Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_718.4773073030970.0
YBR060C (ORC2)62046613800.0
CAGL0H10230g51447812651e-167
Kwal_27.1094159545711221e-145
AGR028C57954410341e-132
KLLA0F18590g5964317463e-89
AFL147C93860685.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_718.47
         (730 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_718.47                                                          1197   0.0  
YBR060C (ORC2) [251] chr2 complement(360612..362474) Origin reco...   536   0.0  
CAGL0H10230g complement(1000574..1002118) similar to sp|P32833 S...   491   e-167
Kwal_27.10941                                                         436   e-145
AGR028C [4338] [Homologous to ScYBR060C (ORC2) - SH] (766480..76...   402   e-132
KLLA0F18590g 1709034..1710824 similar to sp|P32833 Saccharomyces...   291   3e-89
AFL147C [3048] [Homologous to ScYMR185W - SH] (158619..161435) [...    31   5.4  

>Scas_718.47
          Length = 730

 Score = 1197 bits (3097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/730 (83%), Positives = 606/730 (83%)

Query: 1   MSEGQPDDIVTHIDILCSPVKSSNKAIRNPLAHIHDSPNKKSRVSTKRPALETVKLETTE 60
           MSEGQPDDIVTHIDILCSPVKSSNKAIRNPLAHIHDSPNKKSRVSTKRPALETVKLETTE
Sbjct: 1   MSEGQPDDIVTHIDILCSPVKSSNKAIRNPLAHIHDSPNKKSRVSTKRPALETVKLETTE 60

Query: 61  TIGKFVGPGEXXXXXXXXXXXXXVTSXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTMKER 120
           TIGKFVGPGE             VTS                            GTMKER
Sbjct: 61  TIGKFVGPGEPIIKRKRGRPRKIVTSEPPKLKRKRGRPRKEEQHQYKEEDEESEGTMKER 120

Query: 121 SMSPLSAKISSDNILTSAKRTRGIKITVQLXXXXXXXXXXXXXXXXXKXXXXXXXXXXXX 180
           SMSPLSAKISSDNILTSAKRTRGIKITVQL                 K            
Sbjct: 121 SMSPLSAKISSDNILTSAKRTRGIKITVQLSSASEADSSDDDTFTSAKEEVEESTEEEND 180

Query: 181 XXXXXXXXXXIFTEKRKRGRPRKYPIPETXXXXXXXXXXXXXXVISENNSEEKGKSRKPN 240
                     IFTEKRKRGRPRKYPIPET              VISENNSEEKGKSRKPN
Sbjct: 181 GFEENEVKEEIFTEKRKRGRPRKYPIPETPKIKRKRGRPRKEPVISENNSEEKGKSRKPN 240

Query: 241 KKGESSDIESDRESLAMDQTSPLPSKIAPLTEHDFTSPLKQVIMNSLRQYQEDSLLSSKK 300
           KKGESSDIESDRESLAMDQTSPLPSKIAPLTEHDFTSPLKQVIMNSLRQYQEDSLLSSKK
Sbjct: 241 KKGESSDIESDRESLAMDQTSPLPSKIAPLTEHDFTSPLKQVIMNSLRQYQEDSLLSSKK 300

Query: 301 LVLNREFVPTQVPKTDKYEKRLEASENKSSKTFFDTFEGYFDQRSHSLKYTTKLSKNTMS 360
           LVLNREFVPTQVPKTDKYEKRLEASENKSSKTFFDTFEGYFDQRSHSLKYTTKLSKNTMS
Sbjct: 301 LVLNREFVPTQVPKTDKYEKRLEASENKSSKTFFDTFEGYFDQRSHSLKYTTKLSKNTMS 360

Query: 361 MGPSVSKDEFAMFTNVFNKHYLKEPRAKLQALQRKMFPQYWFEITQGFSLLFYGIGSKRN 420
           MGPSVSKDEFAMFTNVFNKHYLKEPRAKLQALQRKMFPQYWFEITQGFSLLFYGIGSKRN
Sbjct: 361 MGPSVSKDEFAMFTNVFNKHYLKEPRAKLQALQRKMFPQYWFEITQGFSLLFYGIGSKRN 420

Query: 421 FLEDLAIKYISPKLTFGKRIALQKELELKKVNKSTGSIQGIPCLIINGYNPTCSYREIFQ 480
           FLEDLAIKYISPKLTFGKRIALQKELELKKVNKSTGSIQGIPCLIINGYNPTCSYREIFQ
Sbjct: 421 FLEDLAIKYISPKLTFGKRIALQKELELKKVNKSTGSIQGIPCLIINGYNPTCSYREIFQ 480

Query: 481 DITDIMFPDGLTRNETKFWGNLAILQVQKMIEFYSTQPKDIKLILVIHNLDGPALRKEIF 540
           DITDIMFPDGLTRNETKFWGNLAILQVQKMIEFYSTQPKDIKLILVIHNLDGPALRKEIF
Sbjct: 481 DITDIMFPDGLTRNETKFWGNLAILQVQKMIEFYSTQPKDIKLILVIHNLDGPALRKEIF 540

Query: 541 QTIFSSLAQIKQIVLIASVDHIYAPVLFDNKKAQNYNFVFHDVTNYESNEVESSFQDKMN 600
           QTIFSSLAQIKQIVLIASVDHIYAPVLFDNKKAQNYNFVFHDVTNYESNEVESSFQDKMN
Sbjct: 541 QTIFSSLAQIKQIVLIASVDHIYAPVLFDNKKAQNYNFVFHDVTNYESNEVESSFQDKMN 600

Query: 601 LGKXXXXXGAEGAKYVLESLTLNAKKMYKXXXXXXXXXXXXAXXXXXXXXXXXXXRGGLS 660
           LGK     GAEGAKYVLESLTLNAKKMYK            A             RGGLS
Sbjct: 601 LGKSSSSSGAEGAKYVLESLTLNAKKMYKLLLDLQLNNMDLASGSKNKSASSVSKRGGLS 660

Query: 661 TGVEFKSFVTMCASEFIASNEISLRTMLTEFIEHKMLLLSRHSSGTEYLYVPYRYSEMEK 720
           TGVEFKSFVTMCASEFIASNEISLRTMLTEFIEHKMLLLSRHSSGTEYLYVPYRYSEMEK
Sbjct: 661 TGVEFKSFVTMCASEFIASNEISLRTMLTEFIEHKMLLLSRHSSGTEYLYVPYRYSEMEK 720

Query: 721 ILSTVLNNIE 730
           ILSTVLNNIE
Sbjct: 721 ILSTVLNNIE 730

>YBR060C (ORC2) [251] chr2 complement(360612..362474) Origin
           recognition complex, 72 kDa subunit, functions in
           pre-replication complex formation, which is essential
           for proper DNA replication initiation [1863 bp, 620 aa]
          Length = 620

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/466 (54%), Positives = 341/466 (73%), Gaps = 20/466 (4%)

Query: 264 PSKIAPLTEHDFTSPLKQVIMNSLRQYQEDSLLSSKKLVLNREFVPTQVPKTDKYEKRLE 323
           PSK +  T HDFTSPLKQ+IMN+L++Y++ +  S  KL L+R F PT VPK  K     +
Sbjct: 175 PSKKSLTTNHDFTSPLKQIIMNNLKEYKDST--SPGKLTLSRNFTPTPVPKNKKL---YQ 229

Query: 324 ASENKSSKTFFDTFEGYFDQRSHSLKYTTKLSKNTMSMGPSVSKDEFAMFTNVFNKHYLK 383
            SE KS+ +F DTFEGYFDQR   +  T   S++TMSM P V+++EF++ +N FN+++ K
Sbjct: 230 TSETKSASSFLDTFEGYFDQRK--IVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQK 287

Query: 384 EPRAKLQALQRKMFPQYWFEITQGFSLLFYGIGSKRNFLEDLAIKYISPKLTFGKRIALQ 443
            PR KL  +Q+KMFPQYWFE+TQGFSLLFYG+GSKRNFLE+ AI Y+SPK+ + + +A +
Sbjct: 288 RPRQKLFEIQKKMFPQYWFELTQGFSLLFYGVGSKRNFLEEFAIDYLSPKIAYSQ-LAYE 346

Query: 444 KELELKKVNKSTGSIQGIPCLIINGYNPTCSYREIFQDITDIMFPDGLTRNETKFWGNLA 503
            EL+  K       +  IPCLI+NGYNP+C+YR++F++ITD++ P  LTR+ETK+WGN  
Sbjct: 347 NELQQNK------PVNSIPCLILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHV 400

Query: 504 ILQVQKMIEFYSTQPKDIKLILVIHNLDGPALRKEIFQTIFSSLAQIKQIVLIASVDHIY 563
           ILQ+QKMI+FY  QP DIKLILV+HNLDGP++RK  FQT+ S L+ I+QI ++AS DHIY
Sbjct: 401 ILQIQKMIDFYKNQPLDIKLILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIY 460

Query: 564 APVLFDNKKAQNYNFVFHDVTNYESNEVESSFQDKMNLGKXXXXXGAEGAKYVLESLTLN 623
           AP+L+DN KAQNYNFVFHD++N+E + VES+FQD M +GK     GAEGAKYVL+SLT+N
Sbjct: 461 APLLWDNMKAQNYNFVFHDISNFEPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVN 520

Query: 624 AKKMYKXXXXXXXXXXXXAXXXXXXXXXXXXXRGGLSTGVEFKSFVTMCASEFIASNEIS 683
           +KKMYK                          RG   TGVE K F  +CA++FIASNEI+
Sbjct: 521 SKKMYK------LLIETQMQNMGNLSANTGPKRGTQRTGVELKLFNHLCAADFIASNEIA 574

Query: 684 LRTMLTEFIEHKMLLLSRHSSGTEYLYVPYRYSEMEKILSTVLNNI 729
           LR+ML EFIEHKM  +++++SG E ++VPY Y+E+EK+L TVLN +
Sbjct: 575 LRSMLREFIEHKMANITKNNSGMEIIWVPYTYAELEKLLKTVLNTL 620

>CAGL0H10230g complement(1000574..1002118) similar to sp|P32833
           Saccharomyces cerevisiae YBR060c RRR1 origin recognition
           complex, hypothetical start
          Length = 514

 Score =  491 bits (1265), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 240/478 (50%), Positives = 335/478 (70%), Gaps = 13/478 (2%)

Query: 244 ESSDIESDRESLAMDQTSPLPSKIAPLTEHDFTSPLKQVIMNSLRQYQEDSLLSSKKLVL 303
           E+ ++ SD E+L   QT     K+    EHDFTSPLK+VIMN+L +Y++  L  + KL L
Sbjct: 43  ETPELTSDEENLVQLQTPRKRRKVNLSKEHDFTSPLKKVIMNNLNEYKKSDL--ADKLKL 100

Query: 304 NREFVPTQVPKTDKYEKRLEASENKSSKTFFDTFEGYFDQRSHSLKYTTKLSKNTMSMGP 363
           +R+FV TQVP+    EK L+A  N++  +F DTFEGYF+Q+  S++   K+SKN+++M P
Sbjct: 101 SRDFVNTQVPRPADVEK-LKA--NRAVTSFTDTFEGYFEQK-RSVR-GVKVSKNSITMAP 155

Query: 364 SVSKDEFAMFTNVFNKHYLKEPRAKLQALQRKMFPQYWFEITQGFSLLFYGIGSKRNFLE 423
            V+++EF + +N+F+++  K  R  L  +Q+K++PQYWFE+ QGFSLLFYGIGSK+ FLE
Sbjct: 156 HVTREEFGLISNIFHRNLHKNLRDHLYIIQKKLYPQYWFEVIQGFSLLFYGIGSKKVFLE 215

Query: 424 DLAIKYISPKLTFGKRIALQKELELKKVNKSTGSIQGIPCLIINGYNPTCSYREIFQDIT 483
           D   KY+SPKL      AL + +E+   N      +GIP +++NGYNPTC+YR++F+DI 
Sbjct: 216 DFVFKYLSPKL------ALSQAIEVPTYNGKKSKFEGIPVVVVNGYNPTCNYRDVFKDIL 269

Query: 484 DIMFPDGLTRNETKFWGNLAILQVQKMIEFYSTQPKDIKLILVIHNLDGPALRKEIFQTI 543
            ++ P  LT++E+KFWGN  I+ +QK+I++Y  +P DIKLI+ IHN+DGP +R+    TI
Sbjct: 270 SLLTPAELTQSESKFWGNHVIMNIQKLIDYYKDKPLDIKLIVAIHNIDGPNIRRGDSPTI 329

Query: 544 FSSLAQIKQIVLIASVDHIYAPVLFDNKKAQNYNFVFHDVTNYESNEVESSFQDKMNLGK 603
            S L+ I+Q+ ++AS DHIYAP L+DN +AQNYNFVFHDVTNY   E ESSFQD M LGK
Sbjct: 330 LSFLSLIRQVAIVASADHIYAPFLWDNLRAQNYNFVFHDVTNYAPYEAESSFQDVMRLGK 389

Query: 604 XXXXXGAEGAKYVLESLTLNAKKMYKXXXXXXXXXXXXAXXXXXXXXXXXXXRGGLSTGV 663
                GAEGAKYVL+SLTLN+KKMYK                          RG +S GV
Sbjct: 390 SENSTGAEGAKYVLQSLTLNSKKMYKLLIETQLQHMEKVSTTKSTGKVAASKRGTMSMGV 449

Query: 664 EFKSFVTMCASEFIASNEISLRTMLTEFIEHKMLLLSRHSSGTEYLYVPYRYSEMEKI 721
           EFK  V +CA++FIASNE++LR+MLTEFIEHKM  +S+++ GTE+++VPY Y+EM+++
Sbjct: 450 EFKQLVHLCAADFIASNEMALRSMLTEFIEHKMASVSKNTVGTEFVWVPYTYAEMKRL 507

>Kwal_27.10941
          Length = 595

 Score =  436 bits (1122), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 215/457 (47%), Positives = 297/457 (64%), Gaps = 20/457 (4%)

Query: 271 TEHDFTSPLKQVIMNSLRQYQEDSLLSSKKLVLNREFVPTQVPKTDKYEKRLEASENKSS 330
           + H F+SP K      L+Q       S  K+ L+R FVPT +P    Y+   E    K  
Sbjct: 158 SSHVFSSPAKSPSKPVLKQ-------SPFKIQLDRHFVPTPIPHEGDYKPPQE----KHL 206

Query: 331 KTFFDTFEGYFDQRSHSLKYTTKLSKNTMSMGPSVSKDEFAMFTNVFNKHYLKEPRAKLQ 390
             FFD FEGY DQ+   L+   K S NTM+M P V+++EF++ +N       K  +  L 
Sbjct: 207 TYFFDGFEGYIDQKK-PLRAHQK-STNTMAMAPQVTREEFSLLSNTLIDSLHKPAKEALL 264

Query: 391 ALQRKMFPQYWFEITQGFSLLFYGIGSKRNFLEDLAIKYISPKLTFGKRIALQKELELKK 450
            +QRKMFPQYWFE+ QGFSLLFYG+GSKR+FLE+  ++Y+SP+L     +      + + 
Sbjct: 265 EVQRKMFPQYWFELAQGFSLLFYGVGSKRSFLEEFVLQYLSPQLALSDALNFGTAEDSEA 324

Query: 451 VNKSTGSIQGIPCLIINGYNPTCSYREIFQDITDIMFPDGLTRNETKFWGNLAILQVQKM 510
           +++ +  I G+PC++INGYNPTC+YR+ F  I+ IM  + L+++ETK+WGN   LQ+ KM
Sbjct: 325 IDEES-EIDGVPCVVINGYNPTCNYRDAFHSISQIMMQEELSKSETKYWGNHVELQINKM 383

Query: 511 IEFYSTQPKDIKLILVIHNLDGPALRKEIFQTIFSSLAQIKQIVLIASVDHIYAPVLFDN 570
           IE Y   P  IKLI+++HNLDGP +RK+ FQ + SSL++++QI LIAS D++YAP+L+D+
Sbjct: 384 IEVYRDSPPLIKLIVLVHNLDGPMVRKDPFQNMLSSLSRVRQIALIASTDNLYAPLLWDH 443

Query: 571 KKAQNYNFVFHDVTNYESNEVESSFQDKMNLGKXXXXXGAEGAKYVLESLTLNAKKMYKX 630
            +AQN+NF+FHD+TNY+S  VESSF D M LG+     GAEGA+YVLESLT N+K+MYK 
Sbjct: 444 VRAQNFNFIFHDITNYQSYAVESSFSDIMQLGRSAGTTGAEGARYVLESLTSNSKRMYKL 503

Query: 631 XXXXXXXXXXXAXXXXXXXXXXXXXRGGLSTGVEFKSFVTMCASEFIASNEISLRTMLTE 690
                                    RG  + G+EFK F  MCA++FIASNE+SLR+ML E
Sbjct: 504 LIETQL------SNMDSQGKAVANKRGSHAFGIEFKQFYHMCAADFIASNEVSLRSMLGE 557

Query: 691 FIEHKMLLLSRHSSGTEYLYVPYRYSEMEKILSTVLN 727
           FIEHKM  +SR  +G E LY+PY +SEM+ +L  VL+
Sbjct: 558 FIEHKMAAMSRDRTGAETLYIPYVHSEMQALLRDVLD 594

>AGR028C [4338] [Homologous to ScYBR060C (ORC2) - SH]
           (766480..768219) [1740 bp, 579 aa]
          Length = 579

 Score =  402 bits (1034), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 214/544 (39%), Positives = 317/544 (58%), Gaps = 45/544 (8%)

Query: 195 KRKRGRPRKYPIPETXXXXXXXXXXXXXXVISENNSEEKGKSRKPN--KKGESSDIESD- 251
           +R R  PR+    ++                 E +   K   R P    K  +  +E+D 
Sbjct: 72  RRGRASPRRGGAVDSSVDEGATAVPSSRDAAKEESPRRKQPVRVPQTPAKLAAPALEADD 131

Query: 252 RESLAMDQTSPLPSKIAPLTEHDFTSPLKQVIMNSLRQYQEDSLLSS-KKLVLNREFVPT 310
            +     +++PL S   P  +  F+SP K    +  +  ++D LL+      L+  FVP 
Sbjct: 132 SDGFVTARSTPLRS---PRRQLTFSSPSK----SPRKTRKQDVLLAQVPSFKLDPGFVPA 184

Query: 311 QVPKTDKYEKRLEASENKSSKTFFDTFEGYFDQ----RSHSLKYTTKLSKNTMSMGPSVS 366
            VPK  +        E+++   FFD FEGY DQ    R+H      K S+N+M++ PSVS
Sbjct: 185 AVPKGYRLP------EDRNLTYFFDGFEGYIDQKKPIRAH------KKSRNSMAIAPSVS 232

Query: 367 KDEFAMFTNVFNKHYLKEPRAKLQALQRKMFPQYWFEITQGFSLLFYGIGSKRNFLEDLA 426
           +DEF + +   N    + PRA L   Q+++FPQYWFE+ QGF+LLFYGIGSKR FLE L 
Sbjct: 233 RDEFRLLSGALNGFMHQTPRAVLTGHQQRLFPQYWFEVMQGFTLLFYGIGSKRRFLETLV 292

Query: 427 IKYISPKLTFGKRIALQKELELKKVNKSTGSIQGIPCLIINGYNPTCSYREIFQDITDIM 486
            +Y+SPKL      AL    E          ++G+PC++ING+NP C+YR+ FQ I   M
Sbjct: 293 FEYLSPKL------ALSGAPE-------GADVEGVPCVVINGFNPACNYRDCFQSIAAYM 339

Query: 487 FPDGLTRNETKFWGNLAILQVQKMIEFYSTQPKDIKLILVIHNLDGPALRKEIFQTIFSS 546
            PD L   ETK+W N   LQ+QKM+E ++ QP  +++++++HNLDGP LRK+ FQ + SS
Sbjct: 340 LPDELRHAETKYWHNHVHLQIQKMVEHWAAQPPQVQMVVLVHNLDGPMLRKDPFQQMLSS 399

Query: 547 LAQIKQIVLIASVDHIYAPVLFDNKKAQNYNFVFHDVTNYESNEVESSFQDKMNLGKXXX 606
           LA+I+QI ++ASVDHI+AP+L+ + +AQ YNFVFHDVTNYE   +E++FQ+ + L +   
Sbjct: 400 LARIRQIAIVASVDHIHAPLLWYSLRAQLYNFVFHDVTNYEPYAIEAAFQESVRLNRSEL 459

Query: 607 XXGA-EGAKYVLESLTLNAKKMYKXXXXXXXXXXXXAXXXXXXXXXXXXXRGGLSTGVEF 665
             G+ + A+YVL SLT N+K++++            A             R G+S GV F
Sbjct: 460 QAGSIDAARYVLASLTANSKRLFRLLLETVVANMQSA----KRIKLTNSRRAGISFGVPF 515

Query: 666 KSFVTMCASEFIASNEISLRTMLTEFIEHKMLLLSRHSSGTEYLYVPYRYSEMEKILSTV 725
            +F   CA++F+ASNE+SLR+ML EF+EHKM  L++  +G E +YV Y + EM+K+LS  
Sbjct: 516 SAFYQACAAQFVASNEMSLRSMLREFVEHKMAHLAKDKAGQEIVYVNYSFGEMQKLLSDA 575

Query: 726 LNNI 729
           L+++
Sbjct: 576 LSSV 579

>KLLA0F18590g 1709034..1710824 similar to sp|P32833 Saccharomyces
           cerevisiae YBR060c RRR1 origin recognition complex, 72
           kDa subunit singleton, start by similarity
          Length = 596

 Score =  291 bits (746), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 166/431 (38%), Positives = 254/431 (58%), Gaps = 27/431 (6%)

Query: 300 KLVLNREFVPTQVPKTDKYEKRLEASENKSSKTFFDTFEGYFDQRSHSLKYTTKLSKNTM 359
           KL LN  F PT++PK+D  +   + S+ +S   FFD FEG+ DQ +  LK T K SKN+M
Sbjct: 183 KLNLNPNFKPTKLPKSDNND---QTSDEQSQIYFFDGFEGFIDQ-TKILK-TDKRSKNSM 237

Query: 360 SMGPSVSKDEFAMFTNVFNKHYLKEPRAKLQALQRKMFPQYWFEITQGFSLLFYGIGSKR 419
           S  PS+S+DE+ + + + N  + +     +Q +   +F Q+ FE+ QGF+LLFYGIGSK+
Sbjct: 238 SSAPSISRDEYNILSQLSNDIFHRSSTKAVQKIHETLFQQFTFELLQGFTLLFYGIGSKK 297

Query: 420 NFLEDLAIKYISPKLTFGKRIALQKELELKKVNKSTGSIQGIPCLIINGYNPTCSYREIF 479
            FLE  A  ++S K+   +   +QK+               IP  ++NGY  T   + IF
Sbjct: 298 KFLESFAFNFLSMKIALLQNPDIQKDDPC------------IPVFVMNGY--TTLSKNIF 343

Query: 480 QDITDIMFPDGLT---RNETKFWGNLAILQVQKMIEFYSTQPKDIKLILVIHNLDGPALR 536
            DI  I+  +G T   + ++ +W N   LQ+ ++ +++  +P  +K+IL+IHNLDGP+ R
Sbjct: 344 LDIFKILV-EGETIDDQGQSNYWDNRIDLQMDRLSKYFKKRPPTVKMILLIHNLDGPSFR 402

Query: 537 KEIFQTIFSSLAQIKQIVLIASVDHIYAPVLFDNKKAQNYNFVFHDVTNYESNEVESSFQ 596
           +E FQT  S LAQIKQI ++ASVDHI AP L+D+ +AQ++NFV+HD+TN+E   VE+   
Sbjct: 403 REHFQTRMSILAQIKQICVVASVDHIQAPFLWDHFRAQSFNFVYHDITNFEPYIVETVQT 462

Query: 597 DK-MNLGKXX-XXXGAEGAKYVLESLTLNAKKMYKXXXXXXXXXXXXAXXXXXXXXXXXX 654
           D  ++  K       A GAKYVLESLT N+K+MYK                         
Sbjct: 463 DNAIDFSKDSGTLFNANGAKYVLESLTDNSKRMYKILLQLLMGQINAKNESKPRAKSSSL 522

Query: 655 XRGGLSTGVEFKSFVTMCASEFIASNEISLRTMLTEFIEHKMLLLSRHSSGTEYLYVPYR 714
            +  ++ G+EF      C  +F+ S+E+ LRT+L+EFI+HKM + +++  G E + V Y 
Sbjct: 523 NK--ITPGIEFSELFKTCTEQFVVSSEMGLRTILSEFIDHKMAVNTKNKMGKEIINVKYS 580

Query: 715 YSEMEKILSTV 725
           Y +MEK+++ +
Sbjct: 581 YGDMEKMITEI 591

>AFL147C [3048] [Homologous to ScYMR185W - SH] (158619..161435)
           [2817 bp, 938 aa]
          Length = 938

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 539 IFQTIFSSLAQIKQIVLIASVDHIYAPVLFDNKKAQNYNFVFHDVTNYESNEVESSFQDK 598
           +F+ I++ LA + + VLI+ ++ +     + NK+   Y+F+F  V     N    +F +K
Sbjct: 299 LFKQIYTCLADVNRPVLISCLNSVLVGFYYKNKRIV-YDFLFQRVARILFNVGSEAFSEK 357

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.131    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,032,464
Number of extensions: 748772
Number of successful extensions: 2840
Number of sequences better than 10.0: 19
Number of HSP's gapped: 2911
Number of HSP's successfully gapped: 19
Length of query: 730
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 621
Effective length of database: 12,822,747
Effective search space: 7962925887
Effective search space used: 7962925887
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)