Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_718.48*88884634e-62
YBR058C-A (TSC3)80822534e-30
KLLA0F18634g84802327e-27
Kwal_27.1094984812301e-26
AGR026C107902303e-26
KLLA0F25762g100355601.2
Scas_719.344642572.6
YHR004C (NEM1)44648573.3
ACL181C192639564.8
YGR032W (GSC2)189539564.8
YLR342W (FKS1)187639556.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_718.48*
         (88 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_718.48*                                                          182   4e-62
YBR058C-A (TSC3) [249] chr2 complement(356284..356526) Protein a...   102   4e-30
KLLA0F18634g 1713947..1714201 weakly similar to sgd|S0007521 Sac...    94   7e-27
Kwal_27.10949                                                          93   1e-26
AGR026C [4336] [Homologous to ScYBR058C-A (TSC3) - SH] (762745.....    93   3e-26
KLLA0F25762g 2391115..2394126 weakly similar to sp|P36097 Saccha...    28   1.2  
Scas_719.3                                                             27   2.6  
YHR004C (NEM1) [2289] chr8 complement(111748..113088) Protein re...    27   3.3  
ACL181C [868] [Homologous to ScYLR342W (FKS1) - SH; ScYGR032W (G...    26   4.8  
YGR032W (GSC2) [1999] chr7 (548266..553953) Component of beta-1,...    26   4.8  
YLR342W (FKS1) [3725] chr12 (809997..815627) Component of beta-1...    26   6.1  

>Scas_718.48*
          Length = 88

 Score =  182 bits (463), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 88/88 (100%), Positives = 88/88 (100%)

Query: 1  MHLTSATASQCTMIFVPTNKELKEKRRAANGRGSIMEKVEEIVEKLYWMYYIHLPYYLMT 60
          MHLTSATASQCTMIFVPTNKELKEKRRAANGRGSIMEKVEEIVEKLYWMYYIHLPYYLMT
Sbjct: 1  MHLTSATASQCTMIFVPTNKELKEKRRAANGRGSIMEKVEEIVEKLYWMYYIHLPYYLMT 60

Query: 61 SFDSFCLHLFFLTIFSLSVFAVIKYIFL 88
          SFDSFCLHLFFLTIFSLSVFAVIKYIFL
Sbjct: 61 SFDSFCLHLFFLTIFSLSVFAVIKYIFL 88

>YBR058C-A (TSC3) [249] chr2 complement(356284..356526) Protein
          associated with serine palmitoyltransferase and
          required for optimal enzyme activity [243 bp, 80 aa]
          Length = 80

 Score =  102 bits (253), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 49/82 (59%), Positives = 61/82 (74%), Gaps = 3/82 (3%)

Query: 7  TASQCTMIFVPTNKELKEKRRAANGRGSIMEKVEEIVEKLYWMYYIHLPYYLMTSFDSFC 66
          T  + +M+++PT KE   KRR     G I+  +EE+VEKLYW YYIHLP+YLM SFDSF 
Sbjct: 2  TQHKSSMVYIPTTKE--AKRRNGKSEG-ILNTIEEVVEKLYWTYYIHLPFYLMASFDSFF 58

Query: 67 LHLFFLTIFSLSVFAVIKYIFL 88
          LH+FFLTIFSLS F ++KY FL
Sbjct: 59 LHVFFLTIFSLSFFGILKYCFL 80

>KLLA0F18634g 1713947..1714201 weakly similar to sgd|S0007521
          Saccharomyces cerevisiae YBR058ca required for optimal
          serine palmitoyltransferase activity, start by
          similarity
          Length = 84

 Score = 94.0 bits (232), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 58/80 (72%), Gaps = 8/80 (10%)

Query: 9  SQCTMIFVPTNKELKEKRRAANGRGSIMEKVEEIVEKLYWMYYIHLPYYLMTSFDSFCLH 68
          S+ TMI+ PTN+++         RG I EK+ + V+ LYW+YYIHLP+YLMTS D+FCLH
Sbjct: 13 SRGTMIYTPTNQQMS--------RGGIGEKLADFVKNLYWVYYIHLPFYLMTSLDAFCLH 64

Query: 69 LFFLTIFSLSVFAVIKYIFL 88
            FL + SLS+F ++KYIFL
Sbjct: 65 TIFLVVVSLSLFGLLKYIFL 84

>Kwal_27.10949
          Length = 84

 Score = 93.2 bits (230), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (67%), Gaps = 8/81 (9%)

Query: 8  ASQCTMIFVPTNKELKEKRRAANGRGSIMEKVEEIVEKLYWMYYIHLPYYLMTSFDSFCL 67
           +  TMI+ PT++EL          GS +EKV    E LYWMYYIHLPYYLMT+ D+FCL
Sbjct: 12 TNNGTMIYRPTDEELS--------NGSFLEKVSNFGENLYWMYYIHLPYYLMTTGDAFCL 63

Query: 68 HLFFLTIFSLSVFAVIKYIFL 88
          H FFL + +L +F ++KYIFL
Sbjct: 64 HTFFLAMLTLGLFGLVKYIFL 84

>AGR026C [4336] [Homologous to ScYBR058C-A (TSC3) - SH]
          (762745..763068) [324 bp, 107 aa]
          Length = 107

 Score = 93.2 bits (230), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 44/90 (48%), Positives = 59/90 (65%), Gaps = 14/90 (15%)

Query: 3  LTSATASQC------TMIFVPTNKELKEKRRAANGRGSIMEKVEEIVEKLYWMYYIHLPY 56
          ++S  A  C      TM++ PT+        A    G + EKV +  E LYWMYYIHLPY
Sbjct: 8  MSSKRADNCYKKDRGTMVYTPTD--------AQQATGKVHEKVYKFFESLYWMYYIHLPY 59

Query: 57 YLMTSFDSFCLHLFFLTIFSLSVFAVIKYI 86
          YLMTSFDSFCLH+FFL +F+LS+F ++K++
Sbjct: 60 YLMTSFDSFCLHVFFLVVFTLSLFGLLKWV 89

>KLLA0F25762g 2391115..2394126 weakly similar to sp|P36097
           Saccharomyces cerevisiae YKL033w singleton, start by
           similarity
          Length = 1003

 Score = 27.7 bits (60), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 9/55 (16%)

Query: 34  SIMEKVEEIVEKLYWMYYIHLPYYLMTSFDSFCLHLFFLTIFSLSVFAVIKYIFL 88
            ++E++ +I+EKL+WM    L YY    +D  C  L  L I    +   I+Y FL
Sbjct: 664 DLVERLNDILEKLFWM----LGYY--HGYDDLCTVLLNLFI---EISYKIQYTFL 709

>Scas_719.3
          Length = 446

 Score = 26.6 bits (57), Expect = 2.6,   Method: Composition-based stats.
 Identities = 11/42 (26%), Positives = 22/42 (52%)

Query: 13 MIFVPTNKELKEKRRAANGRGSIMEKVEEIVEKLYWMYYIHL 54
          M+ + +N  +  K R+ + +   ++  +E+V K  W Y  HL
Sbjct: 1  MVSIQSNNSMTSKERSHSRKWQNLDVNKEVVLKQVWTYLFHL 42

>YHR004C (NEM1) [2289] chr8 complement(111748..113088) Protein
           required for nuclear morphology [1341 bp, 446 aa]
          Length = 446

 Score = 26.6 bits (57), Expect = 3.3,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 7/48 (14%)

Query: 32  RGSIMEKVEEIVEKLYWMYYIHLPYYLMTSFDSFCLHLFFLTIFSLSV 79
           R  ++EK+  I+    W   + LPYYL+       + L+F+  F LSV
Sbjct: 85  RSILIEKIASIL----WALLLFLPYYLII---KPLMSLWFVFTFPLSV 125

>ACL181C [868] [Homologous to ScYLR342W (FKS1) - SH; ScYGR032W (GSC2)
            - SH] (40324..46104) [5781 bp, 1926 aa]
          Length = 1926

 Score = 26.2 bits (56), Expect = 4.8,   Method: Composition-based stats.
 Identities = 10/39 (25%), Positives = 20/39 (51%)

Query: 43   VEKLYWMYYIHLPYYLMTSFDSFCLHLFFLTIFSLSVFA 81
            +++    YY H  ++L   F    L +F LT+ +++  A
Sbjct: 1297 IDRFLSFYYAHPGFHLNNLFIQLSLQMFILTLMNMNALA 1335

>YGR032W (GSC2) [1999] chr7 (548266..553953) Component of
            beta-1,3-glucan synthase, provides an essential function
            that overlaps with that of Fks1p, a strongly similar
            protein [5688 bp, 1895 aa]
          Length = 1895

 Score = 26.2 bits (56), Expect = 4.8,   Method: Composition-based stats.
 Identities = 11/39 (28%), Positives = 19/39 (48%)

Query: 43   VEKLYWMYYIHLPYYLMTSFDSFCLHLFFLTIFSLSVFA 81
            +++    YY H  ++L   F    L +F LT+ +L   A
Sbjct: 1303 IDRFLTFYYAHPGFHLNNLFIQLSLQMFMLTLVNLHALA 1341

>YLR342W (FKS1) [3725] chr12 (809997..815627) Component of
            beta-1,3-glucan synthase, provides an essential function
            that overlaps with that of Gsc2p, a strongly similar
            protein [5631 bp, 1876 aa]
          Length = 1876

 Score = 25.8 bits (55), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 20/39 (51%)

Query: 43   VEKLYWMYYIHLPYYLMTSFDSFCLHLFFLTIFSLSVFA 81
            V++    YY H  ++L   F    L +F LT+ +LS  A
Sbjct: 1284 VDRFLTFYYAHPGFHLNNLFIQLSLQMFMLTLVNLSSLA 1322

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.331    0.140    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,608,643
Number of extensions: 89871
Number of successful extensions: 376
Number of sequences better than 10.0: 25
Number of HSP's gapped: 374
Number of HSP's successfully gapped: 25
Length of query: 88
Length of database: 16,596,109
Length adjustment: 60
Effective length of query: 28
Effective length of database: 14,519,029
Effective search space: 406532812
Effective search space used: 406532812
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 54 (25.4 bits)