 205
            R+   +G     ++KG +DC +++V ++   SL +G    + R
Sbjct: 162 RRMMMTSGQAV--KYKGAIDCFQQIVSQEGVYSLFKGCGANIFR 203

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 67/155 (43%), Gaps = 7/155 (4%)

Query: 173 NGNEREFKGPLDCIRKLVKEKS---LMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGK 229
           +G  R+F G LD  +K +       L RG  P ++      G YF  Y++L    +    
Sbjct: 73  SGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLTGSF 132

Query: 230 DRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQ 289
           + + + S+ L    ++S        YPLD V+  +   + +  ++K ++ +    +  ++
Sbjct: 133 ENAFLPSFLLGWAVTISAST---TSYPLDTVRRRMMMTSGQAVKYKGAI-DCFQQIVSQE 188

Query: 290 GISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
           G+ + FKG    + R     G   +  +L + L G
Sbjct: 189 GVYSLFKGCGANIFRGVAAAGVISLYDQLQLLLFG 223

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/255 (22%), Positives = 97/255 (38%), Gaps = 17/255 (6%)

Query: 68  QTSAKSVGALDIIRKLVKNEGVWAFYKG-SLIPIVGVGACVSVQFGVNEAMKRFFREWNT 126
           Q + +  GALD ++++   EGV   Y+G     + G     S  F      K +FR    
Sbjct: 67  QAAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFR-LKQ 125

Query: 127 SRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCI 186
           +RG   R  T    +  + G+     +    +PI  V  R QT+       + +     +
Sbjct: 126 ARGGDARFST---PEELVLGIVAAATSQLFVNPINVVATRQQTRGQAAGAADMRTVAREV 182

Query: 187 RKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIA-SWKLCS---- 241
                 +    GL+  ++   +     + TYE L           S +  S  L S    
Sbjct: 183 HAENGWRGFWAGLKVSLVLTVNP-SITYATYERLREALFPTPAAASHLVDSAALLSPGQN 241

Query: 242 --YGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFA 299
              G LS +V  +   PL + K+ +Q    R+         V++HLY  +G  + +KG  
Sbjct: 242 FVMGVLSKIVSTVLTQPLIIAKASLQ----RSGSCFQDFHQVLHHLYSTEGPLSLWKGLG 297

Query: 300 PTMLRAAPVNGATFV 314
           P + +   V G  F+
Sbjct: 298 PQITKGVLVQGLLFM 312

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 111/279 (39%), Gaps = 23/279 (8%)

Query: 40  LKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKG---S 96
           L  ++     GI ++ V  P DT   R+ ++   +     +  +V  E     +     +
Sbjct: 10  LARVVGSASAGILEIGVFHPVDTISKRLMSNHTKITNAQQLNDVVFREHASKPFGQRLFT 69

Query: 97  LIPIVGVGACVSV-QFGVNEAMKRFFREWNTSRGTQHRDGTL--QLGQYYICGLTGGVVN 153
           L P +G  A   + Q       + F  E+         DG    + G+       G ++ 
Sbjct: 70  LFPGLGYAATYKIFQRVYKYGGQPFANEFLNKHFKADFDGAFGEKTGKALRSATAGSLIG 129

Query: 154 --SFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK-SLMRGLRPMMLRAGHGL 210
               +  P++ ++I+ QT     N   F+G    +R L  E   L RG      R  +  
Sbjct: 130 IGEIVLLPLDVLKIKRQT-----NPESFRG-RGFLRILRDEGMGLYRGWGWTAAR--NAP 181

Query: 211 GCYFLTYEALIANEIKKG-KDRSEIASWKLCSYGSLSGVVLWLAI-YPLDVVKSMIQTDT 268
           G + L      A E   G KD S+ A+W      S+ G    L +  PLDV+K+ IQ+  
Sbjct: 182 GSFALFGGNAFAKEYILGLKDYSQ-ATWGQNFVSSIFGASASLIVSAPLDVIKTRIQS-- 238

Query: 269 LRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAP 307
            RN     S   ++ +  + +G +AFFKG  P +L   P
Sbjct: 239 -RNFESAESGFTIVKNTLKNEGATAFFKGLTPKLLTTGP 276

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 41/81 (50%), Gaps = 6/81 (7%)

Query: 41  KDILAGTCGGISQVIVGQPFDTTKVRMQT----SAKSVGALDIIRKLVKNEGVWAFYKGS 96
           ++ ++   G  + +IV  P D  K R+Q+    SA+S     I++  +KNEG  AF+KG 
Sbjct: 210 QNFVSSIFGASASLIVSAPLDVIKTRIQSRNFESAES--GFTIVKNTLKNEGATAFFKGL 267

Query: 97  LIPIVGVGACVSVQFGVNEAM 117
              ++  G  +   F + + +
Sbjct: 268 TPKLLTTGPKLVFSFAIAQTL 288

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/190 (20%), Positives = 84/190 (44%), Gaps = 23/190 (12%)

Query: 38  RVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSL 97
           + L+   AG+  GI ++++  P D  K++ QT+ +S      +R ++++EG+   Y+G  
Sbjct: 117 KALRSATAGSLIGIGEIVL-LPLDVLKIKRQTNPESFRGRGFLR-ILRDEGM-GLYRGWG 173

Query: 98  IPIVGVGACVSVQFGVNEAMKRF---FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNS 154
                        FG N   K +    ++++ +            GQ ++  + G   + 
Sbjct: 174 WTAARNAPGSFALFGGNAFAKEYILGLKDYSQA----------TWGQNFVSSIFGASASL 223

Query: 155 FLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLRAGHGLG 211
            +++P++ ++ R+Q++     E  F      ++  +K +   +  +GL P +L  G  L 
Sbjct: 224 IVSAPLDVIKTRIQSRNFESAESGF----TIVKNTLKNEGATAFFKGLTPKLLTTGPKLV 279

Query: 212 CYFLTYEALI 221
             F   + LI
Sbjct: 280 FSFAIAQTLI 289

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 52/247 (21%), Positives = 98/247 (39%), Gaps = 17/247 (6%)

Query: 59  PFDTTKVRMQTSAKSVGA-LDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAM 117
           P D  K R+Q + +   + LD  + +V++EG+   + G     +G     + ++G  E  
Sbjct: 35  PLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYF 94

Query: 118 KRFFREWNTSRGTQHRDGTLQLGQYYICG-LTGGVVNSFLASPIEHVRIRLQTQTGNGNE 176
           K+ +     S  T HR  T      Y+C   +   +   L  P E ++++ QT      +
Sbjct: 95  KQTYSNL-LSPETAHRHRT----AVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCK 149

Query: 177 REFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYE---ALIANEIKKGKDRSE 233
              +G    I        L +G+ P+  R      C F ++E    +I  ++ + K    
Sbjct: 150 NFLEG-WSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMS 208

Query: 234 IASWKLCSY--GSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGI 291
            +     S+  G L+G++  +  +P DV+ S +  D  +      SM      +Y   G 
Sbjct: 209 PSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQG----ESMVEASKRIYSRIGF 264

Query: 292 SAFFKGF 298
              + G 
Sbjct: 265 GGLWNGL 271

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 83/200 (41%), Gaps = 33/200 (16%)

Query: 141 QYYICGLTGGVV----NSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLM 196
           +YY     GGVV         +P++ V+ RLQ      N + ++  LD  + +V+ + L 
Sbjct: 13  EYYAACTLGGVVACGPTHSSVTPLDLVKCRLQV-----NPQLYRSNLDGWKTIVRSEGLS 67

Query: 197 R---GLRPMMLRAGHGLGC------YF-LTYEALIANEIKKGKDRSEIASWKLCSYGS-- 244
           +   G+    +       C      YF  TY  L++ E    + R+ +    LC+  S  
Sbjct: 68  KVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAH-RHRTAV---YLCASASAE 123

Query: 245 -LSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTML 303
            L+ ++L     P + +K   QT     P F  +     + +   +G+S  +KG  P   
Sbjct: 124 FLADILL----CPWEAIKVKQQTTI---PPFCKNFLEGWSKITAAEGLSGLYKGITPLWC 176

Query: 304 RAAPVNGATFVTFELVMRLL 323
           R  P     F +FE ++ ++
Sbjct: 177 RQIPYTMCKFTSFERIVEMI 196

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 71/167 (42%), Gaps = 6/167 (3%)

Query: 157 ASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLT 216
           A P++    R            F G +  I +    +  ++G  P + R        F T
Sbjct: 173 ARPVQTAHERWLLHYERQPSSHFAGTVLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTT 232

Query: 217 YEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKN 276
           Y A I   +   K   E   ++  + G+LS   +     P+DV+K+ +Q+ T     +K+
Sbjct: 233 Y-AWIVQSLSPHKALDE---YQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWF-TYKS 287

Query: 277 SMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
           S+ N    ++ E+G    +KG+ P + + +   G +F  ++ V  L+
Sbjct: 288 SL-NCAYRIFVEEGFRYMWKGWVPRLFKVSLSGGISFGVYQYVENLV 333

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 35/87 (40%), Gaps = 3/87 (3%)

Query: 45  AGTCGGISQVIVGQPFDTTKVRMQTSAKSV---GALDIIRKLVKNEGVWAFYKGSLIPIV 101
           AG     + V + QP D  K RMQ+         +L+   ++   EG    +KG +  + 
Sbjct: 254 AGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAYRIFVEEGFRYMWKGWVPRLF 313

Query: 102 GVGACVSVQFGVNEAMKRFFREWNTSR 128
            V     + FGV + ++     W   R
Sbjct: 314 KVSLSGGISFGVYQYVENLVLLWEHER 340

>Scas_645.9
          Length = 391

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 56/282 (19%), Positives = 112/282 (39%), Gaps = 40/282 (14%)

Query: 68  QTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTS 127
            +S +  G L+   K+ K EG+   ++G  I ++       V F   E ++      N+ 
Sbjct: 124 NSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLRD-----NSP 178

Query: 128 RGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLD--C 185
             T             +CG    ++ +   +P+E ++ +LQ+       R  K       
Sbjct: 179 LATSS-----PTFNPLMCGAIARILAASTVAPLELLKTKLQSI-----PRVSKSTTSWMM 228

Query: 186 IRKLVKE-----------KSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEI 234
           +++L+KE            +L +GL   + R       Y+ +YE    +           
Sbjct: 229 VKELLKETRQEMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSN 288

Query: 235 ASWKLCSY--GSLSGVVLWLAIYPLDVVKSMIQTD--------TLRNPRFKNS--MKNVI 282
            ++ + S+  GS+SG +  L  +P DV K+  Q           +++P  + +  M   +
Sbjct: 289 LTFFINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFL 348

Query: 283 NHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLLG 324
            ++++ +G  A + G  P M++ AP       ++EL  RL  
Sbjct: 349 RNIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKRLFN 390

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 100/266 (37%), Gaps = 87/266 (32%)

Query: 125 NTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQ-------------- 170
           N +  T   DG L L Q  +   TG ++ S   +P++ VRIRLQ Q              
Sbjct: 23  NRAMSTNATDG-LTLHQRMLSASTGSLLTSLTLTPMDVVRIRLQQQELLPDCSCETIAVK 81

Query: 171 ----------------------TGNGNEREFKGP----LDC----------------IRK 188
                                 TGN N+  +  P    L+C                I K
Sbjct: 82  DFLPKAKTDLSSVQVSRAATISTGNKNKVFWDNPCFQELNCKNSSVRFNGTLEAFNKIWK 141

Query: 189 LVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWK------LCSY 242
           L    +L RG+   +L A      YF  YE L        +D S +A+        +C  
Sbjct: 142 LEGITTLWRGISINLLMAIPANIVYFTGYEYL--------RDNSPLATSSPTFNPLMC-- 191

Query: 243 GSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNS------MKNVINHLYREQGIS---- 292
           G+++ ++    + PL+++K+ +Q+     PR   S      +K ++    +E  IS    
Sbjct: 192 GAIARILAASTVAPLELLKTKLQSI----PRVSKSTTSWMMVKELLKETRQEMRISGASN 247

Query: 293 AFFKGFAPTMLRAAPVNGATFVTFEL 318
           A FKG   T+ R  P +   + ++E 
Sbjct: 248 ALFKGLEITLWRDVPFSAIYWGSYEF 273

 Score = 32.3 bits (72), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 37/100 (37%), Gaps = 15/100 (15%)

Query: 37  TRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTS-----AKSV----------GALDIIR 81
           T  +   + G+  G    +V  PFD  K R Q S      KSV               +R
Sbjct: 290 TFFINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLR 349

Query: 82  KLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFF 121
            + K EG  A Y G +  +V +    ++     E  KR F
Sbjct: 350 NIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKRLF 389

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/274 (18%), Positives = 111/274 (40%), Gaps = 23/274 (8%)

Query: 52  SQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQF 111
           SQV      D+ + ++  + +    +D +  + K +G+   Y+G  +  V       V F
Sbjct: 33  SQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKEKGILGLYQGMTVTTVATFVQNFVYF 92

Query: 112 GVNEAMKRFFREWNTS--RGTQHRDG--TLQLGQYYICGLTGGVVNSFLASPIEHVRIRL 167
                +++ + +      +  ++RDG  T    +  + G+    ++    SP+  V  R 
Sbjct: 93  FWYTFIRKSYMKHKLLGLQSLKNRDGPITPSTIEELVLGVAAASISQLFTSPMAVVATRQ 152

Query: 168 QTQTGNGNEREFKGPLDCIRKLVKEK-----SLMRGLR---PMMLRAGHGLGCYFLTYEA 219
           QT   +    +F    + I+ + +E      +  +GLR    + +        +    E 
Sbjct: 153 QT-VHSAESAKFT---NVIKDIYRENNGDITAFWKGLRTGLALTINPSITYASFQRLKEV 208

Query: 220 LIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMK 279
              +        S + ++ L   G LS ++  L   PL V K+M+Q+   +   F+ ++ 
Sbjct: 209 FFHDHSNDAGSLSAVQNFIL---GVLSKMISTLVTQPLIVAKAMLQSAGSKFTTFQEALL 265

Query: 280 NVINHLYREQGISAFFKGFAPTMLRAAPVNGATF 313
               +LY+ +G+ + +KG  P + +   V G  F
Sbjct: 266 ----YLYKNEGLKSLWKGVLPQLTKGVIVQGLLF 295

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 45/85 (52%), Gaps = 21/85 (24%)

Query: 243 GSLSGVVLWLAIYPLDVVKSMIQTD-------------TLRNPRFKNSMKNVINHLYREQ 289
           G+++  +  +A+YPLD+ K++IQ+               L N R+KN +  +IN +++E+
Sbjct: 10  GAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMIN-IFKEK 68

Query: 290 GISAFFKGFAPTMLRAAPVNGATFV 314
           GI   ++G   T +       ATFV
Sbjct: 69  GILGLYQGMTVTTV-------ATFV 86

>Scas_613.24
          Length = 177

 Score = 38.1 bits (87), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 72/178 (40%), Gaps = 21/178 (11%)

Query: 134 DGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK 193
           D + +   + + G  GG+ ++    P++ ++ R+Q   G       K   D I+      
Sbjct: 3   DKSPKTSVHLVSGFIGGLSSAVTLQPLDLLKTRIQQHKGATLWSAIKDIKDPIQ------ 56

Query: 194 SLMRGLRPMMLRAGHGLGCYFLTYEAL---IANEIKKGKDRSEIASWKLCSYGSL----- 245
              RG  P  LR   G   Y      +   + +  K        +  +L  Y +L     
Sbjct: 57  -FWRGTLPSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAM 115

Query: 246 -SGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTM 302
             G+V ++ + P+ ++K   ++          SM   I  +Y+ +GIS FFKGF PT+
Sbjct: 116 ARGLVGYITM-PITILKVRYESTYYSY----KSMNEAIKDIYKMEGISGFFKGFGPTV 168

 Score = 28.5 bits (62), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 5/61 (8%)

Query: 48  CGGISQVIVG---QPFDTTKVRMQTSAKSVGAL-DIIRKLVKNEGVWAFYKGSLIPIVGV 103
            G +++ +VG    P    KVR +++  S  ++ + I+ + K EG+  F+KG   P VG+
Sbjct: 112 TGAMARGLVGYITMPITILKVRYESTYYSYKSMNEAIKDIYKMEGISGFFKG-FGPTVGI 170

Query: 104 G 104
           G
Sbjct: 171 G 171

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 62/299 (20%), Positives = 120/299 (40%), Gaps = 51/299 (17%)

Query: 59  PFDTTKVRMQTSAKSVGA------------LDIIRKLVKNEGVWAFYKGSLIPIVGVGAC 106
           P D  K  +QT  K+  +            +D I K+ K  G    Y+G       +   
Sbjct: 23  PLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLYQG-------LATN 75

Query: 107 VSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLG-----------QYYICGLTGGVVNSF 155
           V+  F V   +  F+     S     + G LQL            +    G++ G +   
Sbjct: 76  VAANF-VQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEELALGMSAGAMTQV 134

Query: 156 LASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK-----SLMRGLRPMMLRAGHGL 210
           + +PI  +  R Q  T +G +   K     I+++ +E      +  +G +  ++ + +  
Sbjct: 135 VTNPISVISTR-QQLTKDGEDASLKA---VIKQIYEESNGDLTAFWKGFKVALVLSTNPA 190

Query: 211 GCYFLTYEALIANEIK-KGKDRSEIASWKLCS-----YGSLSGVVLWLAIYPLDVVKSMI 264
             Y  +Y+ L +  +  KG   S+  S +L +      G  S ++      PL V K  +
Sbjct: 191 ITYG-SYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGMFSKMISTFVTQPLIVAKITL 249

Query: 265 QTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
           Q    +  +FK + + V+ H+Y+ +G  + +KG  P + +   V G  F   + ++R++
Sbjct: 250 QG---KGSKFK-TFQEVLQHIYQNEGFLSLWKGVIPQVSKGVIVQGLLFTYKDEIVRVI 304

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 46/94 (48%), Gaps = 9/94 (9%)

Query: 234 IASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQT--------DTLRNPRFKNSMKNVINHL 285
           +AS +    G+++  +    +YPLD+ K++IQT        D+    ++KN +  +I  +
Sbjct: 1   MASLESAFTGAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCII-KI 59

Query: 286 YREQGISAFFKGFAPTMLRAAPVNGATFVTFELV 319
           ++++G    ++G A  +      N   F  + L+
Sbjct: 60  FKKRGFLGLYQGLATNVAANFVQNFIYFFWYSLI 93

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 54/250 (21%), Positives = 99/250 (39%), Gaps = 24/250 (9%)

Query: 59  PFDTTKVRMQTS-------AKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQF 111
           P  T   RMQ S        +S   L+ +R++ + EGV  FY G    + G+ A      
Sbjct: 36  PLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAA------ 89

Query: 112 GVNEAMKRFFREWNTSRGTQHRDGT--LQLGQYYICGLTGGVVNSFLASPIEHVRIRLQT 169
             N     +F E   +R T    G+  L   +  +     G + +  ++PI  V  R+  
Sbjct: 90  --NSLNYYYFYEL-AARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRM-- 144

Query: 170 QTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGK 229
                 +      LD +RK     +L  GLRP ++   + +  Y + +E L    +K   
Sbjct: 145 TVAKSEQSTLAVLLDIVRK-DGVTALFNGLRPALMLVSNPIIQYTV-FEQLKNVVLKWSG 202

Query: 230 DRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKS-MIQTDTLRNPRFKNSMKNVINHLYRE 288
               + SW     G++  +    + YP   +K+ M       +   + SM +++  + ++
Sbjct: 203 SDVLLPSWAFL-LGAVGKLAATGSTYPYITLKTRMHLAKGKEDADTQQSMWSLMVDIVKK 261

Query: 289 QGISAFFKGF 298
           +GI   + G 
Sbjct: 262 EGIQGLYHGI 271

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 95/219 (43%), Gaps = 41/219 (18%)

Query: 126 TSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQ---TGNGNEREFKGP 182
           T + T+ R+ +     + I G  GG+ ++    P++ ++ R+Q     T   N +E   P
Sbjct: 2   TEQATKPRNSS-----HLIGGFFGGLTSAVALQPLDLLKTRIQQDKKATLWKNLKEIDSP 56

Query: 183 LDCIRKLVKEKSLMRGLRPMMLRAGHG----LGCYFLTYEALIA--NEIKKGKDRSEIAS 236
           L           L RG  P  LR   G    L C  L   +L    N +    + S I  
Sbjct: 57  LQ----------LWRGTLPSALRTSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVY 106

Query: 237 WKLCSYGSLS------------GVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINH 284
            K  S   L+            G+V ++ + P+ V+K   ++ TL N    +S+K  I H
Sbjct: 107 NKSSSLPRLTMYENLLTGAFARGLVGYITM-PITVIKVRYES-TLYN---YSSLKEAITH 161

Query: 285 LYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
           +Y ++G+  FF+GF  T LR AP  G   + +E   +LL
Sbjct: 162 IYTKEGLFGFFRGFGATCLRDAPYAGLYVLLYEKSKQLL 200

 Score = 35.8 bits (81), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 2/67 (2%)

Query: 56  VGQPFDTTKVRMQTS-AKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVN 114
           V  PFDT K RMQ   +K   + +    +VKNE V   + G  + +        + +G+ 
Sbjct: 240 VTAPFDTIKTRMQLEPSKFTNSFNTFTSIVKNENVLKLFSGLSMRLARKAFSAGIAWGIY 299

Query: 115 EAM-KRF 120
           E + KRF
Sbjct: 300 EELVKRF 306

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 71/172 (41%), Gaps = 24/172 (13%)

Query: 59  PFDTTKVRMQTSA-KSVGALD--IIRKLV---KNEGVWAFYKGSLIPIVGVGACVSVQFG 112
           P    K RMQ  A + V  L   + R+LV   K+ GV   Y+G    ++  G   +VQ  
Sbjct: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196

Query: 113 VNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTG 172
           V    K           ++H    + L  Y +      V      +P +    R+    G
Sbjct: 197 VYSHAKEAL--------SRHVPDGMAL--YTLASALSSVAVCIAMNPFDVAMTRMYHHRG 246

Query: 173 NGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLR-AGHGLGCYFLTYEAL 220
                 ++GPLDC+ K V+++   +L +G    +LR A H + C  L  +AL
Sbjct: 247 G----LYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQAL 294

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 77/176 (43%), Gaps = 24/176 (13%)

Query: 158 SPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVK------EKSLMRGLRPMMLRAGHG-- 209
           SP++ V+ R+Q        R    P    R+LV        + L +G+   +LR G G  
Sbjct: 136 SPLQLVKTRMQAL---APRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSA 192

Query: 210 --LGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTD 267
             L  Y    EAL +  +  G     +A + L S  +LS V + +A+ P DV  +M +  
Sbjct: 193 VQLAVYSHAKEAL-SRHVPDG-----MALYTLAS--ALSSVAVCIAMNPFDV--AMTRMY 242

Query: 268 TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
             R   ++  + + +    R++G SA +KG    +LR AP         E  +R++
Sbjct: 243 HHRGGLYRGPL-DCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVV 297

 Score = 34.3 bits (77), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 2/81 (2%)

Query: 44  LAGTCGGISQVIVGQPFDTTKVRMQTSAKSV--GALDIIRKLVKNEGVWAFYKGSLIPIV 101
           LA     ++  I   PFD    RM      +  G LD + K V+ EG  A YKG L  ++
Sbjct: 218 LASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLL 277

Query: 102 GVGACVSVQFGVNEAMKRFFR 122
            +     +   + E   R  R
Sbjct: 278 RIAPHTILCLTLMEQALRVVR 298

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 69/328 (21%), Positives = 120/328 (36%), Gaps = 66/328 (20%)

Query: 43  ILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVG 102
           I AG+  G+    +  PF+  K  +Q     V A       V    V  ++ G     +G
Sbjct: 13  ITAGSVSGLFSATITYPFEFLKTGLQLHRNVVAAKPF---EVLGYQVRTYFAGCSAVNIG 69

Query: 103 VGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEH 162
           V    S++F   +    + R    +     +D  L   Q  + G   G + S    P E+
Sbjct: 70  VVMKTSLRFLAFDKASEWLRPPALA-----KDAPLSGVQLLMAGALTGTMESLCIIPFEN 124

Query: 163 VRI-----------RLQTQTGN-----GNERE---FKGP------------------LDC 185
           V++           RL T T N      NE +    K P                  L  
Sbjct: 125 VKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEALFPEKLPTNVLTT 184

Query: 186 IRKLVKEKSL---MRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSY 242
             +L ++  L    +G  P ++R        F T+  L     K+ ++    A+      
Sbjct: 185 AAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKEYQNNEYFATL----L 240

Query: 243 GSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSM---KNVINHLYR---EQGISAFFK 296
           G +S   +  A  PLDV+K+ +Q         K+S+   +N IN  YR   E+G +  +K
Sbjct: 241 GLISSCAVVGATQPLDVIKTRMQA--------KDSVLLYRNSINCAYRIFVEEGFAMLWK 292

Query: 297 GFAPTMLRAAPVNGATFVTFELVMRLLG 324
           G+ P +++       +F  ++    ++ 
Sbjct: 293 GWLPRLMKVGLSGSVSFGIYQYTENMIA 320

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 8/72 (11%)

Query: 256 PLDVVKSMIQTDTLRNPRFKNSMKNVINHLYR---EQGISAFFKGFAPTMLRAAPVNGAT 312
           P+DVVK+ + +        K   KN +N +YR   ++G++ F+KG     ++     G T
Sbjct: 214 PIDVVKTRMMSQNA-----KTEYKNTLNCMYRIFVQEGMATFWKGSIFRFMKVGISGGLT 268

Query: 313 FVTFELVMRLLG 324
           F  +E V  LLG
Sbjct: 269 FTVYEQVSLLLG 280

 Score = 35.0 bits (79), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 42  DILAGTCGGISQVIVGQPFDTTKVRMQT-SAKS--VGALDIIRKLVKNEGVWAFYKGSLI 98
            ++ G     + V + QP D  K RM + +AK+     L+ + ++   EG+  F+KGS+ 
Sbjct: 197 SVITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWKGSIF 256

Query: 99  PIVGVGACVSVQFGVNE 115
             + VG    + F V E
Sbjct: 257 RFMKVGISGGLTFTVYE 273

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/116 (20%), Positives = 47/116 (40%), Gaps = 26/116 (22%)

Query: 234 IASWKLCSYGSLSGVVLWLAIYPLDVVKS-MIQTDTLRNPRFKNSMKNV----------- 281
           +  + L   G+L+G+V  L I P + +K+ +IQ+  + + + + +   V           
Sbjct: 73  LTGYNLLIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVAT 132

Query: 282 --------------INHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323
                         + H+Y+ +G +AF +G   T+ R        F  +    RLL
Sbjct: 133 KSTPVARIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLL 188

>Scas_715.45
          Length = 305

 Score = 35.4 bits (80), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 32/68 (47%), Gaps = 3/68 (4%)

Query: 256 PLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVT 315
           P + +K   QT     P + N++      +Y ++G++ F+KG  P   R  P     F +
Sbjct: 135 PFEAIKVKQQTTM---PPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTS 191

Query: 316 FELVMRLL 323
           FE ++  +
Sbjct: 192 FERIVEAI 199

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 32/70 (45%), Gaps = 4/70 (5%)

Query: 253 AIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGAT 312
           ++ PLD++K  +Q D    P    S  + I  + +++G+   F G   T +  +      
Sbjct: 33  SVTPLDLIKCRLQVD----PTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGK 88

Query: 313 FVTFELVMRL 322
           +  +EL  RL
Sbjct: 89  YGGYELFKRL 98

>Kwal_55.21338
          Length = 323

 Score = 35.4 bits (80), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 52/128 (40%), Gaps = 8/128 (6%)

Query: 41  KDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPI 100
           + +L G+  G        P      RM       G L  I  +VK+EG+   +KG L P 
Sbjct: 120 ESMLVGSIAGSLNATAANPLWVANTRMTVQKSDRGTLSTIFDIVKDEGISGLFKG-LNPA 178

Query: 101 VGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPI 160
           + +     +Q+ V E +K +     +SR T+    TL     +I G  G +  +    P 
Sbjct: 179 LILVINPIIQYTVYEQLKNWIL---SSRQTR----TLSPSWAFILGAVGKLAATGSTYPY 231

Query: 161 EHVRIRLQ 168
             ++ R+ 
Sbjct: 232 VTMKARMH 239

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 29/67 (43%), Gaps = 2/67 (2%)

Query: 255 YPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFV 314
           YPL VV + +QT   +  +   S+ + I  +YR+ G   FF G    +      N   + 
Sbjct: 41  YPLIVVTTKLQTQDAKGEKL--SLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYYY 98

Query: 315 TFELVMR 321
            +E   R
Sbjct: 99  CYEASSR 105

 Score = 31.6 bits (70), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 61/151 (40%), Gaps = 12/151 (7%)

Query: 156 LASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLM---RGLRPMMLRAGHGLGC 212
           L  P+  V  +LQTQ   G +       D I+ + ++   M    GL   +         
Sbjct: 39  LTYPLIVVTTKLQTQDAKGEKLSLA---DTIKDIYRKDGAMGFFAGLESALFGTTLSNFV 95

Query: 213 YFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNP 272
           Y+  YEA  +  + + +    + + +    GS++G +   A  PL V  + +        
Sbjct: 96  YYYCYEA-SSRCVLRARHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQ----- 149

Query: 273 RFKNSMKNVINHLYREQGISAFFKGFAPTML 303
           +      + I  + +++GIS  FKG  P ++
Sbjct: 150 KSDRGTLSTIFDIVKDEGISGLFKGLNPALI 180

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 35.0 bits (79), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 58/273 (21%), Positives = 108/273 (39%), Gaps = 40/273 (14%)

Query: 59  PFDTTKVRMQTSAKS-----VGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGV 113
           P  T   ++QT            L+ I+++ + +G+  FY G    I G+     V +  
Sbjct: 33  PLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFVYYYF 92

Query: 114 NEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGN 173
            E   R     N  +  +H+   L   +  + G   G V +  ++PI     R+      
Sbjct: 93  YELTSR-----NVLKVRKHKK--LNTLESMLTGCVAGSVTAIASNPIWVANTRMTVT--- 142

Query: 174 GNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKD 230
              +  K  L  I ++VK+   K+L  GL+P ++   + +  Y + +E L    +   K 
Sbjct: 143 ---KSEKTALATIIEIVKKDSAKTLFNGLKPALVLVMNPIVQYTV-FEQLKNLVLAWNKQ 198

Query: 231 RSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQ-------TDTLRNPRFK------NS 277
                SW     G+L  +    + YP   +K+ +        TD     + K       S
Sbjct: 199 GILSPSWAFL-LGALGKLAATGSTYPYITLKTRMHLSESGKHTDDDSGKKAKGHKASSKS 257

Query: 278 MKNVINHLYREQGISAFFKG----FAPTMLRAA 306
           M ++I  + ++ G+S  ++G     A ++L AA
Sbjct: 258 MLSLITEIVKKDGVSGLYRGVGIKLAQSILTAA 290

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 2/68 (2%)

Query: 255 YPLDVVKSMIQTD-TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATF 313
           YPL  + + +QT     N + K+ ++  I  +YR+ G+  F+ G    +   A  N   +
Sbjct: 32  YPLVTITTKLQTQGNDENNQVKSKLET-IKEIYRKDGLLGFYAGLESAIYGMALTNFVYY 90

Query: 314 VTFELVMR 321
             +EL  R
Sbjct: 91  YFYELTSR 98

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 34/158 (21%), Positives = 69/158 (43%), Gaps = 24/158 (15%)

Query: 156 LASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLG---- 211
           L  P+  +  +LQTQ  + N  + K  L+ I+++ ++  L+ G    +  A +G+     
Sbjct: 30  LTYPLVTITTKLQTQGNDENN-QVKSKLETIKEIYRKDGLL-GFYAGLESAIYGMALTNF 87

Query: 212 CYFLTYEALIAN--EIKKGKDRSEIASWKL-CSYGSLSGVV---LWLAIYPLDVVKSMIQ 265
            Y+  YE    N  +++K K  + + S    C  GS++ +    +W+A   + V KS   
Sbjct: 88  VYYYFYELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKSE-- 145

Query: 266 TDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTML 303
                    K ++  +I  + ++      F G  P ++
Sbjct: 146 ---------KTALATII-EIVKKDSAKTLFNGLKPALV 173

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 31.6 bits (70), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 13/94 (13%)

Query: 41  KDILAGTCGGISQVIVGQPFDTTKVRMQTSA----------KSVGALDIIRKLVKNEGVW 90
           K  +    GG++Q +V  PFD  + R Q  A          KSV   D +  + K EG  
Sbjct: 13  KLAMGAISGGVAQTLV-YPFDLLRRRFQVLAMGGNELGFRYKSVS--DALITIGKTEGPK 69

Query: 91  AFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREW 124
            +YKG    +  V    +V + V E ++    EW
Sbjct: 70  GYYKGLTANLFKVIPSTAVSWLVYEVIREAMVEW 103

 Score = 31.6 bits (70), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/80 (20%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 243 GSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLY---REQGISAFFKGFA 299
           G++SG V    +YP D+++   Q   +         K+V + L    + +G   ++KG  
Sbjct: 17  GAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGYYKGLT 76

Query: 300 PTMLRAAPVNGATFVTFELV 319
             + +  P    +++ +E++
Sbjct: 77  ANLFKVIPSTAVSWLVYEVI 96

>Kwal_23.5757
          Length = 307

 Score = 32.7 bits (73), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 14/68 (20%), Positives = 32/68 (47%), Gaps = 2/68 (2%)

Query: 256 PLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVT 315
           P + +K  ++  T   P F  ++ +  + +   +G ++ +KG  P   R  P     F +
Sbjct: 136 PWEAIK--VRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTS 193

Query: 316 FELVMRLL 323
           FE ++ ++
Sbjct: 194 FERIVEMI 201

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 72/181 (39%), Gaps = 19/181 (10%)

Query: 43  ILAGTCGGISQVIVGQPFDT-------TKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKG 95
           I+ G  GG++Q  +   F T       TK +   +     +    +++   EG+    KG
Sbjct: 109 IMGGVSGGVAQAYLTMGFCTCMKTVEITKHKSAAAGAKQSSWAAFKEIYNKEGIRGINKG 168

Query: 96  SLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSF 155
                +        +FG +  ++   R++     T   D    L + +   + GG+  S 
Sbjct: 169 VNAVAIRQMTNWGSRFGFSRLVEEGLRKFTGK--TNPDDKLTALEKIFASAIGGGL--SA 224

Query: 156 LASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGLGC 212
              PIE +R+ +Q++T + N  +        R + +    K L RG+ P +     GLG 
Sbjct: 225 WNQPIEVIRVEMQSKTNDPNRPKDLTVGKAFRYIYQSNGVKGLYRGVTPRI-----GLGI 279

Query: 213 Y 213
           +
Sbjct: 280 W 280

>Scas_671.1*
          Length = 123

 Score = 28.5 bits (62), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 35/84 (41%), Gaps = 2/84 (2%)

Query: 33  AKDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKS-VGALDIIRKLVKNEGVWA 91
           +  ++ V+  + A     ++  I   PFDT K RMQ   K        +  + KNE ++ 
Sbjct: 34  STSTSTVVNSVSAIASASLATAITA-PFDTIKTRMQLKPKVFTNFFTTLVLITKNESIFQ 92

Query: 92  FYKGSLIPIVGVGACVSVQFGVNE 115
            + G  + +        + +G+ E
Sbjct: 93  LFSGLSMRLTRKALSAGIAWGIYE 116

>AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516)
           [1440 bp, 479 aa]
          Length = 479

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 6/56 (10%)

Query: 207 GHGLGCYFLTYEALIANEIKKGKDRSEIASW------KLCSYGSLSGVVLWLAIYP 256
           GH  GCY L     + N++  G     +  W      +LCS+ +  G+V  L + P
Sbjct: 65  GHRDGCYVLAKNYNVLNKLASGSADGVVKYWNMATREELCSFRAHYGLVTGLCVTP 120

>Scas_688.3
          Length = 296

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 173 NGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIA 222
           NG + ++K  ++ +  L+  KS++  L+P   R G+   C   T+E L+A
Sbjct: 145 NGKDFDYKEKIEGMGPLILNKSVV-ALQPGSAREGNNFKCKLATFENLLA 193

>YFR002W (NIC96) [1682] chr6 (150011..152530) Nuclear pore protein
           (nucleoporin), acts in a complex with Nsp1p, Nup57p, and
           Nup49p, functions in the assembly and nuclear export of
           the small ribosomal subunit [2520 bp, 839 aa]
          Length = 839

 Score = 29.3 bits (64), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 47/109 (43%), Gaps = 18/109 (16%)

Query: 207 GHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPL---DVVKSM 263
             GL       ++ I  ++KK        SWK+ +   ++GV +W  I+ L    ++K  
Sbjct: 295 NEGLATNVNKIKSFIDTKLKKAD-----KSWKISNLTVINGVPIWALIFYLLRAGLIKEA 349

Query: 264 IQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGAT 312
           +Q   + N   K ++K V      EQ    +FK +A +     PV  +T
Sbjct: 350 LQV-LVEN---KANIKKV------EQSFLTYFKAYASSKDHGLPVEYST 388

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.138    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,704,961
Number of extensions: 374080
Number of successful extensions: 2114
Number of sequences better than 10.0: 208
Number of HSP's gapped: 1244
Number of HSP's successfully gapped: 471
Length of query: 324
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 222
Effective length of database: 13,065,073
Effective search space: 2900446206
Effective search space used: 2900446206
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)