Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_718.49*82982941170.0
YBR058C (UBP14)78180019180.0
CAGL0H10186g77880417910.0
Kwal_56.2308476279716790.0
AGR023C78081516080.0
KLLA0F18700g77080214700.0
Sklu_1729.11361262296e-22
CAGL0G05247g9472531421e-08
AFR007W8482581251e-06
YHL010C585621213e-06
Scas_545.2*9182541213e-06
Scas_11.1*88431083e-06
KLLA0C06974g4463651161e-05
Kwal_14.20084242591132e-05
YFR010W (UBP6)499431105e-05
Kwal_26.8090520651105e-05
Scas_623.2*795901098e-05
KLLA0A10791g484431089e-05
Scas_609.9729701081e-04
Kwal_34.16268449431071e-04
YDR069C (DOA4)926761081e-04
AEL029W446431071e-04
Scas_618.5493431061e-04
CAGL0K02563g586391071e-04
CAGL0M11198g4612011052e-04
CAGL0K10494g495411043e-04
AGL079C506531016e-04
KLLA0F25740g517531007e-04
AFR627C1287100990.001
YJL197W (UBP12)1254100980.002
CAGL0L01639g1147101980.002
YNL186W (UBP10)79262980.002
Scas_655.487562960.003
Scas_715.2717164950.004
Kwal_33.136281160108950.004
Scas_634.141201107950.004
YER098W (UBP9)75443920.008
KLLA0D08459g750283920.008
Kwal_33.14430511281910.009
YMR223W (UBP8)471158910.009
CAGL0I05522g72476910.010
Sklu_2425.875442910.011
KLLA0E10252g796127900.013
CAGL0J11352g77164900.013
ABL145W74964890.020
Scas_698.7103084890.020
Scas_692.3946660880.020
AGR370W74069870.030
KLLA0C03476g125298870.034
KLLA0E20449g69720850.050
CAGL0A04477g77020850.052
YBL067C (UBP13)68839850.059
YER144C (UBP5)80569850.061
Sklu_1544.245467840.065
Kwal_55.1964597038840.069
YIL156W (UBP7)107183840.075
KLLA0A00396g101263840.078
CAGL0G02563g63119830.095
CAGL0I06765g88782830.11
AGR139C78969810.16
Kwal_26.915145459800.21
Kwal_55.2126760450790.24
KLLA0F23463g101396790.27
AFR296C116970790.32
YER151C (UBP3)91274780.40
KLLA0E08767g77118770.50
Kwal_27.1084271120770.51
YOR138C67167760.68
Scas_555.691770760.71
Scas_714.11126927750.78
CAGL0K10252g126755750.79
YKR098C (UBP11)71785750.90
Scas_664.17494205740.97
Kwal_55.21393123326741.3
CAGL0H06721g108192721.8
Scas_695.748218721.8
AFR551W469366721.9
Sklu_2195.429148702.1
AAR175C65469712.2
CAGL0J08393g66791712.6
Scas_562.1230068702.7
YOR124C (UBP2)127229712.8
Sklu_1620.277261703.4
ACL164C138926703.5
KLLA0E02376g122020703.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_718.49*
         (829 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_718.49*                                                         1590   0.0  
YBR058C (UBP14) [248] chr2 complement(353632..355977) Ubiquitin-...   743   0.0  
CAGL0H10186g complement(993354..995690) similar to sp|P38237 Sac...   694   0.0  
Kwal_56.23084                                                         651   0.0  
AGR023C [4333] [Homologous to ScYBR058C (UBP14) - SH] (756967..7...   624   0.0  
KLLA0F18700g 1718738..1721050 similar to sp|P38237 Saccharomyces...   570   0.0  
Sklu_1729.1 YBR058C, Contig c1729 2315-2720 reverse complement         93   6e-22
CAGL0G05247g complement(491024..493867) similar to sp|P32571 Sac...    59   1e-08
AFR007W [3199] [Homologous to ScYDR069C (DOA4) - SH; ScYER144C (...    53   1e-06
YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein t...    51   3e-06
Scas_545.2*                                                            51   3e-06
Scas_11.1*                                                             46   3e-06
KLLA0C06974g complement(604344..605684) similar to sp|P50102 Sac...    49   1e-05
Kwal_14.2008                                                           48   2e-05
YFR010W (UBP6) [1690] chr6 (165060..166559) Ubiquitin C-terminal...    47   5e-05
Kwal_26.8090                                                           47   5e-05
Scas_623.2*                                                            47   8e-05
KLLA0A10791g join(complement(935718..935733),complement(934135.....    46   9e-05
Scas_609.9                                                             46   1e-04
Kwal_34.16268                                                          46   1e-04
YDR069C (DOA4) [920] chr4 complement(584935..587715) Ubiquitin-s...    46   1e-04
AEL029W [2477] [Homologous to ScYFR010W (UBP6) - SH] complement(...    46   1e-04
Scas_618.5                                                             45   1e-04
CAGL0K02563g complement(230983..232743) similar to sp|P38748 Sac...    46   1e-04
CAGL0M11198g 1101217..1102602 similar to sp|P50102 Saccharomyces...    45   2e-04
CAGL0K10494g 1022869..1024356 highly similar to sp|P43593 Saccha...    45   3e-04
AGL079C [4232] [Homologous to ScYHL010C - SH] (557422..558942) [...    44   6e-04
KLLA0F25740g complement(2389226..2390779) similar to sp|P38748 S...    43   7e-04
AFR627C [3819] [Homologous to ScYJL197W (UBP12) - SH] (1572372.....    43   0.001
YJL197W (UBP12) [2729] chr10 (63804..67568) Ubiquitin-specific p...    42   0.002
CAGL0L01639g 176107..179550 similar to sp|P39538 Saccharomyces c...    42   0.002
YNL186W (UBP10) [4415] chr14 (289498..291876) Ubiquitin C-termin...    42   0.002
Scas_655.4                                                             42   0.003
Scas_715.2                                                             41   0.004
Kwal_33.13628                                                          41   0.004
Scas_634.14                                                            41   0.004
YER098W (UBP9) [1530] chr5 (355462..357726) Ubiquitin C-terminal...    40   0.008
KLLA0D08459g complement(718046..720298) some similarities with s...    40   0.008
Kwal_33.14430                                                          40   0.009
YMR223W (UBP8) [4179] chr13 (716714..718129) Putative ubiquitin-...    40   0.009
CAGL0I05522g complement(521749..523923) some similarities with s...    40   0.010
Sklu_2425.8 YER098W, Contig c2425 12113-14377 reverse complement       40   0.011
KLLA0E10252g 906675..909065 gi|10444512|gb|AAG17929.1|AF303215_1...    39   0.013
CAGL0J11352g complement(1101349..1103664) similar to sp|P53874 S...    39   0.013
ABL145W [447] [Homologous to ScYNL186W (UBP10) - SH] complement(...    39   0.020
Scas_698.7                                                             39   0.020
Scas_692.39                                                            39   0.020
AGR370W [4681] [Homologous to ScYER098W (UBP9) - SH; ScYBL067C (...    38   0.030
KLLA0C03476g 314815..318573 weakly similar to sp|P39538 Saccharo...    38   0.034
KLLA0E20449g 1810593..1812686 weakly similar to sp|P39967 Saccha...    37   0.050
CAGL0A04477g 437397..439709 similar to sp|P38187 Saccharomyces c...    37   0.052
YBL067C (UBP13) [130] chr2 complement(93817..95883) Ubiquitin C-...    37   0.059
YER144C (UBP5) [1573] chr5 complement(457801..460218) Ubiquitin-...    37   0.061
Sklu_1544.2 YMR223W, Contig c1544 592-1956 reverse complement          37   0.065
Kwal_55.19645                                                          37   0.069
YIL156W (UBP7) [2521] chr9 (48091..51306) Putative ubiquitin-spe...    37   0.075
KLLA0A00396g 29717..32755 similar to sp|P40453 Saccharomyces cer...    37   0.078
CAGL0G02563g complement(235498..237393) weakly similar to sp|P36...    37   0.095
CAGL0I06765g 655806..658469 similar to sp|P32571 Saccharomyces c...    37   0.11 
AGR139C [4450] [Homologous to ScYER151C (UBP3) - SH] (1010466..1...    36   0.16 
Kwal_26.9151                                                           35   0.21 
Kwal_55.21267                                                          35   0.24 
KLLA0F23463g 2193239..2196280 weakly similar to sp|P40987 Saccha...    35   0.27 
AFR296C [3488] [Homologous to ScYIL156W (UBP7) - SH; ScYKR098C (...    35   0.32 
YER151C (UBP3) [1580] chr5 complement(469681..472419) Ubiquitin-...    35   0.40 
KLLA0E08767g 784991..787306 similar to sp|P25037 Saccharomyces c...    34   0.50 
Kwal_27.10842                                                          34   0.51 
YOR138C (YOR138C) [4939] chr15 complement(584309..586324) Protei...    34   0.68 
Scas_555.6                                                             34   0.71 
Scas_714.11                                                            33   0.78 
CAGL0K10252g complement(997315..1001118) similar to sp|Q01476 Sa...    33   0.79 
YKR098C (UBP11) [3349] chr11 complement(632662..634815) Ubiquiti...    33   0.90 
Scas_664.17                                                            33   0.97 
Kwal_55.21393                                                          33   1.3  
CAGL0H06721g complement(667816..671061) similar to sp|P40453 Sac...    32   1.8  
Scas_695.7                                                             32   1.8  
AFR551W [3743] [Homologous to ScYMR223W (UBP8) - SH] complement(...    32   1.9  
Sklu_2195.4 YBR040W, Contig c2195 5864-6739 reverse complement         32   2.1  
AAR175C [363] [Homologous to ScYGL124C (MON1) - SH] (659185..661...    32   2.2  
CAGL0J08393g 833499..835502 similar to tr|Q04377 Saccharomyces c...    32   2.6  
Scas_562.12                                                            32   2.7  
YOR124C (UBP2) [4926] chr15 complement(554824..558642) Ubiquitin...    32   2.8  
Sklu_1620.2 YER151C, Contig c1620 788-3106                             32   3.4  
ACL164C [885] [Homologous to ScYOR124C (UBP2) - SH] (67792..7196...    32   3.5  
KLLA0E02376g complement(218647..222309) gi|6136095|sp|O42726|UBP...    32   3.7  

>Scas_718.49*
          Length = 829

 Score = 1590 bits (4117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 774/829 (93%), Positives = 774/829 (93%)

Query: 1   LWSLPFGMFTYLFSNQDSFFPQKTQEQKGRLISIMEEQVFTNLAVPTSIAKDQCIYCFES 60
           LWSLPFGMFTYLFSNQDSFFPQKTQEQKGRLISIMEEQVFTNLAVPTSIAKDQCIYCFES
Sbjct: 1   LWSLPFGMFTYLFSNQDSFFPQKTQEQKGRLISIMEEQVFTNLAVPTSIAKDQCIYCFES 60

Query: 61  LYNNITATFNTTHSLDICISCFQATCPNHSLLHYKVTQHSSDSPHGHYLNLSKWERXXXX 120
           LYNNITATFNTTHSLDICISCFQATCPNHSLLHYKVTQHSSDSPHGHYLNLSKWER    
Sbjct: 61  LYNNITATFNTTHSLDICISCFQATCPNHSLLHYKVTQHSSDSPHGHYLNLSKWERPASS 120

Query: 121 XXXXXMNNDESNNKKIKLQIDTKSEDELYETKWSFQKISTDGSLLEPLFDXXXXXXXXXX 180
                MNNDESNNKKIKLQIDTKSEDELYETKWSFQKISTDGSLLEPLFD          
Sbjct: 121 PSSASMNNDESNNKKIKLQIDTKSEDELYETKWSFQKISTDGSLLEPLFDNNTNTETLSS 180

Query: 181 XXXXKINDIIRAKSKTLVEETQSWELELNSCSHTRSLQSGESSISPTPAALDHCHDCDLD 240
               KINDIIRAKSKTLVEETQSWELELNSCSHTRSLQSGESSISPTPAALDHCHDCDLD
Sbjct: 181 NTLNKINDIIRAKSKTLVEETQSWELELNSCSHTRSLQSGESSISPTPAALDHCHDCDLD 240

Query: 241 SNLWLCLHCGNVGCGRNQVGIDGNSHALAHFDTHKDHPLAIKLGSLSPESSDVYCYQCND 300
           SNLWLCLHCGNVGCGRNQVGIDGNSHALAHFDTHKDHPLAIKLGSLSPESSDVYCYQCND
Sbjct: 241 SNLWLCLHCGNVGCGRNQVGIDGNSHALAHFDTHKDHPLAIKLGSLSPESSDVYCYQCND 300

Query: 301 EVRFDGDKDFLAKFLLTNYQIDVSSKMGTEKSLIELQVEQNMNWNFKMVDSHGNELIQLP 360
           EVRFDGDKDFLAKFLLTNYQIDVSSKMGTEKSLIELQVEQNMNWNFKMVDSHGNELIQLP
Sbjct: 301 EVRFDGDKDFLAKFLLTNYQIDVSSKMGTEKSLIELQVEQNMNWNFKMVDSHGNELIQLP 360

Query: 361 PSKELGCGFINLGNSCYLNSVLQCLFNDGVPNWATLLANLIGNEFPLDCVYPTTNLKCQL 420
           PSKELGCGFINLGNSCYLNSVLQCLFNDGVPNWATLLANLIGNEFPLDCVYPTTNLKCQL
Sbjct: 361 PSKELGCGFINLGNSCYLNSVLQCLFNDGVPNWATLLANLIGNEFPLDCVYPTTNLKCQL 420

Query: 421 IKILNAFKLNPENYPEGIKPQSFKNYVGQSNKEFKSNNQQDAXXXXXXXXXXXXXXXXXX 480
           IKILNAFKLNPENYPEGIKPQSFKNYVGQSNKEFKSNNQQDA                  
Sbjct: 421 IKILNAFKLNPENYPEGIKPQSFKNYVGQSNKEFKSNNQQDATEFLTFLLEQLEKTLFKK 480

Query: 481 DNNPNNIMKFIMEDKIQCQSCGNVKYSYEPTEYIQLPLDGTNNPQNLVETLTNFFNGENI 540
           DNNPNNIMKFIMEDKIQCQSCGNVKYSYEPTEYIQLPLDGTNNPQNLVETLTNFFNGENI
Sbjct: 481 DNNPNNIMKFIMEDKIQCQSCGNVKYSYEPTEYIQLPLDGTNNPQNLVETLTNFFNGENI 540

Query: 541 DFDCPTCKKTVVATKRQRFKTSPNTLVISPHRISFEKETWTPIKTSAELTLPXXXXXXXX 600
           DFDCPTCKKTVVATKRQRFKTSPNTLVISPHRISFEKETWTPIKTSAELTLP        
Sbjct: 541 DFDCPTCKKTVVATKRQRFKTSPNTLVISPHRISFEKETWTPIKTSAELTLPNLDDSSNE 600

Query: 601 XXXXXXFISKGFDPTKETLFPEDVNEDNNTFKPNEQAVPPLLEMGFTENLAAKALYHTGN 660
                 FISKGFDPTKETLFPEDVNEDNNTFKPNEQAVPPLLEMGFTENLAAKALYHTGN
Sbjct: 601 LLDLSSFISKGFDPTKETLFPEDVNEDNNTFKPNEQAVPPLLEMGFTENLAAKALYHTGN 660

Query: 661 NNDPEPALQWLMQHMDDSDFQDEFVPPPQTKAAGPAAKVDQESLSNMIDMGLNEKLSIKA 720
           NNDPEPALQWLMQHMDDSDFQDEFVPPPQTKAAGPAAKVDQESLSNMIDMGLNEKLSIKA
Sbjct: 661 NNDPEPALQWLMQHMDDSDFQDEFVPPPQTKAAGPAAKVDQESLSNMIDMGLNEKLSIKA 720

Query: 721 LVLNKGDINASIEWVFNNPDDNGELPSETTPKRDEEGIIYGNLDAKPYRLTAVVCHKGNS 780
           LVLNKGDINASIEWVFNNPDDNGELPSETTPKRDEEGIIYGNLDAKPYRLTAVVCHKGNS
Sbjct: 721 LVLNKGDINASIEWVFNNPDDNGELPSETTPKRDEEGIIYGNLDAKPYRLTAVVCHKGNS 780

Query: 781 AHSGHYVAFIRKMIDDELKWVLYNDEKIVVSDNIDEIKKDGYIYFYSRD 829
           AHSGHYVAFIRKMIDDELKWVLYNDEKIVVSDNIDEIKKDGYIYFYSRD
Sbjct: 781 AHSGHYVAFIRKMIDDELKWVLYNDEKIVVSDNIDEIKKDGYIYFYSRD 829

>YBR058C (UBP14) [248] chr2 complement(353632..355977)
           Ubiquitin-specific protease, ubiquitin C-terminal
           hydrolase [2346 bp, 781 aa]
          Length = 781

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/800 (47%), Positives = 515/800 (64%), Gaps = 26/800 (3%)

Query: 35  MEEQVFTNLAVPTSIAKDQCIYCFESLYNN-ITATFNTTHSLDICISCFQATCPNHSLLH 93
           M E V  N+ VP  ++KD+CIYCFES YN  +    +  HSL+IC++CFQATC  H  LH
Sbjct: 1   MAEAVLENVNVPAVVSKDECIYCFESPYNEPLALNASPKHSLNICLNCFQATCNRHVPLH 60

Query: 94  YKVTQHSSDSPHGHYLNLSKWERXXXXXXXXXMNNDESNNKKIKLQIDTKSEDELYETKW 153
            +VT+++ D+ H +YL ++K E+              +NNKKIKLQ+   SED+ + T W
Sbjct: 61  IRVTEYACDTIHSNYLTIAKVEKPKQENVEE-----NNNNKKIKLQVIETSEDDTHNTIW 115

Query: 154 SFQKISTDGSLLEPLFDXXXXXXXXXXXXXXKINDIIRAKSKTLVEETQSWELELNSCSH 213
           S Q+   +G  +                   KI  I++AKS+   ++  SW LE+++C H
Sbjct: 116 SLQRF--NGENVPRTVLSKSTDSDISSTALEKIEKILKAKSQDFEDKKNSWVLEISTCPH 173

Query: 214 TRSLQSGESSISPTPAALDHCHDCDLDSNLWLCLHCGNVGCGRNQVGIDGNSHALAHFDT 273
           T + Q    S       L+ C  CDL  NLWLCLHCGN+GCGR Q+GIDG+SHAL H+ +
Sbjct: 174 TENFQI--PSKPENTVNLNQCSSCDLTQNLWLCLHCGNIGCGREQIGIDGHSHALDHYRS 231

Query: 274 HKDHPLAIKLGSLSPESSDVYCYQCNDEVRFDGDKDFLAKFLLTNYQIDVSSKMGTEKSL 333
           + +HPLAIKLGSLS  + D+YCY C+DE RF  + +  +   +  Y I++  K+  EK+L
Sbjct: 232 NNNHPLAIKLGSLSSSTYDLYCYACDDETRFPDNVNLGSALQI--YGINIQEKIADEKTL 289

Query: 334 IELQVEQNMNWNFKMVDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQCLFNDGVPNW 393
           ++LQVEQN NW F+MVDS G E  +L  SK  GCG INLGNSCYLNSV+Q L N GVPNW
Sbjct: 290 VQLQVEQNENWQFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLVNGGVPNW 349

Query: 394 ATLLANLIGNEFPLDCVYPTTNLKCQLIKILNAFKLNPENYPEGIKPQSFKNYVGQSNKE 453
           +    + +G++FPLD VYP  NLKCQ IK+LNA K  PE YP GIKP +FK  +GQ+++E
Sbjct: 350 SL---DFLGSKFPLDVVYPDNNLKCQWIKLLNAMKCEPELYPNGIKPTTFKKCIGQNHQE 406

Query: 454 FKSNNQQDAXXXXXXXXXXXXXXXXXXDN----NPNNIMKFIMEDKIQCQSCGNVKYSYE 509
           F SN QQDA                   +    NPN++++F+MED++QC  CG VKYSYE
Sbjct: 407 FSSNRQQDAMEFLTFLLDLLDKKFFSSSSSGIPNPNDLVRFMMEDRLQCNICGKVKYSYE 466

Query: 510 PTEYIQLPLDGTNNPQNLVETLTNFFNGENIDFDCPTCKKTVVATKRQRFKTSPNTLVIS 569
           PTE IQ+PL+  + PQ+++E +  +F G+ I+F C  CK+ V A K+  FK+ P TL+++
Sbjct: 467 PTEAIQIPLEENDEPQDMLERIKAYFEGQTIEFKCANCKEKVTANKKPGFKSLPQTLILN 526

Query: 570 PHRISFEKETWTPIKTSAELTLPXXXXXXXXXXXXXXFISKGFDPTKETLFPEDVNEDNN 629
           P RI    + W P+KTS EL+LP              ++S+GFDP  E L P D +E+ +
Sbjct: 527 PIRIRL--QNWIPVKTSNELSLP-GLIDRDDMLDVSSYLSQGFDPQTENLLP-DEDENRS 582

Query: 630 TFKPNEQAVPPLLEMGFTENLAAKALYHTGNNNDPEPALQWLMQHMDDSDFQDEFVPPPQ 689
           +F PN+ ++  L+EMGFT+N + +AL++TG N D E A+ WL QHMDD D  D FVPPP 
Sbjct: 583 SFTPNQCSISQLIEMGFTQNASVRALFNTG-NQDAESAMNWLFQHMDDPDLNDPFVPPPN 641

Query: 690 TKAAGPAAKVDQESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNNPDDNGELPSET 749
                   +VD+ SL++M+ MGLN  L  KAL+LN GD+N S+EWVFNN DD+G  P   
Sbjct: 642 VPKKD-KREVDEVSLTSMLSMGLNPNLCRKALILNNGDVNRSVEWVFNNMDDDGTFPEPE 700

Query: 750 TPKRDEEGII-YGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKI 808
            P  +++     G   AKPY LTAV+CHKGNS HSGHYV FIRK++ D+ KWVLYNDEK+
Sbjct: 701 VPNEEQQQKKDLGYSTAKPYALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKL 760

Query: 809 VVSDNIDEIKKDGYIYFYSR 828
           V +D+I+++KK+GYIYFY+R
Sbjct: 761 VAADSIEDMKKNGYIYFYTR 780

>CAGL0H10186g complement(993354..995690) similar to sp|P38237
           Saccharomyces cerevisiae YBR058c UBP14 ubiquitin
           specific protease, hypothetical start
          Length = 778

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/804 (46%), Positives = 488/804 (60%), Gaps = 37/804 (4%)

Query: 35  MEEQVFTNLAVPTSIAKDQCIYCFESLYN---------NITATFNTTHSLDICISCFQAT 85
           M +Q+   L VP  IAK++CIYCFE+ YN          +T +    H+L+IC+ CFQA 
Sbjct: 1   MSDQILQGLEVPAIIAKEECIYCFETPYNPEKPGSKEQQLTDSTKAAHTLNICLVCFQAV 60

Query: 86  CPNHSLLHYKVTQHSSDSPHGHYLNLSKWERXXXXXXXXXMNNDESNNKKIKLQIDTKSE 145
           CP H+  H +V +H+ D+ H  YLN++K  R          + D +++KKIKLQ+  KS 
Sbjct: 61  CPRHTPFHIEVGKHN-DAQHFDYLNVAKV-RKYEDMLDGEEDEDTNSSKKIKLQVIEKSR 118

Query: 146 DELYETKWSFQKISTDGSLLEPLFDXXXXXXXXXXXXXXKINDIIRAKSKTLVEETQSWE 205
           DE Y   WS     +  S    +                K++ ++ AKS+ L ++   WE
Sbjct: 119 DEDYNDVWSLLHFESSQSSPHIVL----KSNEANAAQTEKVDHVLNAKSQDLADQANVWE 174

Query: 206 LELNSCSHTRSLQSGESSISPTPAALDHCHDCDLDSNLWLCLHCGNVGCGRNQVGIDGNS 265
           L++  C H  S         P      HC  C+L  NLW+CL+CGN+GCGR QVGI+G+S
Sbjct: 175 LDIKPCKHVDSFSFANVQEKPLET---HCSSCELTQNLWICLYCGNLGCGREQVGIEGHS 231

Query: 266 HALAHFDTHKDHPLAIKLGSLSPESSDVYCYQCNDEVRFDGDKDFLAKFLLTNYQIDVSS 325
           HAL HF +  DH LAIKLGSLS  S D+YCY C+DEV+F+  +  + K  L  Y ID+  
Sbjct: 232 HALEHFKSKNDHCLAIKLGSLSSSSFDLYCYACDDEVKFNDLQ--VLKTTLAKYGIDMDK 289

Query: 326 KMGTEKSLIELQVEQNMNWNFKMVDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQCL 385
           K   EK+L+ELQVEQNMNW+FKMVD  G +L QL  S+ELGCG INLGNSCYLNS LQCL
Sbjct: 290 KSADEKTLVELQVEQNMNWDFKMVDEKGQQLKQLNASQELGCGLINLGNSCYLNSTLQCL 349

Query: 386 FNDGVPNWATLLANLIGNEFPLDCVYPTTNLKCQLIKILNAFKLNPENYPEGIKPQSFKN 445
           FN GV  W T   +++GN   L+ VYP  NLK QL K+  A K  P  Y +GI+P+SFK 
Sbjct: 350 FNGGVKGWDT---DMLGNSPSLNVVYPANNLKSQLTKLRTALKEEPTIYKQGIRPKSFKK 406

Query: 446 YVGQSNKEFKSNNQQDAXX-XXXXXXXXXXXXXXXXDNNPNNIMKFIMEDKIQCQSCGNV 504
            +G S++EF S  QQDA                   D NPN++MKF+MED++QCQ C  V
Sbjct: 407 CIGGSHEEFSSGRQQDALEFFTYFVDELDKKLFKNSDYNPNDLMKFMMEDRLQCQECHGV 466

Query: 505 KYSYEPTEYIQLPLDGTNNPQNLVETLTNFFNGENIDFDCPTCKKTVVATKRQRFKTSPN 564
           KYS E +  IQLPL  +N+ Q+L E +  +F+GE I+F CP CKK V A K+   +T P+
Sbjct: 467 KYSTETSNVIQLPLQESNDAQDLEERINAYFSGEVIEFKCPNCKKMVNAVKKPAMRTFPD 526

Query: 565 TLVISPHRISFEKETWTPIKTSAELTLPXXXXXXXXXXXXXXFISKGFDPTKETLFPEDV 624
           TLVI+P RI    E WTP+KTS  LT+P              +   G     ET   +D 
Sbjct: 527 TLVINPIRIKI--ENWTPVKTSNLLTIP-GLETPTEVLELTQYKGNGLQKDTETQLNDD- 582

Query: 625 NEDNNTFKPNEQAVPPLLEMGFTENLAAKALYHTGNNNDPEPALQWLMQHMDDSDFQDEF 684
             D   F+ NE  V  L+EMGFTEN   +ALYHTG N DPE A+ WL  H++D+D   EF
Sbjct: 583 -NDEIQFEVNETFVNQLMEMGFTENACVRALYHTG-NKDPELAMNWLFGHIEDADVNAEF 640

Query: 685 VPPPQTKAAGPAAKVDQESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNNPDDNGE 744
           +PP + K       V+ E +S M+ MGL+ KL  KAL+LN  D+  S++WVFNN DD+GE
Sbjct: 641 IPPKKAK-----NDVNPEHISMMVGMGLDPKLCRKALILNNHDVTRSVDWVFNNMDDDGE 695

Query: 745 LPSETTPKRDEEGIIYGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYN 804
           +  E   ++ +    YG+ DAKPY L+A++CHKGNS HSGHYVAFIRKM+D +  WVLYN
Sbjct: 696 I--EELKEQSDTSKTYGHHDAKPYELSAIICHKGNSVHSGHYVAFIRKMVDGKPTWVLYN 753

Query: 805 DEKIVVSDNIDEIKKDGYIYFYSR 828
           DEKIVVS+N +E+ K+ Y+ FYSR
Sbjct: 754 DEKIVVSNNFEEMMKNSYMLFYSR 777

>Kwal_56.23084
          Length = 762

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/797 (43%), Positives = 485/797 (60%), Gaps = 50/797 (6%)

Query: 40  FTNLAVPTSIAKDQCIYCFESLYNNITATFNTTHSLDICISCFQATCPNHSLLHYKVTQH 99
           FT L +P+ I KD C YCFE+L+N    +  T+H+L IC+ CFQ+ C +H  LH  VT+ 
Sbjct: 7   FTQLQIPSVIYKDDCGYCFETLHNE---SQTTSHALHICLDCFQSFCKSHVPLHQCVTKK 63

Query: 100 SSDSPHGHYLNLSKWERXXXXXXXXXMNNDESNNKKIKLQIDTKSEDELYETKWSFQK-- 157
                H   L +SK ++             +   KK+KL++  +SED++Y++ W   K  
Sbjct: 64  EFARSHDFLLKVSKCKKA---------EQSQPIEKKLKLEVMERSEDDIYDSLWWLMKGN 114

Query: 158 -ISTDGSLLEPLFDXXXXXXXXXXXXXXKINDIIRAKSKTLVEETQSWELELNSCSHTRS 216
            I  D                       K+  I+ A+S T    T+SW+LE+  CSH  S
Sbjct: 115 DIIAD-----------YKSQDFEADVQNKVAQILNARSNTFQRATESWQLEIKPCSHVTS 163

Query: 217 LQSGESSISPTPAALDHCHDCDLDSNLWLCLHCGNVGCGRNQVGIDGNSHALAHFDTHKD 276
               E+ ++ +    D C +C L SNLWLCLHCGNVGCGR QVGI+G+SHAL HF+ + +
Sbjct: 164 F---ETPVNKSECLSDVCVECKLGSNLWLCLHCGNVGCGRQQVGIEGHSHALTHFEENPE 220

Query: 277 HPLAIKLGSLSPESSDVYCYQCNDEVRF-DGDKDFLAKFLLTNYQIDVSSKMGTEKSLIE 335
           HPLA+KLGSLS  S+D+YCY C+DEV+F D DK      +L ++ I++  K+  EKSL+E
Sbjct: 221 HPLAVKLGSLSNTSADIYCYFCDDEVQFQDLDK---WHNVLEHWGINIRDKVAQEKSLVE 277

Query: 336 LQVEQNMNWNFKMVDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQCLFNDGVPNWAT 395
           LQVEQN +W+F+MVDS G+EL  L  SK  GCG +NLGNSCY+N+VLQ LFN GV +W+ 
Sbjct: 278 LQVEQNASWDFQMVDSQGHELHHLRSSKRYGCGLLNLGNSCYMNAVLQVLFNGGVSSWS- 336

Query: 396 LLANLIGNEFPLDCVYPTTNLKCQLIKILNAFKLNPENYPEGIKPQSFKNYVGQSNKEFK 455
            L  L   +FP D VY ++NLKCQLIK+ NA + NPE YP G+KP +FK+ VG +++EF 
Sbjct: 337 -LDEL--GDFPTDVVYVSSNLKCQLIKLRNALRTNPEMYPNGVKPSTFKDCVGGTHEEFS 393

Query: 456 SNNQQDAXXXXXXXXXXXXXXX-XXXDNNPNNIMKFIMEDKIQCQSCGNVKYSYEPTEYI 514
           S  QQDA                   + +PN++MKF ++D+I+C SC  VKY  + ++Y+
Sbjct: 394 SGRQQDALEFFSYLIDLLDKKLFNRSEFHPNDLMKFSLQDRIECTSCHGVKYVTQVSDYL 453

Query: 515 QLPLDGTNNPQNLVETLTNFFNGENIDFDCPTCKKTVVATKRQRFKTSPNTLVISPHRIS 574
           Q+PL  +++PQ L+  L  +  GE ++F CP C +   A K   F+T P TLV+S  RI 
Sbjct: 454 QVPLPESDDPQMLITNLERYLQGETVEFSCPKCNRVTEAVKSSGFQTYPETLVVSCSRIK 513

Query: 575 FEKETWTPIKTSAELTLPXXXXXXXXXXXXXXFISKGFDPTKETLFPEDVNEDNNTFKPN 634
                W P KTS E+T+P                S GF+   E L PED   ++  FK  
Sbjct: 514 LV--NWVPTKTSQEVTMPGIDAADTSLLQLGHLKSNGFNSESEHLLPED---ESPGFKAK 568

Query: 635 EQAVPPLLEMGFTENLAAKALYHTGNNNDPEPALQWLMQHMDDSDFQDEFVPPPQTKAAG 694
              V  L+EMGFTEN + +ALYHTGN+ D + A+ WL QH++D D  + FV P    A  
Sbjct: 569 PHCVSQLMEMGFTENASIRALYHTGNS-DTDSAMNWLFQHVEDDDINELFVAP---NAPS 624

Query: 695 PAAKVDQESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNNPDDNGELPSETTPKRD 754
             ++V+ ++L +M+ MGLN  L  KALVL+KG+++AS+EWVFNN D+  +   ET    D
Sbjct: 625 KPSEVNPQALESMVSMGLNPDLCHKALVLHKGNVSASVEWVFNNADNTDDTLLETQDGLD 684

Query: 755 EEGIIYGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVVSD-- 812
                  +     +RL+AV+CHKG+S HSGHYVAFI+K +++E KWVLYNDEK+VV+D  
Sbjct: 685 SNSYGISDETKANFRLSAVICHKGSSVHSGHYVAFIKKDVENETKWVLYNDEKMVVADDP 744

Query: 813 -NIDEIKKDGYIYFYSR 828
            NI EIKK+GYIY +SR
Sbjct: 745 SNITEIKKNGYIYLFSR 761

>AGR023C [4333] [Homologous to ScYBR058C (UBP14) - SH]
           (756967..759309) [2343 bp, 780 aa]
          Length = 780

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/815 (42%), Positives = 489/815 (60%), Gaps = 65/815 (7%)

Query: 38  QVFTNLAVPTSIAKDQCIYCFESLYN---NITATFNTTHSLDICISCFQATCPNHSLLHY 94
           +V   L +P++I KD C YCFE++ N            H L+IC+ CFQ+ C  H  LH 
Sbjct: 3   EVVKQLKIPSTIYKDDCGYCFETMINPNFGDGGPAEPEHQLNICLGCFQSFCHEHVNLHQ 62

Query: 95  KVTQHSSDSPHGHYLNLSKWERXXXXXXXXXMNNDESNNKKIKLQIDTKSEDELYETKWS 154
           +V +    + H  YLN+ K ER             ES  K++KL++   SE+ELYET WS
Sbjct: 63  QVVRRVQQATHDLYLNVYKIERPKAT---------ESAEKRLKLEVQDLSEEELYETVWS 113

Query: 155 FQKISTDGSLLEPLFDXXXXXXXXXXXXXXKINDIIRAKSKTLVEETQSWELELNSCSHT 214
             +I+   +                     K+  IIR +S    +   +W+LE+ +C H+
Sbjct: 114 LVRINNACT---ARLGSSKQKQKMDTTVVSKLEQIIRTRSSDFKDMAATWQLEIKACPHS 170

Query: 215 RSLQSGESSISPTPA--ALDHCHDCDLDSNLWLCLHCGNVGCGRNQVGIDGNSHALAHFD 272
                 E  + P  A    + C DCDLD NLWLCLHCGN+GCGR QVGI+G+SHAL H+ 
Sbjct: 171 ------EQFVVPQDAMPVRETCGDCDLDRNLWLCLHCGNIGCGREQVGIEGHSHALKHYQ 224

Query: 273 -THKDHPLAIKLGSLSPESSDVYCYQCNDEVRFDGDKDFLAKFLLTNYQIDVSSKMGTEK 331
            +  +HPLA+KLGSL+ ES+D+YCY CNDEV F     F A  +L  + ID+  ++  EK
Sbjct: 225 QSENNHPLAVKLGSLTSESNDIYCYSCNDEVAFPDPNRFSA--VLAKFGIDLEGQVAKEK 282

Query: 332 SLIELQVEQNMNWNFKMVDSHGNELIQ-LPPSKELGCGFINLGNSCYLNSVLQCLFNDGV 390
           +L+ELQVEQNMNW+F+M DS GNE  + +  SKE GCG INLGNSCYLNSV+Q LFN GV
Sbjct: 283 TLVELQVEQNMNWDFQMRDS-GNEFTKKIFASKEYGCGLINLGNSCYLNSVVQVLFNGGV 341

Query: 391 PNWATLLANLIGNEFPLDCVYPTTNLKCQLIKILNAFKLNPENYPEGIKPQSFKNYVGQS 450
            +W     +++G +FP D V+P+TNLKCQLIK+ NA K++PE Y  G+KP S K  +G+ 
Sbjct: 342 KDWNL---DMLG-DFPRDVVFPSTNLKCQLIKLRNALKIHPEKYQHGVKPASVKKCIGED 397

Query: 451 NKEFKSNNQQDAXXXXX--XXXXXXXXXXXXXDNNPNNIMKFIMEDKIQCQSCGNVKYSY 508
           N+EF S  QQDA                     +NPN++M+F++ED+++C  C +VKYS 
Sbjct: 398 NEEFSSGRQQDAMEFLTYFIDKLDRKVFSKASSSNPNDLMRFMVEDRLECTKCEHVKYSS 457

Query: 509 EPTEYIQLPLDGTNNPQNLVETLTNFFNGENIDFDCPTCKKTVVATKRQRFKTSPNTLVI 568
           +  E +Q+PL  +N+PQ L++ L ++FNGE++D  CP C +  VATK    KT+P TL+I
Sbjct: 458 QVCEILQIPLLDSNDPQFLMDRLHSYFNGESLDIHCPQCSEITVATKNSMLKTAPATLLI 517

Query: 569 SPHRISFEKETWTPIKTSAELTLPXXXXXXXXXXXXXXFISKGFDPTKETLFPEDVNEDN 628
           +P RI    + WTPIKTS +L +P              F + G  P  E +F ED  +DN
Sbjct: 518 NPIRIKL--QNWTPIKTSNQLFVP--GLRDEKRLKLSQFKAHGRQPG-EKIF-EDSPDDN 571

Query: 629 N-------TFKPNEQAVPPLLEMGFTENLAAKALYHTGNNNDPEPALQWLMQHMDDSDFQ 681
           +       +F P+E  V  ++ MGF++N A +ALY+TG  ++ E AL W+ +HM+D +  
Sbjct: 572 SNVPASAISFNPDEDKVISIISMGFSKNAALRALYNTG--SEVERALNWIFEHMEDPELN 629

Query: 682 DEFVPPPQTKAAGPAAKVDQESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNNPDD 741
            EF  P   K    AA VDQ +L +M+ MGL E+   KAL+LN GD+  S+EWVFNN D+
Sbjct: 630 AEFSVPGTKKQ---AAVVDQGALDSMVSMGLAERHCRKALILNDGDVTRSVEWVFNNADN 686

Query: 742 NGELPSETT----PKRDEEGIIYGNLDAKP-YRLTAVVCHKGNSAHSGHYVAFIRKMIDD 796
             +  ++ +      RD     YG     P Y L+AV+CHKGNS  SGHYVAFI+K +D 
Sbjct: 687 LDDDDTQESIDPPVSRD-----YGYPGDIPDYALSAVICHKGNSVQSGHYVAFIKKAVDG 741

Query: 797 ELKWVLYNDEKIVV---SDNIDEIKKDGYIYFYSR 828
           E KWVLYNDEK++    ++N+ EI+K+GYI+ ++R
Sbjct: 742 EPKWVLYNDEKLMAVGGNENLQEIEKNGYIFIFNR 776

>KLLA0F18700g 1718738..1721050 similar to sp|P38237 Saccharomyces
           cerevisiae YBR058c UBP14 ubiquitin specific protease
           singleton, start by similarity
          Length = 770

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/802 (40%), Positives = 466/802 (58%), Gaps = 60/802 (7%)

Query: 42  NLAVPTSIAKDQCIYCFESLYNNITATFNTTHSLDICISCFQATCPNHSLLHYKVTQHSS 101
           ++ VP  I  D C+YCFE++ N         HSL IC+ CFQ+    H  LH +V    +
Sbjct: 8   DINVPRVIDTDDCVYCFETMKNKDEGR---EHSLFICLRCFQSFSEEHWELHQEVVLSET 64

Query: 102 DSPHGHYLNLSKWERXXXXXXXXXMNNDESNNKKIKLQIDTKSEDELYETKWSFQKISTD 161
            S H  YL + K  +             E   KK+KL++   +ED+LY+T W    +   
Sbjct: 65  GSTHDLYLRVFKVLKPKQEREEAGTPPLE---KKLKLEVKDVNEDDLYDTHWLLGSVE-H 120

Query: 162 GSLLEPLFDXXXXXXXXXXXXXXKINDIIRAKSKTLVEETQSWELELNSCSHTRS----- 216
           G LL                   KI++I++ KS +  + + +W LEL SC H ++     
Sbjct: 121 GELL------SSDTPSIPKEWSDKISEILQTKSSSYQDMSNTWTLELKSCPHIQTFDLSN 174

Query: 217 LQSGESSISPTPAALDHCHDCDLDSNLWLCLHCGNVGCGRNQVGIDGNSHALAHFDTHKD 276
           L+  E  IS +      C+DC L SNLWLCLHCGNV CGR QVGI+G SHAL H+++   
Sbjct: 175 LEKREGGISQS------CNDCGLTSNLWLCLHCGNVACGREQVGIEGYSHALKHYESTDG 228

Query: 277 HPLAIKLGSLSPESSDVYCYQCNDEVRFDGDKDFLAKFLLTNYQIDVSSKMGTEKSLIEL 336
           H LAIKLGSL+ +++D+YCY C+++V+F    +   + +L  ++++V +K   EK+L+EL
Sbjct: 229 HALAIKLGSLTADAADIYCYSCDEDVKF--THNLQLQDILKFWEVEVPAK-SKEKTLVEL 285

Query: 337 QVEQNMNWNFKMVDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQCLFNDGVPNWATL 396
           QVEQ++ W+F+MVDS G  L  L    E G G +NLGNSCYLNSVLQ L N G+ NW   
Sbjct: 286 QVEQSLKWDFQMVDSQGKSLKHLQNGPEYGLGLLNLGNSCYLNSVLQVLLNGGIRNW--- 342

Query: 397 LANLIG-NEFPLDCVYPTTNLKCQLIKILNAFKLNPENYPEGIKPQSFKNYVGQSNKEFK 455
             NL G   FP D VYP TNL CQLIKI NA  L    YPEGIKP +FK  +G S++EF 
Sbjct: 343 --NLDGLGSFPTDVVYPRTNLHCQLIKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFS 400

Query: 456 SNNQQDAXX-XXXXXXXXXXXXXXXXDNNPNNIMKFIMEDKIQCQSCGNVKYSYEPTEYI 514
           S  QQD+                     NPN++ +F ++DKI+C +C  VK+  + +E I
Sbjct: 401 SGRQQDSLEFFSYLSDKLDREIFKNTTTNPNDLFRFNIQDKIKCDNCNKVKFMDQVSEVI 460

Query: 515 QLPLDGTNNPQNLVETLTNFFNGENIDFDCPTCKKTVVATKRQRFKTSPNTLVISPHRIS 574
           QLPL   +  QNL++ L ++F+GE I++ C T KK   A+K   F + P TL+I+P RI 
Sbjct: 461 QLPLRKLDGEQNLIDRLNDYFSGEKIEYRCLTNKKINTASKVPGFSSFPRTLIINPIRI- 519

Query: 575 FEKETWTPIKTSAELTLPXXXXXXXXXXXXXXFISKGFDPTKET----LFPEDVNEDNNT 630
            E   W P KTS ++ +P                     P K T        +  E++++
Sbjct: 520 -ELINWQPSKTSEQVVVPGVRDDALLD----------MSPFKATGICEGEEVEEEEESDS 568

Query: 631 FKPNEQAVPPLLEMGFTENLAAKALYHTGNNNDPEPALQWLMQHMDDSDFQDEFVPPPQT 690
           F+ NE  +  L +MGF+ N   +AL+ TG N+DP  A +WL QHM+D +  + F P   +
Sbjct: 569 FQFNELFLGQLEQMGFSRNATKRALFETG-NSDPNAATEWLFQHMEDPNLNEAFDPHASS 627

Query: 691 KAAGPAAKVDQESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNNPDDNGELPSETT 750
            A     +VD E+L++M  MGL+ KL  KAL+L  GD+NAS+EWVF++ DD+GELP    
Sbjct: 628 SAKN---RVDSEALNSMTAMGLDSKLCRKALILKNGDVNASVEWVFSHMDDDGELPEAEE 684

Query: 751 PK---RDEEGIIYGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEK 807
            K   R   GI   ++ +  Y+LTAV+CHKGNS HSGHYVAFI+K+++ + +WVLYNDEK
Sbjct: 685 WKDQSRKSFGIPASSIASAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEK 744

Query: 808 IVVSD---NIDEIKKDGYIYFY 826
           I++++   N ++I+K+GY++F+
Sbjct: 745 ILLANDEPNFEDIEKNGYMFFF 766

>Sklu_1729.1 YBR058C, Contig c1729 2315-2720 reverse complement
          Length = 136

 Score = 92.8 bits (229), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 70/126 (55%), Gaps = 11/126 (8%)

Query: 40  FTNLAVPTSIAKDQCIYCFESLYNNITATFNTTHSLDICISCFQATCPNHSLLHYKVTQH 99
           F NLAVP+SI KD C YCFE++YN+  +   T H L+IC+SCFQ+ C +H  LH  +   
Sbjct: 7   FKNLAVPSSIYKDDCGYCFETMYNSDDS---TNHHLNICLSCFQSFCVDHVHLHQSIVGK 63

Query: 100 SSDSPHGHYLNLSKWERXXXXXXXXXMNNDESNNKKIKLQIDTKSEDELYETKWSFQKIS 159
                H  YL L K  +            ++   KK+KL++  +SEDE+YETKW   +I 
Sbjct: 64  ELSESHDLYLKLKKTRKPEV--------EEQRMEKKLKLEVKEQSEDEIYETKWWVVQIQ 115

Query: 160 TDGSLL 165
              S L
Sbjct: 116 NGSSKL 121

>CAGL0G05247g complement(491024..493867) similar to sp|P32571
           Saccharomyces cerevisiae YDR069c DOA4 ubiquitin-specific
           protease, hypothetical start
          Length = 947

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/253 (21%), Positives = 89/253 (35%), Gaps = 49/253 (19%)

Query: 367 CGFINLGNSCYLNSVLQCLFNDGVPNWATLLAN-----LIGNEFPLDCVYPTTNLKCQLI 421
            G  N+GNSCY+N +LQC+   G    + +  N      I     L           +L 
Sbjct: 583 VGLENMGNSCYMNCILQCIM--GTNELSQIFLNNSYEKHININSKLGSKGVLARYFARLA 640

Query: 422 KILNAFKLNPENYPEGIKPQSFKNYVGQSNKEFKSNNQQDAXXXXXXXXXXXXXXXXXXD 481
            I++    + E     ++P  F+  +   N  F++ NQQD                    
Sbjct: 641 HIMHQTSYDQEKKAAIVRPTQFRMAIASINSMFRNTNQQDCQEFCQFLLDGLHEDLNQCG 700

Query: 482 NNPN-------------------------------------NIMKFIMEDKIQCQSCGNV 504
           NNP                                      ++ +     +++C  C N 
Sbjct: 701 NNPPLKELSEEAEKKRELLSLRIASSIEWERFLTTNFSVIIDLFQGQYASRLKCSVCSNT 760

Query: 505 KYSYEPTEYIQLPL-DGTNNPQNLVETLTNFFNGENIDFD----CPTCKKTVVATKRQRF 559
             +Y+P   + +PL  GT +  NL++    F   E ++ D    CPTCKK   +TK+   
Sbjct: 761 STTYQPFSVLSVPLPTGTKSSVNLMDCFNEFTKCEKLEHDEYWNCPTCKKKQPSTKQLTI 820

Query: 560 KTSPNTLVISPHR 572
              P  L+I   R
Sbjct: 821 TRLPRNLIIHLKR 833

>AFR007W [3199] [Homologous to ScYDR069C (DOA4) - SH; ScYER144C
           (UBP5) - SH] complement(448632..451178) [2547 bp, 848
           aa]
          Length = 848

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/258 (22%), Positives = 91/258 (35%), Gaps = 53/258 (20%)

Query: 365 LGCGFINLGNSCYLNSVLQCLFNDGVPNWATL-LANLIGNEFPLDCVYPTTNLKC----Q 419
              G +N GNSCY++ ++QCL   G     T+ L N   N   L+    +  L      Q
Sbjct: 486 FSVGLVNCGNSCYMSCIIQCLL--GTQELCTMFLNNSYQNHINLNSRLGSKGLLARYFSQ 543

Query: 420 LIKILNAF----KLNPENYPEGIKPQSFKNYVGQSNKEFKSNNQQDAXXXXXXXXXXXXX 475
           LI  +  +    +    N    + P  FK   G  N  FK N QQD              
Sbjct: 544 LIHQMYQYGKDIRKKMGNEKTAVIPTQFKIACGSINSSFKDNTQQDCQEFCQFLLDGLHE 603

Query: 476 XXXXXDNNP------------NNIM-----------KFIMED--------------KIQC 498
                 NNP              +M           +++  D              ++QC
Sbjct: 604 DLNQCGNNPPLKELSEEAEKMREMMPMRLASAIEWERYLTTDFSVIVDLFQGQYASQLQC 663

Query: 499 QSCGNVKYSYEPTEYIQLPLDGTNNPQNLVETLTNFFNGENID----FDCPTCKKTVVAT 554
           + C     +Y+P   + +P+  T     L +  T F   E ++    + CP+CKK   +T
Sbjct: 664 KVCQRTSTTYQPFSVLSVPVPSTRTC-TLTDCFTEFTKIETLEQEEQWSCPSCKKRQPST 722

Query: 555 KRQRFKTSPNTLVISPHR 572
           K+      P  L+I   R
Sbjct: 723 KKITITRLPRNLIIHLKR 740

>YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein that
           binds in vitro to proteins containing canonical nuclear
           localization signal, has similarity to human BRAP2
           breast cancer-associated protein which may regulate
           protein import into the nucleus [1758 bp, 585 aa]
          Length = 585

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 6/62 (9%)

Query: 211 CSHTRSLQSGESSISPTPAALDHCHDCDLDSNLWLCLHCGNVGCGRNQVGIDGNSHALAH 270
           C H+ SL+    S+        HC  C    NLW+CL CGNVGCGR       + HA+ H
Sbjct: 279 CRHS-SLRLSRESLLKQAGDSAHCATCGSTDNLWICLICGNVGCGRY-----NSKHAIKH 332

Query: 271 FD 272
           ++
Sbjct: 333 YE 334

>Scas_545.2*
          Length = 918

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 97/254 (38%), Gaps = 51/254 (20%)

Query: 367 CGFINLGNSCYLNSVLQCLFNDGVPNWATL-LANLIGNEFPLDCVYPTTNLKC----QLI 421
            G  N+GNSCYLN ++QCL   G      + L N       L+    +  +      +LI
Sbjct: 559 VGLQNIGNSCYLNCIIQCLL--GTHELTKIFLNNFYERHINLNSKLGSKGVLAKYFARLI 616

Query: 422 KILNAFKLNPENYPEGIKPQSFKNYVGQSNKEFKSNNQQDAXXXXXXXXXXXXXXXXXXD 481
            +++    NP+     ++P  FK  VG  N  FK+ +QQD                    
Sbjct: 617 HLMHNHA-NPKLKNNYVRPAQFKMAVGSVNTLFKNCSQQDCQEFCQFLLDGLHEDLNQCG 675

Query: 482 NNP---------------------NNIM--KFIMED--------------KIQCQSCGNV 504
           +NP                     ++I   +F+  D              ++QC+ C + 
Sbjct: 676 SNPPLKELSSAAEKNREKLSLRIASSIEWERFLTTDFSVIVDLFQGQYASRLQCEVCKHT 735

Query: 505 KYSYEPTEYIQLPLDGT--NNPQNLVETLTNFFNGENIDFD----CPTCKKTVVATKRQR 558
             +Y+P   + +P+         N+++   +F   E +D D    CPTCKK   +TK+  
Sbjct: 736 STTYQPFSVLSVPIPRVPKGVKVNILDCFKDFTKLELLDTDEQWLCPTCKKKQRSTKKLT 795

Query: 559 FKTSPNTLVISPHR 572
               P  L+I   R
Sbjct: 796 ITRLPRNLIIHLKR 809

>Scas_11.1*
          Length = 88

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/43 (48%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 768 YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVV 810
           Y L  V+ H+G ++ SGHY AFIR  + DE KW  +ND+K+ V
Sbjct: 19  YDLIGVITHQGANSESGHYQAFIRDEM-DENKWYKFNDDKVSV 60

>KLLA0C06974g complement(604344..605684) similar to sp|P50102
           Saccharomyces cerevisiae YMR223w UBP8, start by
           similarity
          Length = 446

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 78/365 (21%), Positives = 143/365 (39%), Gaps = 79/365 (21%)

Query: 234 CHDCDLDS--NLWLCLHCGNVGCGRNQVGIDGNSHALAHFDTHKDHPLAIKLGSLSPESS 291
           C DC   S  + ++CL CG  GC  N   +D +S  L H            +  ++  + 
Sbjct: 45  CMDCGEISCGSTFICLQCGFCGCWNNNHFLD-HSQKLGH------------IFGVNSSNG 91

Query: 292 DVYCYQCNDEVRFDGDKDFLAKFLLTNYQIDVSSKMGTEKSLIELQVEQNMNWNFKMVDS 351
            V+C++C D         F+A  +                   E+   Q   W+  M   
Sbjct: 92  LVFCFRCGD---------FMADLV------------------AEIPASQ---WDTVM--- 118

Query: 352 HGNELIQLPPS--KELGCGFINLGNSCYLNSVLQCLFNDGVPNWATLLANLIGNEFPLDC 409
              E  +LP S  ++   G +N+G++C+++S++Q + ++        + +L+ ++   +C
Sbjct: 119 ---EKTELPASLHRDGLQGLVNMGSTCFMSSIIQTIIHN-----PYFVEDLLSHKHCNNC 170

Query: 410 VYP--TTNLKCQLIKILNAFKLN-PENYPEGIKPQSFKNYVGQS---NKEFKSNNQQDAX 463
                T  + C L +I   F  N P         + F N +  S   N     ++QQDA 
Sbjct: 171 DIKSGTKCVSCALDEIACDFYGNGPGTGKSSSVSKGFVNLLSASWHINHHLVGSSQQDAH 230

Query: 464 XXXXXXXXXXXXXXXXXDNNP---------NNIMKFIMEDKIQCQSCGNVKYSYEPTEYI 514
                              +          + I +  +++ +QC  CG  K + +P   +
Sbjct: 231 EYWQFLLNQLHTDHARVFGSSKAPDCQCITHRIFQGYLKNTLQCSQCGFSKTTIDPI--M 288

Query: 515 QLPLDGTNNPQNLVETLTNFFNGENI---DFDCPTCKKTVVATKRQRFKTSPNTLVISPH 571
            L L+  NNP+ L + L +F   E +    ++C +CK+     K+     +PN LVI   
Sbjct: 289 DLSLEIKNNPK-LEDCLDHFQREETLTDFHYECQSCKQNQGVVKQLTLHKAPNVLVIQLK 347

Query: 572 RISFE 576
           R   +
Sbjct: 348 RFEHQ 352

>Kwal_14.2008
          Length = 424

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/259 (21%), Positives = 90/259 (34%), Gaps = 56/259 (21%)

Query: 368 GFINLGNSCYLNSVLQCL----------FNDGVPNWATLLANLIGNEFPLDCVYPTT--N 415
           G +NLGNSCY+N ++QCL           +D   N   L + L G++  L   +     N
Sbjct: 57  GLVNLGNSCYMNCIIQCLLGTRELVQIFLDDSYKNHVNLNSRL-GSKGVLAKYFSQLIHN 115

Query: 416 LKCQLIKILNAFKLNPENYPEGIKPQSFKNYVGQSNKEFKSNNQQDAXXXXXXXXXXXXX 475
           ++ Q I   +  K    N    ++P  FK   G  N  FK+ +QQD              
Sbjct: 116 MQQQAISA-SGRKSTSGNERNAVQPLHFKVACGSINSLFKTTSQQDCQEFCQFLLDGLHE 174

Query: 476 XXXXXDNNPN-------------------------------------NIMKFIMEDKIQC 498
                  NP                                      ++ +     ++ C
Sbjct: 175 DLNQCGGNPALKELSEEAEAIREKLCMRIASSIEWERYLTTDFSVIVDLFQGQYASQLMC 234

Query: 499 QSCGNVKYSYEPTEYIQLPLDGTNNPQNLVETLTNFFNGENIDFD----CPTCKKTVVAT 554
           + CG    +Y+P   + +P+       NL++    F   E ++ D    CP CK    +T
Sbjct: 235 KVCGRTSTTYQPFSVLSVPVP-RGARCNLLDCFEEFTKIETLEKDEQWSCPRCKVKQPST 293

Query: 555 KRQRFKTSPNTLVISPHRI 573
           K+      P  L+I   R 
Sbjct: 294 KKITITRLPRNLIIHLKRF 312

>YFR010W (UBP6) [1690] chr6 (165060..166559) Ubiquitin C-terminal
           hydrolase associated with the 26S proteaseome, involved
           in ubiquitin turnover [1500 bp, 499 aa]
          Length = 499

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 768 YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVV 810
           Y L  V+ H+G ++ SGHY AFIR  + DE KW  +ND+K+ V
Sbjct: 430 YNLIGVITHQGANSESGHYQAFIRDEL-DENKWYKFNDDKVSV 471

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 358 QLPPSKELGCGFINLGNSCYLNSVLQCLFN 387
           Q+    +L  GF N+GN+CYLN+ LQ L+ 
Sbjct: 100 QVQQFAQLPVGFKNMGNTCYLNATLQALYR 129

>Kwal_26.8090
          Length = 520

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 10/65 (15%)

Query: 209 NSCSHTR--SLQSGESSISPTPAALDHCHDCDLDSNLWLCLHCGNVGCGRNQVGIDGNSH 266
           N C   R   L+  +SS++   A    C  C ++ NLW+CL CGN+GCGR         H
Sbjct: 261 NRCPVCRYSGLKLTKSSLARQGA---RCSTCGVNENLWICLICGNIGCGRYNF-----KH 312

Query: 267 ALAHF 271
           A+ HF
Sbjct: 313 AVQHF 317

>Scas_623.2*
          Length = 795

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 44/90 (48%), Gaps = 7/90 (7%)

Query: 740 DDNGELPSETTPKRDEEGIIYGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDELK 799
           D NGELP   T     +G   G +    Y+L AV CH G +  SGHY A++ K  D  + 
Sbjct: 709 DFNGELPLGMTNSLLTKG---GQVGPFKYQLNAVACHMG-TLGSGHYTAYVNKGPD--VG 762

Query: 800 WVLYNDEK-IVVSDNIDEIKKDGYIYFYSR 828
           W  ++D    +V    + +  D Y+ FY R
Sbjct: 763 WYYFDDSSHRIVKIATEYMNPDAYLLFYHR 792

 Score = 33.1 bits (74), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 38/84 (45%), Gaps = 6/84 (7%)

Query: 495 KIQCQSCGNVKYSYEPTEYIQLP--LDGTNNPQNLVETLTNFFNGENIDFD----CPTCK 548
           +++C  C     +Y+P   + +P  L    +  ++++    F   E +D D    CP CK
Sbjct: 599 QLRCCVCQYTSTTYQPFTLLSVPVPLSSRVSRCSIIDCFQEFTKCERLDKDEEWFCPQCK 658

Query: 549 KTVVATKRQRFKTSPNTLVISPHR 572
           +   +TK+ +    P  L+I   R
Sbjct: 659 RKQPSTKQLKITRLPKNLIIHFKR 682

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 2/32 (6%)

Query: 368 GFINLGNSCYLNSVLQCLFNDGVPNWATLLAN 399
           G  N+ NSCY+N ++QCL +  VP    +  N
Sbjct: 430 GLENMSNSCYMNCIIQCLLS--VPELIQICLN 459

>KLLA0A10791g
           join(complement(935718..935733),
           complement(934135..935573)) similar to sp|P43593
           Saccharomyces cerevisiae YFR010w UBP6 ubiquitin-specific
           protease singleton, start by similarity
          Length = 484

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query: 768 YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVV 810
           Y L  VV H+G ++ SGHY AF+R    DE KW  YND+K+ V
Sbjct: 415 YNLIGVVTHQGANSDSGHYQAFVRDDA-DENKWYKYNDDKVYV 456

>Scas_609.9
          Length = 729

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 35/70 (50%), Gaps = 11/70 (15%)

Query: 765 AKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKI--VVSDNIDEIKKD-- 820
           AK Y LT VV H G S   GHYV+  +   +D+  W+L++DE +  V    + E   D  
Sbjct: 585 AKKYELTGVVIHMGGSPQHGHYVSLCK---NDKFGWLLFDDETVESVTEKTVLEFTGDSS 641

Query: 821 ----GYIYFY 826
                Y+ FY
Sbjct: 642 NQATAYVLFY 651

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%)

Query: 368 GFINLGNSCYLNSVLQCLFN 387
           G+ N GN+CY NSVLQCL+N
Sbjct: 138 GYENFGNTCYCNSVLQCLYN 157

>Kwal_34.16268
          Length = 449

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 768 YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVV 810
           Y L  V+ H+G ++ SGHY +FIR  + DE KW  +ND+K+ +
Sbjct: 380 YNLIGVITHQGANSESGHYQSFIRDEV-DENKWYRFNDDKVSI 421

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 15/21 (71%)

Query: 367 CGFINLGNSCYLNSVLQCLFN 387
            G  NLGN+CY+NS LQ L+ 
Sbjct: 60  VGLKNLGNTCYMNSTLQALYQ 80

>YDR069C (DOA4) [920] chr4 complement(584935..587715)
           Ubiquitin-specific protease (ubiquitin C-terminal
           hydrolase), involved in recycling ubiquitin from protein
           substrates targeted to the proteasome and the vacuole
           [2781 bp, 926 aa]
          Length = 926

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 754 DEEGIIYGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIV-VSD 812
           D+E  I G +    Y L  V CH G + + GHY A+++K +     W+ ++D K   V +
Sbjct: 850 DDELPIRGQIPPFKYELYGVACHFG-TLYGGHYTAYVKKGLKK--GWLYFDDTKYKPVKN 906

Query: 813 NIDEIKKDGYIYFYSR 828
             D I  + Y+ FY R
Sbjct: 907 KADAINSNAYVLFYHR 922

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 40/84 (47%), Gaps = 6/84 (7%)

Query: 495 KIQCQSCGNVKYSYEPTEYIQLPLDGTNNPQNLV--ETLTNFFNGENIDFD----CPTCK 548
           +++C+ C +   +Y+P   + +P+   N+  N+   +    F   EN++ D    CP C+
Sbjct: 729 RLKCKVCSHTSTTYQPFTVLSIPIPKKNSRNNITIEDCFREFTKCENLEVDEQWLCPHCE 788

Query: 549 KTVVATKRQRFKTSPNTLVISPHR 572
           K   +TK+      P  L++   R
Sbjct: 789 KRQPSTKQLTITRLPRNLIVHLKR 812

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 16/23 (69%)

Query: 364 ELGCGFINLGNSCYLNSVLQCLF 386
           +   G  NLGNSCY+N ++QC+ 
Sbjct: 559 DFAVGLENLGNSCYMNCIIQCIL 581

>AEL029W [2477] [Homologous to ScYFR010W (UBP6) - SH]
           complement(580062..581402) [1341 bp, 446 aa]
          Length = 446

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query: 768 YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVV 810
           Y L  V+ H+G ++ SGHY AF+R   DD+ KW  +ND+K+  
Sbjct: 377 YDLIGVITHQGANSESGHYQAFMRDEFDDD-KWYKFNDDKVTA 418

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 7/50 (14%)

Query: 349 VDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQCLFNDGVPNWATLLA 398
            D+   +L ++P       G +N+GN+CY+N+ LQ L+   VP    +LA
Sbjct: 48  ADAQSGQLSRVP------MGIVNMGNTCYMNATLQGLYGI-VPLREQILA 90

>Scas_618.5
          Length = 493

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query: 768 YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVV 810
           Y L  ++ H+G ++ SGHY AFIR    DE KW  +ND+K+ V
Sbjct: 424 YNLVGIITHQGANSESGHYQAFIRDET-DENKWYKFNDDKVSV 465

 Score = 33.1 bits (74), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%)

Query: 367 CGFINLGNSCYLNSVLQCLFN 387
            G  N+GN+CY+N+ LQ LF 
Sbjct: 107 IGLQNMGNTCYMNATLQALFR 127

>CAGL0K02563g complement(230983..232743) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c, hypothetical start
          Length = 586

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 5/39 (12%)

Query: 234 CHDCDLDSNLWLCLHCGNVGCGRNQVGIDGNSHALAHFD 272
           C +C    NLW+CL CG+VGCGR       + HA+ HF+
Sbjct: 307 CSECGSSENLWICLICGHVGCGRY-----NSRHAIKHFE 340

>CAGL0M11198g 1101217..1102602 similar to sp|P50102 Saccharomyces
           cerevisiae YMR223w UBP8, start by similarity
          Length = 461

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 81/201 (40%), Gaps = 57/201 (28%)

Query: 195 KTLVEETQSWELELNSCSHTRSLQSGESSISPTPAALDH---CHDCDLDSNL--WLCLHC 249
           +++ E  ++    LN+ S T+S+       SP  A L H   C  C   SN   +LCL C
Sbjct: 8   QSIFENPKNRAAWLNALSTTQSVLRH----SPIKAKLLHAFRCSTCKEISNGSNFLCLQC 63

Query: 250 GNVGCGRNQVGIDGNSHALAHFDTHKDHPLAIKLGSLSPESSDVYCYQCNDEVRFDGDKD 309
           G  GC              +HF+ H        L  ++ ++  V+C+QC D V   GD D
Sbjct: 64  GFCGCWNG-----------SHFEQHSKE--TGHLFGINAQTELVFCFQCMDYV---GDFD 107

Query: 310 FLAKFLLTNYQIDVSSKMGTEKSLIELQVEQNMNWNFKMVDSHGNELIQLPPSKELG--C 367
                 L N                         W++        E   +P   ++    
Sbjct: 108 LFRDAALAN------------------------RWDYY------EEYTNVPTVDQIDGMA 137

Query: 368 GFINLGNSCYLNSVLQCLFND 388
           G +N+G++CY++S++QC+ ++
Sbjct: 138 GLVNMGSTCYMSSIMQCIIHN 158

 Score = 36.2 bits (82), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 4/59 (6%)

Query: 768 YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVVSDNIDEIKKDGYIYFY 826
           Y L  ++ H G S + GHYVAF +    +  +W  +ND  +      D +K+  Y+ FY
Sbjct: 401 YELIGIISHTG-SVNEGHYVAFCKI---ENGEWFKFNDSMVTKILEKDVLKEQAYLLFY 455

>CAGL0K10494g 1022869..1024356 highly similar to sp|P43593
           Saccharomyces cerevisiae YFR010w UBP6 ubiquitin-specific
           protease, start by similarity
          Length = 495

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 768 YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKI 808
           Y L  V+ H+G ++ SGHY AFIR    DE KW  +ND+K+
Sbjct: 426 YDLIGVITHQGANSESGHYQAFIRDE-SDENKWYKFNDDKV 465

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 15/21 (71%)

Query: 367 CGFINLGNSCYLNSVLQCLFN 387
            G  N+GN+CYLN+ LQ LF 
Sbjct: 109 LGLQNMGNTCYLNATLQALFR 129

>AGL079C [4232] [Homologous to ScYHL010C - SH] (557422..558942)
           [1521 bp, 506 aa]
          Length = 506

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 6/53 (11%)

Query: 233 HCHDCDLDSNLWLCLHCGNVGCGRNQVGIDGNSHALAHFDTHKDHPLAIKLGS 285
           HC  C    NLW+CL CG++GCGR       + HA+ H+++   H  A+ + +
Sbjct: 267 HCDVCGSSENLWVCLICGHMGCGRY-----NSKHAIQHYES-SSHCFAMDIAT 313

>KLLA0F25740g complement(2389226..2390779) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c singleton, start by
           similarity
          Length = 517

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 6/53 (11%)

Query: 231 LDHCHDCDLDSNLWLCLHCGNVGCGRNQVGIDGNSHALAHFDTHKDHPLAIKL 283
           L  C +C   +NLW+CL CG++GCGR       + HA+ H++   +H  A+ L
Sbjct: 267 LPRCLECGETNNLWICLICGHLGCGRY-----NSQHAICHYE-QSNHCFAMDL 313

>AFR627C [3819] [Homologous to ScYJL197W (UBP12) - SH]
           (1572372..1576235) [3864 bp, 1287 aa]
          Length = 1287

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 8/100 (8%)

Query: 367 CGFINLGNSCYLNSVLQCLFNDGVPNWAT-LLANLIGNEFPLDCVYP---TTNLKCQLIK 422
            G  NLGN+CY+NS LQCL +  +P +    L N  G E  ++   P     ++      
Sbjct: 346 IGLSNLGNTCYMNSALQCLLH--IPEFKDYFLYN--GYEKEVNIENPLGHKGHIAWAFAS 401

Query: 423 ILNAFKLNPENYPEGIKPQSFKNYVGQSNKEFKSNNQQDA 462
           ++ A      +      P++FKN +G  N  F    QQD+
Sbjct: 402 MVQALFGKRHSAATSYSPRNFKNTIGHLNSMFSGYQQQDS 441

>YJL197W (UBP12) [2729] chr10 (63804..67568) Ubiquitin-specific
           protease, ubiquitin C-terminal hydrolase [3765 bp, 1254
           aa]
          Length = 1254

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 43/100 (43%), Gaps = 7/100 (7%)

Query: 368 GFINLGNSCYLNSVLQCLFNDGVPNWATLL-----ANLIGNEFPLDCVYPTTNLKCQLIK 422
           G +NLGN+CY+NS LQCL +  +P            + I  E PL            L++
Sbjct: 365 GLVNLGNTCYMNSALQCLVH--IPQLRDYFLYDGYEDEINEENPLGYHGYVARAFSDLVQ 422

Query: 423 ILNAFKLNPENYPEGIKPQSFKNYVGQSNKEFKSNNQQDA 462
            L   +++         P  FK+ +G  N  F    QQD+
Sbjct: 423 KLFQNRMSIMQRNAAFPPSMFKSTIGHFNSMFSGYMQQDS 462

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 41/97 (42%), Gaps = 11/97 (11%)

Query: 732  IEWVFNNPDDNGELPSETTPKRDEEGIIYGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIR 791
            I+   N P  + +L      K D  G+IY         L AV  H G      HY A+++
Sbjct: 1024 IDATVNFPITDLDLSRYVVYKDDPRGLIYD--------LYAVDNHYGGLGGG-HYTAYVK 1074

Query: 792  KMIDDELKWVLYNDEKIVVSDNIDEIKKDGYIYFYSR 828
               D+  KW  ++D ++  +   + I    Y+ FY R
Sbjct: 1075 NFADN--KWYYFDDSRVTETAPENSIAGSAYLLFYIR 1109

>CAGL0L01639g 176107..179550 similar to sp|P39538 Saccharomyces
           cerevisiae YJL197w UBP12 ubiquitin C-terminal hydrolase,
           hypothetical start
          Length = 1147

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 45/101 (44%), Gaps = 8/101 (7%)

Query: 367 CGFINLGNSCYLNSVLQCLFNDGVPNWATLL-----ANLIGNEFPLDCVYPTTNLKCQLI 421
            G  NLGN+CY+NS LQCL +  +P              I  + PL            LI
Sbjct: 289 VGLSNLGNTCYMNSGLQCLVH--IPKLRDYFFYGGYEQEINLDNPLGYNGTVATAFGNLI 346

Query: 422 KILNAFKLNPENYPEGIKPQSFKNYVGQSNKEFKSNNQQDA 462
           + L ++  N + Y +   P  FK  +GQ+N  F    QQD+
Sbjct: 347 QNLYSYHWNQQQY-QSYSPNRFKMTLGQANSMFAGYMQQDS 386

>YNL186W (UBP10) [4415] chr14 (289498..291876) Ubiquitin C-terminal
           hydrolase, involved in telomeric silencing [2379 bp, 792
           aa]
          Length = 792

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 4/62 (6%)

Query: 768 YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVVSDNIDEIKK-DGYIYFY 826
           Y+L +VV H+G S  SGHY+A  ++    +  W  Y+DE I +    D +K+ + Y   Y
Sbjct: 674 YQLLSVVVHEGRSLSSGHYIAHCKQ---PDGSWATYDDEYINIISERDVLKEPNAYYLLY 730

Query: 827 SR 828
           +R
Sbjct: 731 TR 732

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 33/77 (42%), Gaps = 7/77 (9%)

Query: 518 LDGTNNPQNLVETLTNFFNGENIDFD-------CPTCKKTVVATKRQRFKTSPNTLVISP 570
           L   N   ++ +++ +FFN E I  D       C  C KT  A K      +P TL++  
Sbjct: 577 LSSANRRFSIEKSIKDFFNPELIKVDKEQKGYVCEKCHKTTNAVKHSSILRAPETLLVHL 636

Query: 571 HRISFEKETWTPIKTSA 587
            +  F   + + +K + 
Sbjct: 637 KKFRFNGTSSSKMKQAV 653

>Scas_655.4
          Length = 875

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 4/62 (6%)

Query: 768 YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVVSDNIDEIKK-DGYIYFY 826
           Y L +VV H+G S  SGHY+A  R+    +  W  Y+DE I     ++ +K+ + Y   Y
Sbjct: 691 YELLSVVVHEGRSLSSGHYIAHCRQ---PDGSWATYDDEYINKISELNVLKEANAYYLLY 747

Query: 827 SR 828
           +R
Sbjct: 748 TR 749

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 52/138 (37%), Gaps = 36/138 (26%)

Query: 486 NIMKFIMEDKIQCQSCGNVKYSYEPTEYIQLPLDGTNNPQNLVE---------------- 529
           +I   +++  + C+SCG V  + +P   + L L G  N   + +                
Sbjct: 529 DIFGGLLKQIVTCKSCGGVSTTEQPFYDLSLHLKGKKNTTTVTDADGNEKTQHESKDNND 588

Query: 530 -------------TLTNFFNGENIDFD-------CPTCKKTVVATKRQRFKTSPNTLVIS 569
                        ++ +FFN E I  D       C  C KT  ATKR     +P TL++ 
Sbjct: 589 DASQLSKRFSIEKSIKDFFNPELIRVDKEKKGYVCEKCHKTTNATKRSSILRAPETLLVH 648

Query: 570 PHRISFEKETWTPIKTSA 587
             +  F   T + +K + 
Sbjct: 649 LKKFRFNGTTSSKMKQAV 666

>Scas_715.2
          Length = 717

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 66/164 (40%), Gaps = 12/164 (7%)

Query: 438 IKPQSFKNYVGQSNKEFKSNNQQDAXXXXXXXX---XXXXXXXXXXDNNPNNIMKFIMED 494
           + P  F N + + N  F S   QDA                      N  N I +  + +
Sbjct: 388 VSPVQFVNMLRRENVLFDSMMHQDAHEFLNFMLNDFSDRLDRDNQAKNFINEIFQGTLTN 447

Query: 495 KIQCQSCGNVKYSYEPTEYIQLPLDGTNNPQNLVETLTNFF------NGENIDFDCPTCK 548
           K++C +C NV    E   ++ LP++   N    ++ +  ++      NG N  F+C  C 
Sbjct: 448 KVRCLTCDNVTSREEA--FLDLPIEVKENGDTDIQRVLKYYSQREMLNGSN-KFNCSQCC 504

Query: 549 KTVVATKRQRFKTSPNTLVISPHRISFEKETWTPIKTSAELTLP 592
               A +    K  P+TL++   R  + ++  + IK  +++  P
Sbjct: 505 ALQEAERAVELKKLPDTLILHLKRFKYSEQQLSNIKLFSKVYYP 548

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 39/78 (50%), Gaps = 17/78 (21%)

Query: 368 GFINLGNSCYLNSVLQCLFNDGVPNWATLLANLIGNEFPLDCV-YPTTNLKCQLIKILNA 426
           G+ N GN+CY NSVLQCL+N  +P            EF L+ + YP  NL  Q ++ L  
Sbjct: 127 GYENFGNTCYCNSVLQCLYN--LP------------EFRLNILQYPERNLMDQRVRKLEM 172

Query: 427 FKLNPENYPEGI--KPQS 442
               P  + E    KPQ+
Sbjct: 173 PGYKPRCFSEASFEKPQT 190

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 11/77 (14%)

Query: 760 YGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKI--VVSDNI--- 814
           Y   D   Y L+ +V H G+    GHYVA  +    ++  W+ Y+DE +  V  + +   
Sbjct: 557 YKCTDTIKYELSGIVIHVGDGPQMGHYVALCKT---EKYGWLFYDDETVESVSEETVLKF 613

Query: 815 ---DEIKKDGYIYFYSR 828
              ++ +   Y+ FY +
Sbjct: 614 IGDEKTQSTAYVLFYKK 630

>Kwal_33.13628
          Length = 1160

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 46/108 (42%), Gaps = 12/108 (11%)

Query: 360 PPSKELGCGFINLGNSCYLNSVLQCLFNDGVPNWATL-----LANLIGNEFPLDCVYPTT 414
           PPS  +G    NLGNSCY+NS LQCL +  +P              I    PL       
Sbjct: 293 PPSGIVGLS--NLGNSCYMNSALQCLVH--IPELRDYFLYGGFEQDINTSNPLGYQGQIA 348

Query: 415 NLKCQLIKILNAFKLNPENYPEGIKPQSFKNYVGQSNKEFKSNNQQDA 462
                L+K L   K +     +   P++FK+ +G  N  F    QQD+
Sbjct: 349 QAFAALVKSLFDDKASA---LQAFSPRAFKSIIGHHNGMFAGFLQQDS 393

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 3/61 (4%)

Query: 768  YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVVSDNIDEIKKDGYIYFYS 827
            Y L AV  H G      HY A+++  +D   KW  ++D ++  ++    I    Y+ FY 
Sbjct: 962  YDLIAVDNHYGGLGGG-HYTAYVKNFMDG--KWYYFDDSRVSETEAERAISGAAYLLFYR 1018

Query: 828  R 828
            R
Sbjct: 1019 R 1019

>Scas_634.14
          Length = 1201

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 48/107 (44%), Gaps = 7/107 (6%)

Query: 359 LPPSKELGCGFINLGNSCYLNSVLQCLFNDGVPNWATLLANL---IGNEFPLDCVYPTTN 415
           L PS E+  G +NLGN+CY+NS LQC+ +  V     L +     +  + PL        
Sbjct: 314 LVPSLEI-TGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKELNTDNPLGYQGHVAE 372

Query: 416 LKCQLIKILNAFKLNPENYPEGIKPQSFKNYVGQSNKEFKSNNQQDA 462
              +LI+ L   KL   +      P  FK  +G  N  F    QQD+
Sbjct: 373 AFSELIRCLFGDKLVQFS---AYAPNHFKATIGHFNSMFSGYLQQDS 416

>YER098W (UBP9) [1530] chr5 (355462..357726) Ubiquitin C-terminal
           hydrolase, has similarity to Ubp13p [2265 bp, 754 aa]
          Length = 754

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 3/43 (6%)

Query: 766 KPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKI 808
           K Y L+ VV H G+    GHYV   R   +++  W+LY+DE +
Sbjct: 599 KKYELSGVVIHMGSGPQHGHYVCICR---NEKFGWLLYDDETV 638

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%)

Query: 368 GFINLGNSCYLNSVLQCLFN 387
           G+ N GN+CY NSVLQCL+N
Sbjct: 135 GYENFGNTCYCNSVLQCLYN 154

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 50/118 (42%), Gaps = 9/118 (7%)

Query: 481 DNNPNNIMKFIMEDKIQCQSCGNVKYSYEPTEYIQLPLDGTNNPQNLVETL------TNF 534
           DN   ++ K  + ++I+C +C N+    EP  ++  P++   + +  ++ +         
Sbjct: 470 DNFITDLFKGTLTNRIKCLTCDNITSRDEP--FLDFPIEVQGDEETDIQKMLKSYHQREM 527

Query: 535 FNGENIDFDCPTCKKTVVATKRQRFKTSPNTLVISPHRISFEKETWTPIKTSAELTLP 592
            NG N  F C  C     A +    K  P+ L +   R  + +E  + IK   ++  P
Sbjct: 528 LNGVN-KFYCNKCYGLQEAERMVGLKQLPHILSLHLKRFKYSEEQKSNIKLFNKILYP 584

>KLLA0D08459g complement(718046..720298) some similarities with
           sp|P53874 Saccharomyces cerevisiae YNL186w UBP10
           derepression of telomeric silencing, hypothetical start
          Length = 750

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 56/283 (19%), Positives = 105/283 (37%), Gaps = 55/283 (19%)

Query: 347 KMVDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQCLFNDGVPNWATLLANLIGNEFP 406
           ++V + G++L QL P      G +N G +CY N+ +Q + +  +P     L  L+   F 
Sbjct: 347 RIVKNWGSKLTQLKPR-----GLLNHGVTCYTNAAVQAMVH--IPAIQHYLFQLLRGNFK 399

Query: 407 ----LDCVYPTTNLKCQLIKILNAFKLNPENYPEGIKPQSFKNYVGQSNKEFKSNNQQDA 462
                +CV   + L  +    + +       Y   I P    N +   N    + NQ+D+
Sbjct: 400 DTVKSNCV---SMLLAETTMRMWSSDSTKNTY---INPDKLINALEDINCMMSAWNQEDS 453

Query: 463 XXXXXXXXXXXXXXXXXXDNNPN-----NIMKFIMEDKIQCQSCGNVKYSYEPTEYIQLP 517
                              +        ++   +++  ++C +CG +  + +P   + L 
Sbjct: 454 HEYFMSLMSRLQEDSVPKGHKMTESIIYDVFGGLLQQSVKCSNCGEISTTEQPIYDLSLH 513

Query: 518 LDG---TNNPQNLV-----------------------ETLTNFFNGENID-------FDC 544
           L G   T+  QN V                       +++ +FFN E I        + C
Sbjct: 514 LKGRKTTDQDQNSVGQDNSIDNSVDQQQSSKRRFSIEKSIRDFFNPELIKRVDNKEGYTC 573

Query: 545 PTCKKTVVATKRQRFKTSPNTLVISPHRISFEKETWTPIKTSA 587
             CKK   A K  +   +P TLV+   +  F   + + +K + 
Sbjct: 574 EKCKKVTNALKSNKIIRAPETLVVHLKKFRFNGTSSSKMKQAV 616

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 4/62 (6%)

Query: 768 YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKI-VVSDNIDEIKKDGYIYFY 826
           Y+L +VV H+G S  SGHY+A  ++    +  W  Y+DE I  +S+     + + Y   Y
Sbjct: 639 YQLISVVVHEGRSLSSGHYIAHCKQ---PDGSWATYDDEYINKISEKQLLKEPNAYFLVY 695

Query: 827 SR 828
           +R
Sbjct: 696 TR 697

>Kwal_33.14430
          Length = 511

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 53/281 (18%), Positives = 107/281 (38%), Gaps = 41/281 (14%)

Query: 339 EQNMNWNFKMVDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQCLFNDGVPNWATLLA 398
           ++  N + +++ + G +L  + P      G +N G +CY N+ +Q L +  +P     L 
Sbjct: 101 DRGTNNSKRLLKNWGPQLSTMKPK-----GLLNHGVTCYTNAAVQALVH--IPAIQHYLF 153

Query: 399 NLIGNEFPLDCVYPTTNLKCQLIKILNAFKLNPENYPEGIKPQSFKNYVGQSNKEFKSNN 458
           +++  E+    + P +  +  L +       N  +  + I P+     +   N       
Sbjct: 154 DVLRGEYK-STIAPQSVTQV-LAETTKRMWSNESSKNQFINPKKLIGRLDDINCMMSEWQ 211

Query: 459 QQDAXXXXXXXXXXXXXXXXXXDNNPN-----NIMKFIMEDKIQCQSCGNVKYSYEPTEY 513
           Q+D+                   +        +I   ++  ++ C+SCG V  + +P   
Sbjct: 212 QEDSHEYFMSLISRLQEDSVPRGHKLTESILYDIFGGLLRQEVTCKSCGEVSKTEQPIYD 271

Query: 514 IQLPLDGTNN----------------PQ---NLVETLTNFFNGENIDFD--------CPT 546
           + L L G  N                PQ   ++ +++ +FFN E I  D        C  
Sbjct: 272 LSLHLKGKKNSSQGESAKNSSEYEEEPQRRFSIEKSIRDFFNPELIKADKATKEGYVCEK 331

Query: 547 CKKTVVATKRQRFKTSPNTLVISPHRISFEKETWTPIKTSA 587
           C KT  A+K      +P TL++   +  F   + + +K + 
Sbjct: 332 CHKTTNASKHNFLLRAPETLLVHLKKFRFNGTSSSKLKQAV 372

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query: 768 YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVVSDNIDEIKKDGYIYF-Y 826
           Y+L +VV H+G S  SGHY+A  ++    +  W  Y+DE I        +K+ G  Y  Y
Sbjct: 395 YQLISVVVHEGRSLSSGHYIAHCKQ---PDGSWSTYDDEYINKISEKQMLKEPGAYYLVY 451

Query: 827 SR 828
           +R
Sbjct: 452 TR 453

>YMR223W (UBP8) [4179] chr13 (716714..718129) Putative
           ubiquitin-specific protease, ubiquitin C-terminal
           hydrolase [1416 bp, 471 aa]
          Length = 471

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 65/158 (41%), Gaps = 51/158 (32%)

Query: 234 CHDCDLDSNLWLCLHCGNVGCGRNQVGIDGNSHALAHFDTHKDHPLAIKLGSLSPESSDV 293
           CH+ +  +  ++CL CG  GC         +SH L+H      H   I     +  +  +
Sbjct: 49  CHEINSGAT-FMCLQCGFCGCWN-------HSHFLSH-SKQIGHIFGI-----NSNNGLL 94

Query: 294 YCYQCNDEVRFDGDKDFLAKFLLTNYQIDVSSKMGTEKSLIELQVEQNMNWNFKMVDSHG 353
           +C++C D +   G+ D +   +L  Y  DV +K                           
Sbjct: 95  FCFKCEDYI---GNIDLINDAILAKYWDDVCTKT-------------------------- 125

Query: 354 NELIQLPPSKELG---CGFINLGNSCYLNSVLQCLFND 388
                + PS E      G IN+G++C+++S+LQCL ++
Sbjct: 126 -----MVPSMERRDGLSGLINMGSTCFMSSILQCLIHN 158

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 4/60 (6%)

Query: 768 YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVVSDNIDEIKKDGYIYFYS 827
           Y L  +V HKG + + GHY+AF +       +W  +ND  +      + +K+  Y+ FY+
Sbjct: 411 YELIGIVSHKG-TVNEGHYIAFCKI---SGGQWFKFNDSMVSSISQEEVLKEQAYLLFYT 466

>CAGL0I05522g complement(521749..523923) some similarities with
           sp|P39967 Saccharomyces cerevisiae YER098w UBP9 or
           sp|P38187 Saccharomyces cerevisiae YBL067c UBP13,
           hypothetical start
          Length = 724

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 11/76 (14%)

Query: 760 YGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKI------VVSDN 813
           + N   K Y LT VV H G S   GHYV+  +    ++  W++Y+DE I       V+ +
Sbjct: 575 FDNSLCKTYELTGVVLHVGASPTHGHYVSICKH---EKYGWLMYDDETIESIPEEAVTSH 631

Query: 814 IDEIKK--DGYIYFYS 827
           + E       Y+ FYS
Sbjct: 632 VGEPNNPITAYVLFYS 647

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 25/40 (62%)

Query: 348 MVDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQCLFN 387
           +VD++  +L+          G+ N G++CY NSVLQC++N
Sbjct: 102 IVDTNVTKLMPFGDGSNKVFGYENFGHTCYCNSVLQCIYN 141

>Sklu_2425.8 YER098W, Contig c2425 12113-14377 reverse complement
          Length = 754

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%)

Query: 346 FKMVDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQCLFN 387
           F ++ +H  +L+          G+ N GN+CY NSVLQCL+N
Sbjct: 125 FPVLSTHTTDLLPYGDGSNKVFGYENFGNTCYCNSVLQCLYN 166

>KLLA0E10252g 906675..909065 gi|10444512|gb|AAG17929.1|AF303215_1
           Kluyveromyces lactis deubiquitinating enzyme,
           hypothetical start
          Length = 796

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 53/127 (41%), Gaps = 14/127 (11%)

Query: 348 MVDSHGNELIQLP--PSKEL--GCGFINLGNSCYLNSVLQCLFNDGVPNWATLLANLIGN 403
           +V S+GN  +     PS  L    G +NLGNSCYLN ++QCL      ++   L N    
Sbjct: 409 IVSSNGNNSVAKSGHPSINLDFAIGLVNLGNSCYLNCIIQCLLGCHELSY-IFLTNSYRK 467

Query: 404 EFPLDCVYPTTNLKC----QLI-KILNAFKLNPEN----YPEGIKPQSFKNYVGQSNKEF 454
              ++    +  L      QL+ K+    KL   N        + P  FK   G  N  F
Sbjct: 468 HVNVNSRLGSKGLLANYFSQLVQKMYQQGKLQAYNNTNMESTAVHPTQFKLACGSINSLF 527

Query: 455 KSNNQQD 461
           K   QQD
Sbjct: 528 KGKQQQD 534

>CAGL0J11352g complement(1101349..1103664) similar to sp|P53874
           Saccharomyces cerevisiae YNL186w UBP10, start by
           similarity
          Length = 771

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 8/64 (12%)

Query: 768 YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDE---KIVVSDNIDEIKKDGYIY 824
           Y L +VV H+G S  SGHY+A  ++    +  W  Y+DE   KI   + + E  ++ Y  
Sbjct: 662 YELLSVVVHEGRSLSSGHYIAHCKQ---PDGSWATYDDEYINKITEREVLKE--RNAYYV 716

Query: 825 FYSR 828
            Y+R
Sbjct: 717 LYTR 720

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 49/127 (38%), Gaps = 31/127 (24%)

Query: 492 MEDKIQCQSCGNVKYSYEPTEYIQLPLDGTNNPQNLV----------------------- 528
           ++  + C+SCG V  + +P   + L L G    +N V                       
Sbjct: 513 LKQTVTCKSCGEVSTTEQPFYDLSLHLKGKKTDENTVNQEKSSSQSETKDSDSQTSRYSI 572

Query: 529 -ETLTNFFNGENIDFD-------CPTCKKTVVATKRQRFKTSPNTLVISPHRISFEKETW 580
            +++ +FFN E I  D       C  C KT  A KR     +P TL++   +  F   + 
Sbjct: 573 EKSIRDFFNPELIKVDKEKKGYVCEKCHKTTNALKRNSILRAPETLLVHLKKFRFNGTSS 632

Query: 581 TPIKTSA 587
           + +K + 
Sbjct: 633 SKMKQAV 639

>ABL145W [447] [Homologous to ScYNL186W (UBP10) - SH]
           complement(124841..127090) [2250 bp, 749 aa]
          Length = 749

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 768 YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDE---KIVVSDNIDEIKKDGYIY 824
           Y+L +VV H+G S  SGHY+A  ++    +  W  Y+DE   KI   + + E+  + Y  
Sbjct: 638 YQLISVVVHEGRSLSSGHYIAHCKQ---PDGTWATYDDEYINKITERNVLKEV--NAYYL 692

Query: 825 FYSR 828
            Y+R
Sbjct: 693 VYTR 696

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 49/271 (18%), Positives = 100/271 (36%), Gaps = 50/271 (18%)

Query: 368 GFINLGNSCYLNSVLQCLFNDGVPNWATLLANLIGNEFPLDCVYPTTNLKCQLIKILNAF 427
           G +N G +CY N+ +Q + +  +P     L ++   ++  D + P++  +         +
Sbjct: 352 GLLNHGVTCYQNAAVQAMLH--IPALQHYLFDIAQGKYK-DVISPSSVSQVLAETSKRMW 408

Query: 428 KL-NPENYPEGIKPQSFKNYVGQSNKEFKSNNQQDAXXXXXXXXXXXXXXXXXXDNNPN- 485
            L N ++    I P+     +   N      NQ+D+                   +    
Sbjct: 409 SLENGKSKASYINPKKLIGRLEDINCMMSVWNQEDSHEYFMSLISRLQEDSVPRGHKMTE 468

Query: 486 ----NIMKFIMEDKIQCQSCGNVKYSYEPTEYIQLPL----------------------- 518
               +I   +++ +++C+SCG+V  + +P   + L L                       
Sbjct: 469 SLIYDIFGGLLQQRVKCKSCGSVSITEQPIYDLSLHLKGKKLAKGDDSTVDDSITGDVKN 528

Query: 519 --------DGTNNPQ---NLVETLTNFFNGENID-------FDCPTCKKTVVATKRQRFK 560
                   DG   P+   ++ +++ +FFN E I        + C  CK T  A KR    
Sbjct: 529 SAAPSGSTDGAELPKRRYSIEKSIRDFFNPELIKKVDNKEGYVCEKCKATTNAIKRNMIL 588

Query: 561 TSPNTLVISPHRISFEKETWTPIKTSAELTL 591
            +P TL++   +  F   + + +K +    L
Sbjct: 589 RAPETLLVHLKKFRFNGTSSSKMKQAVSYPL 619

>Scas_698.7
          Length = 1030

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 14/84 (16%)

Query: 758  IIYGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRK-----MIDDELKWVLYNDEKIVVSD 812
            I+  N +   Y+L  +V H GN   SGHY + + K     +  ++ +W  ++DE +    
Sbjct: 945  IVLKNNEVAKYKLYGIVNHTGNLI-SGHYTSLVNKEPGHNLNHNQQRWYYFDDEVVKAEG 1003

Query: 813  NIDEI--------KKDGYIYFYSR 828
            N  +I         KD Y+ FY R
Sbjct: 1004 NHGDIDNGISKVSSKDVYVLFYER 1027

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%)

Query: 367 CGFINLGNSCYLNSVLQCLF 386
            G  NLGN+CY+NS+LQCLF
Sbjct: 608 TGLRNLGNTCYINSMLQCLF 627

>Scas_692.39
          Length = 466

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 768 YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVVSDNIDEIKKDGYIYFYS 827
           Y LT ++ H G S + GHYV  ++  I+D  +W  +ND  I V    + +K+  Y+ FY+
Sbjct: 406 YELTGILSHIG-SINEGHYVVVLK--INDG-RWFKFNDSMISVIKEDEALKQQAYLLFYT 461

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 39/195 (20%), Positives = 72/195 (36%), Gaps = 57/195 (29%)

Query: 244 WLCLHCGNVGCGRNQVGIDGNSHALAHFDTHKD---HPLAIKLGSLSPESSDVYCYQCND 300
           ++CL C  VGC              +HF TH     H   I     +  +  ++C++C D
Sbjct: 59  FMCLQCDFVGCWNG-----------SHFITHMKRFGHVFGI-----NSSNGLLFCFKCMD 102

Query: 301 EVRFDGDKDFLAKFLLTNYQIDVSSKMGTEKSLIELQVEQNMNWNFKMVDSHGNELIQLP 360
            +   G  + +   +L  Y  D+S+K                                  
Sbjct: 103 YI---GHLETINYSMLNKYWDDISTKTTI------------------------------- 128

Query: 361 PSKELG---CGFINLGNSCYLNSVLQCLF-NDGVPNWATLLANLIGNEFPLDCVYPTTNL 416
           PS+E      G +N+G++C+++S+LQ L  N  + N++    + +        +  +  L
Sbjct: 129 PSQERRDGLFGLVNMGSTCFMSSILQALIHNPYIVNYSMSQTHFVNCSIKNSSLCMSCAL 188

Query: 417 KCQLIKILNAFKLNP 431
              +I+     KL P
Sbjct: 189 DAMIIEFYGQSKLQP 203

>AGR370W [4681] [Homologous to ScYER098W (UBP9) - SH; ScYBL067C
           (UBP13) - SH] complement(1416093..1418315) [2223 bp, 740
           aa]
          Length = 740

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 30/69 (43%), Gaps = 11/69 (15%)

Query: 766 KPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKI--VVSDNIDEIKKD--- 820
           K Y L  +V H G     GHYVA  +  +     W+LY+DE +  V  D +     D   
Sbjct: 590 KDYELNGIVIHMGGGPQHGHYVAICKHEL---FGWLLYDDETVESVGEDAVLRFIGDVND 646

Query: 821 ---GYIYFY 826
               Y+ FY
Sbjct: 647 MTTAYVLFY 655

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 16/20 (80%)

Query: 368 GFINLGNSCYLNSVLQCLFN 387
           G  N GN+CY NSVLQCL+N
Sbjct: 100 GLENYGNTCYCNSVLQCLYN 119

>KLLA0C03476g 314815..318573 weakly similar to sp|P39538
           Saccharomyces cerevisiae YJL197w UBP12 ubiquitin
           C-terminal hydrolase, hypothetical start
          Length = 1252

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 41/98 (41%), Gaps = 6/98 (6%)

Query: 368 GFINLGNSCYLNSVLQCLFNDGVPNWATLLANL---IGNEFPLDCVYPTTNLKCQLIKIL 424
           G  NLGN+CY+NS LQCL +    N   L       I    PL       +    L+  L
Sbjct: 340 GLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREININNPLGHKGDVAHAFGHLLYSL 399

Query: 425 NAFKLNPENYPEGIKPQSFKNYVGQSNKEFKSNNQQDA 462
            A       +     P++FKN +G  N  F    QQD+
Sbjct: 400 FAPSYGQSTF---YAPRNFKNTIGHYNSLFAGYGQQDS 434

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 3/61 (4%)

Query: 768  YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVVSDNIDEIKKDGYIYFYS 827
            Y L AV  H G     GHY A+ R  ID   KW  ++D ++      + I    Y+ FY 
Sbjct: 992  YDLIAVDNHYGGLG-GGHYTAYCRNFIDG--KWYYFDDSRVNEVSPENSIAGSAYLLFYR 1048

Query: 828  R 828
            R
Sbjct: 1049 R 1049

>KLLA0E20449g 1810593..1812686 weakly similar to sp|P39967
           Saccharomyces cerevisiae YER098w UBP9 ubiquitin
           carboxyl-terminal hydrolase, start by similarity
          Length = 697

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%)

Query: 368 GFINLGNSCYLNSVLQCLFN 387
           G+ N GN+CY NSVLQCL+N
Sbjct: 116 GYENFGNTCYCNSVLQCLYN 135

>CAGL0A04477g 437397..439709 similar to sp|P38187 Saccharomyces
           cerevisiae YBL067c UBP13 or sp|P39967 Saccharomyces
           cerevisiae YER098w UBP9 ubiquitin carboxyl-terminal
           hydrolase, hypothetical start
          Length = 770

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%)

Query: 368 GFINLGNSCYLNSVLQCLFN 387
           G+ N GN+CY NSVLQCL+N
Sbjct: 151 GYENFGNTCYCNSVLQCLYN 170

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 26/44 (59%), Gaps = 3/44 (6%)

Query: 765 AKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKI 808
           +K Y L+ +V H G     GHY++  +   +++  W+L++DE +
Sbjct: 610 SKNYELSGIVVHMGGGPQHGHYISLCK---NEKFGWLLFDDETV 650

>YBL067C (UBP13) [130] chr2 complement(93817..95883) Ubiquitin
           C-terminal hydrolase [2067 bp, 688 aa]
          Length = 688

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (66%), Gaps = 7/39 (17%)

Query: 368 GFINLGNSCYLNSVLQCLFNDGVPNWATLLANLIGNEFP 406
           G+ N GN+CY NSVLQCL+     N ++L  N++  +FP
Sbjct: 141 GYENFGNTCYCNSVLQCLY-----NLSSLRENIL--QFP 172

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 768 YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKI 808
           Y L  +V H G     GHYV+  +    ++  W+L++DE +
Sbjct: 602 YELAGIVVHMGGGPQHGHYVSLCKH---EKFGWLLFDDETV 639

>YER144C (UBP5) [1573] chr5 complement(457801..460218)
           Ubiquitin-specific protease (ubiquitin C-terminal
           hydrolase), homologous to Doa4p and human Tre-2 [2418
           bp, 805 aa]
          Length = 805

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 761 GNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIV-VSDNIDEIKK 819
           G +    YRL  V CH G S + GHY +++ K    +  W  ++D     ++ + + I  
Sbjct: 738 GQVPPFRYRLYGVACHSG-SLYGGHYTSYVYK--GPKKGWYFFDDSLYRPITFSTEFITP 794

Query: 820 DGYIYFYSR 828
             Y+ FY R
Sbjct: 795 SAYVLFYER 803

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 37/83 (44%), Gaps = 5/83 (6%)

Query: 495 KIQCQSCGNVKYSYEPTEYIQLPLDGTNNPQNLVETLTNFFNGENIDFD----CPTCKKT 550
           ++QCQ C +   +Y+    + +P+       N+++    F   E +  D    CP C K 
Sbjct: 616 RLQCQVCEHTSTTYQTFSVLSVPVPRVKT-CNILDCFREFTKCERLGVDEQWSCPKCLKK 674

Query: 551 VVATKRQRFKTSPNTLVISPHRI 573
             +TK+ +    P  L+I+  R 
Sbjct: 675 QPSTKQLKITRLPKKLIINLKRF 697

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 16/22 (72%)

Query: 364 ELGCGFINLGNSCYLNSVLQCL 385
           +L  G  N+GN CY+N +LQCL
Sbjct: 443 DLIVGLENIGNCCYMNCILQCL 464

>Sklu_1544.2 YMR223W, Contig c1544 592-1956 reverse complement
          Length = 454

 Score = 37.0 bits (84), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 761 GNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVVSDNIDEIKKD 820
           G   A  Y L  ++ H+G S + GHY + I K+   +  W  +ND  +     ID +K+ 
Sbjct: 387 GETPAIVYELIGLISHQG-SVNQGHYTS-ICKIPGGQ--WFKFNDSMVTAVAEIDVLKEQ 442

Query: 821 GYIYFYS 827
            Y+ FY+
Sbjct: 443 AYLLFYT 449

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 72/357 (20%), Positives = 127/357 (35%), Gaps = 88/357 (24%)

Query: 244 WLCLHCGNVGCGRNQVGIDGNSHALAHFDTHKDHPLAIKLG---SLSPESSDVYCYQCND 300
           ++C+ CG  GC  N            HF  H       K+G    L+  +  ++C++C+D
Sbjct: 57  FMCVQCGFCGCWNNN-----------HFMIHSK-----KVGHIFGLNSSNGLLFCFKCSD 100

Query: 301 EVRFDGDKDFLAKFLLTNYQIDVSSKMGTEKSLIELQVEQNMNWNFKMVDSHGNELIQLP 360
            +   GD + +A   L      VS+K     S+  ++    +                  
Sbjct: 101 YI---GDNELVACAPLNKVWDGVSTK----SSIPSVEKRNGLA----------------- 136

Query: 361 PSKELGCGFINLGNSCYLNSVLQCLFNDGVPNWATLLANLIGNEFPLDCVYPTT------ 414
                  G +N+G++C+++S++Q           TL+ N    +  +D ++ TT      
Sbjct: 137 -------GLVNMGSTCFMSSIIQ-----------TLIHNPYILKHSMDQLHSTTCDLQNS 178

Query: 415 --NLKCQLIKILNAFKLNPENYPEGIKPQSFKNYVGQS---NKEFKSNNQQDAXX----- 464
              + C + +I++ F    ++       Q F N +  S   NK     +QQDA       
Sbjct: 179 SSCMSCAVDQIISDFYGASKSETSETNQQGFVNLLSCSWRKNKNLAGYSQQDAHEFWQFL 238

Query: 465 --XXXXXXXXXXXXXXXXDNNPNNI----MKFIMEDKIQCQSCGNVKYSYEPTEYIQLPL 518
                              N+ N I     +  ++  I C  C N + +      + L L
Sbjct: 239 LNQLHNDHLRATNQKASLKNDCNCISHRSFQGFLKSSIVCPECQNDRKT-TIDLMMDLSL 297

Query: 519 DGTNNPQNLVETLTNFFNGENI---DFDCPTCKKTVVATKRQRFKTSPNTLVISPHR 572
           D   N   L E L NF   E +   ++ C  C     A ++      P  LV+   R
Sbjct: 298 D-IKNKSTLHECLDNFHKKEQLTDFNYHCEKCNTKQNAIRQLTIAKLPPVLVLQLKR 353

>Kwal_55.19645
          Length = 970

 Score = 37.0 bits (84), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 5/38 (13%)

Query: 349 VDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQCLF 386
           ++   NE + L  +     G  N+GN+CY+NS+LQCLF
Sbjct: 543 IEQSSNEYVALSIT-----GLRNMGNTCYINSMLQCLF 575

>YIL156W (UBP7) [2521] chr9 (48091..51306) Putative ubiquitin-specific
            protease (ubiquitin C-terminal hydrolase) [3216 bp, 1071
            aa]
          Length = 1071

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 40/83 (48%), Gaps = 14/83 (16%)

Query: 758  IIYGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDEL-----KWVLYNDEKIVVSD 812
            II  N D   Y+L  VV H G +  SGHY + + K ++  +     KW  ++DE +V +D
Sbjct: 988  IILKNNDTMKYKLFGVVNHTG-TLISGHYTSLVNKDLEHNVNIGRSKWYYFDDE-VVKAD 1045

Query: 813  -------NIDEIKKDGYIYFYSR 828
                   N+     D Y+ FY R
Sbjct: 1046 RKHGSDKNLKISSSDVYVLFYER 1068

 Score = 37.0 bits (84), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 17/20 (85%)

Query: 367 CGFINLGNSCYLNSVLQCLF 386
            G  NLGN+CY+NS++QCLF
Sbjct: 609 TGLRNLGNTCYINSMIQCLF 628

>KLLA0A00396g 29717..32755 similar to sp|P40453 Saccharomyces
           cerevisiae YIL156w UBP7 ubiquitin carboxy terminal
           hydrolase, start by similarity
          Length = 1012

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 16/63 (25%)

Query: 335 ELQVEQNMNWNFKM-----------VDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQ 383
           EL+  Q  +W  +            ++   NE + L  +     G  N+GN+CY+NS+LQ
Sbjct: 550 ELRTPQRNDWTVQTQHLHVPFSIPTIERSPNEFVSLSIT-----GLRNMGNTCYINSMLQ 604

Query: 384 CLF 386
           CLF
Sbjct: 605 CLF 607

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 31/77 (40%), Gaps = 15/77 (19%)

Query: 485 NNIMKFIMEDKIQCQSCGNVKYSYEPTEYIQLPLDGTNNPQNL--------------VET 530
           ++I +  ME+ ++CQ CG   Y+Y     + L +     P+                + T
Sbjct: 738 DDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYT 797

Query: 531 LTNFFNGENIDFDCPTC 547
                 GEN  +DCP C
Sbjct: 798 QDELLTGENA-WDCPKC 813

>CAGL0G02563g complement(235498..237393) weakly similar to sp|P36026
           Saccharomyces cerevisiae YKR098c UBP11 ubiquitin
           C-terminal hydrolase, hypothetical start
          Length = 631

 Score = 36.6 bits (83), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%)

Query: 368 GFINLGNSCYLNSVLQCLF 386
           G  N+GN+CY+NS+LQCLF
Sbjct: 214 GIRNMGNTCYMNSMLQCLF 232

>CAGL0I06765g 655806..658469 similar to sp|P32571 Saccharomyces
           cerevisiae YDR069c DOA4 ubiquitin-specific protease,
           hypothetical start
          Length = 887

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 38/82 (46%), Gaps = 5/82 (6%)

Query: 495 KIQCQSCGNVKYSYEPTEYIQLPLDGTNNPQNLVETLTNFFNGENIDFD----CPTCKKT 550
           +++C+ C     +Y+    + +P+  +     L++    F   EN++ D    CP+CKK 
Sbjct: 695 QLRCKVCNRTSTTYQAFSVLSVPVP-SGKSCGLLDCFIEFTKTENLEVDEQWFCPSCKKK 753

Query: 551 VVATKRQRFKTSPNTLVISPHR 572
             +TK+      P  L+I   R
Sbjct: 754 QPSTKKLTITRLPRNLIIHLKR 775

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 10/36 (27%)

Query: 361 PSKELGC----------GFINLGNSCYLNSVLQCLF 386
           P K L C          G  N+GNSCY+N ++QC+F
Sbjct: 509 PEKTLSCNQMMDTSFTVGLENMGNSCYINCIIQCIF 544

>AGR139C [4450] [Homologous to ScYER151C (UBP3) - SH]
           (1010466..1012835) [2370 bp, 789 aa]
          Length = 789

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 27/69 (39%), Gaps = 10/69 (14%)

Query: 768 YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVVSDNIDEIK--------K 819
           YRLT VV H G S   GHY A +     D  KW   +D  +      D  K        K
Sbjct: 723 YRLTGVVYHHGLSPSGGHYTADVLHQTQD--KWYRIDDNNVTEIRQEDVFKRGDEASDSK 780

Query: 820 DGYIYFYSR 828
             YI  Y R
Sbjct: 781 TAYILIYQR 789

>Kwal_26.9151
          Length = 454

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 4/59 (6%)

Query: 768 YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVVSDNIDEIKKDGYIYFY 826
           Y L AV+ H+G S + GHY +  +       +W  +ND  IV     + +++  Y+ FY
Sbjct: 394 YELVAVISHEG-SVNQGHYTSMCKI---PGGQWFRFNDSMIVSISEEEALRQQAYLLFY 448

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 62/145 (42%), Gaps = 44/145 (30%)

Query: 244 WLCLHCGNVGCGRNQVGIDGNSHALAHFDTHKDHPLAIKLGSLSPESSDVYCYQCNDEVR 303
           ++CL CG  GC   Q           HF  H     A  +  ++  +  ++C++C + V 
Sbjct: 57  FMCLQCGVCGCWNKQ-----------HFALHSKK--AGHIFGVNSSNGLLFCFKCVEYV- 102

Query: 304 FDGDKDFLAKFLLTNYQIDVSSKMGTEKSLIELQVEQNMNWNFKMVDSHGNELIQLPPSK 363
             G++      +LTN  +                   N NW+   V S     + L   +
Sbjct: 103 -TGNE------MLTNSML-------------------NKNWDDISVKSS----VPLAKGR 132

Query: 364 ELGCGFINLGNSCYLNSVLQCLFND 388
           +  CG +N+G++C+++S++Q L ++
Sbjct: 133 DGLCGLVNMGSTCFMSSIIQTLVHN 157

>Kwal_55.21267
          Length = 604

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 31/50 (62%), Gaps = 5/50 (10%)

Query: 699 VDQESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNNPDDNGELPSE 748
           + + ++ +++DMG+   ++I+AL    GD+  S+ ++F     +GELP +
Sbjct: 1   MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIF-----SGELPQQ 45

>KLLA0F23463g 2193239..2196280 weakly similar to sp|P40987
           Saccharomyces cerevisiae YOR349w CIN1 chromosome
           segregation protein singleton, start by similarity
          Length = 1013

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 47/96 (48%), Gaps = 4/96 (4%)

Query: 638 VPPLLEMGFTENLAAKALYHTGNNNDP---EPALQWLMQHMDDSDFQDEFVPPPQTKAAG 694
           V  L EM F +   A  L+   N       +  +QWL+ +    ++  +FV    +  + 
Sbjct: 428 VLRLAEMHFGQLSNALTLFELFNGRYESYIDEMVQWLVLYSVGQNYDYQFVEKATSLLSE 487

Query: 695 PAAKVDQESLSNMIDMGLNEKLSIKALVLNKGDINA 730
             ++++++SLSNM+   +NE +S+K L     DI A
Sbjct: 488 MTSQINEKSLSNMVSKYINE-ISVKGLKYQDPDICA 522

>AFR296C [3488] [Homologous to ScYIL156W (UBP7) - SH; ScYKR098C
           (UBP11) - SH] (972525..976034) [3510 bp, 1169 aa]
          Length = 1169

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 6/70 (8%)

Query: 319 YQIDVSSKMGTEKSLIELQV-EQNMNWNFKMVDSHGNELIQLPPSKELGCGFINLGNSCY 377
           Y I+      TE+S   L       +++   ++ + NE I L  +     G  N+ N+CY
Sbjct: 702 YPIEYEDPKHTERSRGWLSAGSSEAHFSVPTIEKNPNEYIALSIT-----GLRNMSNTCY 756

Query: 378 LNSVLQCLFN 387
           +NS+LQCLF+
Sbjct: 757 INSMLQCLFS 766

>YER151C (UBP3) [1580] chr5 complement(469681..472419)
           Ubiquitin-specific protease, ubiquitin C-terminal
           hydrolase [2739 bp, 912 aa]
          Length = 912

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 10/74 (13%)

Query: 763 LDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVVSDNIDEIK---- 818
           +D + Y+LT V+ H G S+  GHY A +     +  KW   +D  I   ++ D +K    
Sbjct: 839 IDDRRYKLTGVIYHHGVSSDGGHYTADVYH--SEHNKWYRIDDVNITELEDDDVLKGGEE 896

Query: 819 ----KDGYIYFYSR 828
               +  YI  Y +
Sbjct: 897 ASDSRTAYILMYQK 910

>KLLA0E08767g 784991..787306 similar to sp|P25037 Saccharomyces
           cerevisiae YDL122w UBP1 ubiquitin-specific protease
           singleton, start by similarity
          Length = 771

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 12/18 (66%), Positives = 16/18 (88%)

Query: 368 GFINLGNSCYLNSVLQCL 385
           G +N GN+C++NSVLQCL
Sbjct: 85  GLVNDGNTCFMNSVLQCL 102

>Kwal_27.10842
          Length = 711

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 368 GFINLGNSCYLNSVLQCLFN 387
           G+ N GN+CY NSVLQ L+N
Sbjct: 144 GYENFGNTCYCNSVLQVLYN 163

>YOR138C (YOR138C) [4939] chr15 complement(584309..586324) Protein
           containing a UBA (ubiquitin associated) or TS-N domain
           [2016 bp, 671 aa]
          Length = 671

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 699 VDQESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNN--PD--DNGELPSETTPKRD 754
           +D +++ ++++MG+  ++++ AL    G++ A++ ++F+N  P+  + GE    + P+  
Sbjct: 2   MDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRIS 61

Query: 755 EEGIIYG 761
           E  I+ G
Sbjct: 62  ENKIVAG 68

>Scas_555.6
          Length = 917

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 31/70 (44%), Gaps = 8/70 (11%)

Query: 766 KPYRLTAVVCHKGNSAHSGHYVAFIRKM-------IDDELKWVLYNDEKIVVSDNIDEIK 818
           + Y+LT V+ H G+S   GHY A +          IDD     L ND  +   DN D   
Sbjct: 847 REYKLTGVIYHHGSSPDGGHYTADVFHQQTNKWYRIDDVNISELKNDHVLDADDN-DMGT 905

Query: 819 KDGYIYFYSR 828
           +  YI  Y +
Sbjct: 906 RTAYILIYEK 915

>Scas_714.11
          Length = 1269

 Score = 33.5 bits (75), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 361 PSKELGCGFINLGNSCYLNSVLQCLFN 387
           P K+   G  N+GN+CYLNS+LQ  F+
Sbjct: 707 PIKDWPAGINNIGNTCYLNSLLQYYFS 733

>CAGL0K10252g complement(997315..1001118) similar to sp|Q01476
           Saccharomyces cerevisiae YOR124c UBP2 ubiquitin-specific
           proteinase, hypothetical start
          Length = 1267

 Score = 33.5 bits (75), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 332 SLIELQVEQNMNWNFKMVDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQCLF 386
           +L ++ +E+N N     +++ GN      P++    G  N+GN+CYLNS+LQ  F
Sbjct: 688 ALTKIALERNSNLLLNFLET-GNINPNSLPAENWPTGINNIGNTCYLNSLLQFYF 741

>YKR098C (UBP11) [3349] chr11 complement(632662..634815)
           Ubiquitin-specific protease, ubiquitin C-terminal
           hydrolase [2154 bp, 717 aa]
          Length = 717

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 42/85 (49%), Gaps = 12/85 (14%)

Query: 485 NNIMKFIMEDKIQCQSCGNVKYSYEPTEYIQLPL------DGTNNPQNL-VETLTNFFNG 537
           ++I +  +E+ ++CQ CGN  YSY     + L +        T+  + + +E   N F G
Sbjct: 449 DHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTG 508

Query: 538 E-----NIDFDCPTCKKTVVATKRQ 557
           +     +  +DCP C+ T   +K++
Sbjct: 509 DEELSGDNAWDCPNCRITDSKSKKE 533

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 15/19 (78%)

Query: 368 GFINLGNSCYLNSVLQCLF 386
           G  N  N+CY+NS++QCLF
Sbjct: 299 GLQNPCNTCYINSIIQCLF 317

>Scas_664.17
          Length = 494

 Score = 33.1 bits (74), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 78/205 (38%), Gaps = 28/205 (13%)

Query: 368 GFINLGNSCYLNSVLQCLFNDGVP--NWATLLANLIGNEFPLDCVYPTTNLKCQLIKILN 425
           G +N GN C++NS +Q L    VP     T L+  + +E     + P  N    ++  L 
Sbjct: 77  GLVNPGNDCFINSSIQAL----VPLDKLTTYLSATLEDEKTASTL-PLHNGLATMLLELQ 131

Query: 426 AFKLNPENYPEGIKPQSFKNYVGQSNKEFK---SNNQQDAXXXXXXXXXXXXXXXXXXDN 482
             + +P       K  S K ++ Q    F    S  Q DA                  D+
Sbjct: 132 QLRSDP-------KSVSSKRFIQQLETIFGGKISRQQNDAHEFTQLILERLNEENLTLDH 184

Query: 483 NPNNI-MKFIMEDKIQCQSCGNVKYSYEPTEYI-QLPLDGTNNPQNLVETLTNFFNGENI 540
               +  K I+ + + C  CG   +  E   YI +L L     PQ     L++  NGE +
Sbjct: 185 ADLTVPFKGIVGNHLVCLQCGRTSHVNEQPFYIYELTL-----PQQGSVKLSDLVNGEQM 239

Query: 541 D----FDCPTCKKTVVATKRQRFKT 561
           +    + C  CK   + T  +  K+
Sbjct: 240 ETIENYSCMYCKTVAMLTNEREEKS 264

>Kwal_55.21393
          Length = 1233

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%)

Query: 361 PSKELGCGFINLGNSCYLNSVLQCLF 386
           P++    G  N+GN+CYLNS+LQ  F
Sbjct: 697 PARNWPTGLNNIGNTCYLNSLLQYYF 722

>CAGL0H06721g complement(667816..671061) similar to sp|P40453
           Saccharomyces cerevisiae YIL156w UBP7, hypothetical
           start
          Length = 1081

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 37/92 (40%), Gaps = 13/92 (14%)

Query: 492 MEDKIQCQSCGNVKYSYEPTEYIQLPLDGTNNP------QNLVETLTNFF------NGEN 539
           ME+ +QCQ CG    +Y     + L L   + P      +  +E   N F       GEN
Sbjct: 807 MENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGEN 866

Query: 540 IDFDCPTCKKTVVATKRQRFKTSPNTLVISPH 571
             +DCP C    V  +     ++   L  SPH
Sbjct: 867 A-WDCPKCGSKAVEPRFTSRTSTQTILPNSPH 897

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 15/20 (75%)

Query: 367 CGFINLGNSCYLNSVLQCLF 386
            G  NLGN+CY+N +LQ LF
Sbjct: 648 TGLRNLGNTCYINCMLQSLF 667

>Scas_695.7
          Length = 482

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%)

Query: 368 GFINLGNSCYLNSVLQCL 385
           G IN GNSC++NSVLQ L
Sbjct: 28  GLINNGNSCFMNSVLQAL 45

>AFR551W [3743] [Homologous to ScYMR223W (UBP8) - SH]
           complement(1427056..1428465) [1410 bp, 469 aa]
          Length = 469

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 74/366 (20%), Positives = 132/366 (36%), Gaps = 90/366 (24%)

Query: 244 WLCLHCGNVGCGRNQVGIDGNSHALAHFDTHKDHPLAIKLG---SLSPESSDVYCYQCND 300
           ++CL CG VGC          SH L H         + K+G    ++  +  ++C++C D
Sbjct: 58  FMCLQCGFVGCW-------NESHFLHH---------SKKVGHIFGVNATNGLLFCFRCRD 101

Query: 301 EVRFDGDKDFLAKFLLTNYQIDVSSKMGTEKSLIELQVEQNMNWNFKMVDSHGNELIQLP 360
            +    D +F+         +D+  K                +WN  +  S     I  P
Sbjct: 102 YI---SDNEFV--------HMDIMPK----------------HWNEVLRRSS----IPAP 130

Query: 361 PSKELGCGFINLGNSCYLNSVLQCLFNDGVPNWATLLANLIGNEFPLDCVYPTTNLKCQL 420
              E   G +N+G++C+++SV+Q   +  +P+    +   + +    D     + + C +
Sbjct: 131 HRGEGLLGLVNMGSTCFMSSVIQTFLH--LPHVLQYMLERL-HYATCDVQDSLSCISCAV 187

Query: 421 IKIL-NAFKLNPENYPEGI----------------KPQSFKNYVGQS---NKEFKSNNQQ 460
            +I+ N +    E    G+                + Q F N +  S   N+     +QQ
Sbjct: 188 DEIVANLYGQVKEEAASGVAGPGASTQALSQSLSKQQQGFINLLTCSWKINRNLAGYSQQ 247

Query: 461 DAXXXXXXXXXXXXXXXXXXDNNPNN----------IMKFIMEDKIQCQSC-GNVKYSYE 509
           DA                     P+           + +  +E  I C  C GN K + +
Sbjct: 248 DAHEFWQFLLNQLHTDYIRIHGPPSKKSACGCILHMLFQGYLESSIVCSECHGNNKTTVD 307

Query: 510 PTEYIQLPLDGTNNPQNLVETLTNFFNGENI-DFD--CPTCKKTVVATKRQRFKTSPNTL 566
           P   + L   G  N   L E L +F   E++ DF+  C  C  T    ++      P  L
Sbjct: 308 PIMDLSL---GIQNKSTLHECLDSFHRRESLTDFNYCCKNCMSTSNPIRQLSMAKLPPVL 364

Query: 567 VISPHR 572
           ++   R
Sbjct: 365 MLQLKR 370

>Sklu_2195.4 YBR040W, Contig c2195 5864-6739 reverse complement
          Length = 291

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%)

Query: 775 CHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVVSDNIDEIKKDGY 822
             KG  A +  + AF   ++D  + WVLY  ++  +S+ ID++K + Y
Sbjct: 229 VRKGKKAATMSWFAFSFLLLDCIILWVLYFRDRKSLSEEIDKVKNNHY 276

>AAR175C [363] [Homologous to ScYGL124C (MON1) - SH]
           (659185..661149) [1965 bp, 654 aa]
          Length = 654

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 42/69 (60%), Gaps = 2/69 (2%)

Query: 758 IIYGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVVSDNIDEI 817
           ++YG + A  +RL +V+  KG++ H+   +  +  M++++L+ +L++ +++ V     + 
Sbjct: 365 LLYGMIVAPDHRLVSVLRPKGHTLHTTD-LQLLFSMVENQLQ-LLHSSQEVWVPLCFPKF 422

Query: 818 KKDGYIYFY 826
             +G++Y Y
Sbjct: 423 NGNGFLYCY 431

>CAGL0J08393g 833499..835502 similar to tr|Q04377 Saccharomyces
           cerevisiae YDR499w LCD1 cell cycle checkpoint protein,
           start by similarity
          Length = 667

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 43/91 (47%), Gaps = 6/91 (6%)

Query: 323 VSSKMGTEKSLIELQVEQNMN-WNFKMVDSHGNELIQLPPSKELGCGFINLGNSCYLNSV 381
           V   +G E S IE+     +N   F+ +D    +L+++     +G G ++   SC  N  
Sbjct: 131 VHRIVGVELSTIEI-----LNCIKFEHIDEFNYKLLKINKDTSIGSGIVDFLQSCKKNMK 185

Query: 382 LQCLFNDGVPNWATLLANLIGNEFPLDCVYP 412
           L  L +  + + ATL+  +I N+  L+   P
Sbjct: 186 LNELVDSVLEHLATLIKAIIINDQELNFSVP 216

>Scas_562.12
          Length = 300

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 29/68 (42%), Gaps = 2/68 (2%)

Query: 263 GNSHALAH--FDTHKDHPLAIKLGSLSPESSDVYCYQCNDEVRFDGDKDFLAKFLLTNYQ 320
           GNSH L    F  H   PL  +L +L P       Y+    V   G + F  +FL  +Y+
Sbjct: 46  GNSHELNRVIFREHFSEPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYK 105

Query: 321 IDVSSKMG 328
            D  S  G
Sbjct: 106 KDFDSAFG 113

>YOR124C (UBP2) [4926] chr15 complement(554824..558642)
           Ubiquitin-specific protease (ubiquitin C-terminal
           hydrolase), cleaves at the C-terminus of ubiquitin [3819
           bp, 1272 aa]
          Length = 1272

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 20/29 (68%), Gaps = 1/29 (3%)

Query: 359 LPPSKELGCGFINLGNSCYLNSVLQCLFN 387
           LPP +    G  N+GN+CYLNS+LQ  F+
Sbjct: 729 LPP-ENWPTGINNIGNTCYLNSLLQYYFS 756

>Sklu_1620.2 YER151C, Contig c1620 788-3106
          Length = 772

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 28/61 (45%), Gaps = 3/61 (4%)

Query: 768 YRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVVSDNIDEIKKDGYIYFYS 827
           Y+L  VV H G S   GHY A +     D  KW   +D  I    N +E+ K G   F S
Sbjct: 705 YKLVGVVYHHGVSPSGGHYTADVYHQEMD--KWFRIDDVNI-AELNKEEVLKGGEDGFDS 761

Query: 828 R 828
           R
Sbjct: 762 R 762

>ACL164C [885] [Homologous to ScYOR124C (UBP2) - SH] (67792..71961)
           [4170 bp, 1389 aa]
          Length = 1389

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 361 PSKELGCGFINLGNSCYLNSVLQCLF 386
           P+     G  N+GN+CYLNS+LQ  F
Sbjct: 671 PAGNWPTGINNIGNTCYLNSLLQYYF 696

>KLLA0E02376g complement(218647..222309)
           gi|6136095|sp|O42726|UBP2_KLULA Kluyveromyces lactis
           Ubiquitin carboxyl-terminal hydrolase 2 (Ubiquitin
           thiolesterase 2) (Ubiquitin-specific processing protease
           2) (Deubiquitinating enzyme 2), start by similarity
          Length = 1220

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 15/20 (75%)

Query: 367 CGFINLGNSCYLNSVLQCLF 386
            G  N+GN+CYLNS+LQ  F
Sbjct: 698 AGINNVGNTCYLNSLLQFFF 717

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,607,322
Number of extensions: 1364985
Number of successful extensions: 3760
Number of sequences better than 10.0: 90
Number of HSP's gapped: 3724
Number of HSP's successfully gapped: 151
Length of query: 829
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 719
Effective length of database: 12,788,129
Effective search space: 9194664751
Effective search space used: 9194664751
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)