Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_718.4630930916520.0
YBR061C (TRM7)31031013810.0
CAGL0H10252g30931212641e-177
Sklu_2357.331531112291e-171
KLLA0F18414g30130912231e-171
Kwal_27.1054330330911931e-166
AGR036W30631511011e-152
Scas_642.128392094117e-45
Kwal_33.130548302394012e-43
AFR734C8452103951e-42
CAGL0B00484g8372093932e-42
YCL054W (SPB1)8412093905e-42
Sklu_2421.108492093801e-40
KLLA0C00737g8332093764e-40
KLLA0B01980g2892512254e-21
CAGL0H08954g2812431893e-16
Scas_720.46321961808e-15
Kwal_56.241583071111729e-14
Sklu_2160.23151091674e-13
AFL117C3031011648e-13
YGL136C (MRM2)320981523e-11
KLLA0A02541g53162730.38
CAGL0L05258g13860700.38
ADL043C67353720.46
Kwal_56.2317143862720.49
CAGL0D06600g72553681.6
Kwal_47.1734569952681.6
KLLA0C11231g43862671.8
CAGL0L06754g43868644.0
Scas_633.343768635.5
CAGL0M07095g44385627.9
YDR311W (TFB1)64287628.6
CAGL0F02959g63585629.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_718.46
         (309 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_718.46                                                           640   0.0  
YBR061C (TRM7) [252] chr2 complement(364747..365679) Methyltrans...   536   0.0  
CAGL0H10252g complement(1002563..1003492) highly similar to sp|P...   491   e-177
Sklu_2357.3 YBR061C, Contig c2357 3590-4537 reverse complement        478   e-171
KLLA0F18414g complement(1695869..1696774) similar to sp|P38238 S...   475   e-171
Kwal_27.10543                                                         464   e-166
AGR036W [4346] [Homologous to ScYBR061C - SH] complement(774279....   428   e-152
Scas_642.12                                                           162   7e-45
Kwal_33.13054                                                         159   2e-43
AFR734C [3927] [Homologous to ScYCL054W (SPB1) - SH] (1785487..1...   156   1e-42
CAGL0B00484g 35991..38504 highly similar to sp|P25582 Saccharomy...   155   2e-42
YCL054W (SPB1) [493] chr3 (31449..33974) Putative S-adenosyl-met...   154   5e-42
Sklu_2421.10 YCL054W, Contig c2421 13526-16075 reverse complement     150   1e-40
KLLA0C00737g 53188..55689 similar to sp|P25582 Saccharomyces cer...   149   4e-40
KLLA0B01980g complement(173710..174579) similar to sp|P53123 Sac...    91   4e-21
CAGL0H08954g complement(875104..875949) similar to sp|P53123 Sac...    77   3e-16
Scas_720.46                                                            74   8e-15
Kwal_56.24158                                                          71   9e-14
Sklu_2160.2 YGL136C, Contig c2160 1404-2351                            69   4e-13
AFL117C [3078] [Homologous to ScYGL136C (MRM2) - SH] (218993..21...    68   8e-13
YGL136C (MRM2) [1851] chr7 complement(252900..253862) Methyltran...    63   3e-11
KLLA0A02541g 223318..224913 some similarities with sp|P53226 Sac...    33   0.38 
CAGL0L05258g complement(585873..586289) similar to sp|P36077 Sac...    32   0.38 
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    32   0.46 
Kwal_56.23171                                                          32   0.49 
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    31   1.6  
Kwal_47.17345                                                          31   1.6  
KLLA0C11231g 965524..966840 highly similar to sp|P12385 Saccharo...    30   1.8  
CAGL0L06754g 759181..760497 highly similar to sp|P12385 Saccharo...    29   4.0  
Scas_633.3                                                             29   5.5  
CAGL0M07095g 720613..721944 highly similar to sp|P29704 Saccharo...    28   7.9  
YDR311W (TFB1) [1139] chr4 (1085058..1086986) Component of RNA p...    28   8.6  
CAGL0F02959g 286337..288244 similar to sp|Q04049 Saccharomyces c...    28   9.2  

>Scas_718.46
          Length = 309

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/309 (100%), Positives = 309/309 (100%)

Query: 1   MGKNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQV 60
           MGKNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQV
Sbjct: 1   MGKNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQV 60

Query: 61  LSQKLFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKADF 120
           LSQKLFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKADF
Sbjct: 61  LSQKLFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKADF 120

Query: 121 VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGY 180
           VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGY
Sbjct: 121 VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGY 180

Query: 181 LFDKVVCAKPKSSRGTSLEAFIVCIGYNPPSDWVSTLDVNSSVEEFFSGCHMSKLSIHDK 240
           LFDKVVCAKPKSSRGTSLEAFIVCIGYNPPSDWVSTLDVNSSVEEFFSGCHMSKLSIHDK
Sbjct: 181 LFDKVVCAKPKSSRGTSLEAFIVCIGYNPPSDWVSTLDVNSSVEEFFSGCHMSKLSIHDK 240

Query: 241 LPSWQEDERTIAKFMSCGNLESFDSDATYHLDDFKEDLNTSLDPVQSPTNPPYKKALELK 300
           LPSWQEDERTIAKFMSCGNLESFDSDATYHLDDFKEDLNTSLDPVQSPTNPPYKKALELK
Sbjct: 241 LPSWQEDERTIAKFMSCGNLESFDSDATYHLDDFKEDLNTSLDPVQSPTNPPYKKALELK 300

Query: 301 RSGKLTRAV 309
           RSGKLTRAV
Sbjct: 301 RSGKLTRAV 309

>YBR061C (TRM7) [252] chr2 complement(364747..365679)
           Methyltransferase that methylates 2-prime-O-riboses in
           tRNA anticodon loop, required for optimal protein
           synthesis activity, member of the 2-prime-O-RNA
           methyltransferase family which includes Spb1p, Mrm2p,
           and E. coli FtsJ protein [933 bp, 310 aa]
          Length = 310

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/310 (82%), Positives = 281/310 (90%), Gaps = 1/310 (0%)

Query: 1   MGKNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQV 60
           MGK+SKDKRD+YYRKAKEQG+RARSAFKLLQLND FHFLDDPNLKRVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQV 60

Query: 61  LSQKLFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKADF 120
           LS+KLFD   + + +DRKIV+VDLQPMSPI HVTTLQADITHPKTL RIL LFGNEKADF
Sbjct: 61  LSRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADF 120

Query: 121 VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGY 180
           VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGG FVAKIFRGRDIDMLYSQLGY
Sbjct: 121 VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGY 180

Query: 181 LFDKVVCAKPKSSRGTSLEAFIVCIGYNPPSDWVSTLDVNSSVEEFFSGCHMSKLSIHDK 240
           LFDK+VCAKP+SSRGTSLEAFIVC+GYNPPS+W   LDVN+SV+EFF GC ++KL I DK
Sbjct: 181 LFDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLNKLCISDK 240

Query: 241 LPSWQEDERTIAKFMSCGNLESFDSDATYH-LDDFKEDLNTSLDPVQSPTNPPYKKALEL 299
           L  W E+ER IA+FM+CG+L+SFDSDATYH L       ++SLDPVQSPTNPPYKKALEL
Sbjct: 241 LSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYKKALEL 300

Query: 300 KRSGKLTRAV 309
           KRSGKLTR+V
Sbjct: 301 KRSGKLTRSV 310

>CAGL0H10252g complement(1002563..1003492) highly similar to
           sp|P38238 Saccharomyces cerevisiae YBR061c, start by
           similarity
          Length = 309

 Score =  491 bits (1264), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 234/312 (75%), Positives = 270/312 (86%), Gaps = 6/312 (1%)

Query: 1   MGKNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQV 60
           MGK+SKDKRD+YYRKAKE+G+RARSA+KLLQLN++FHFLDDP LKRVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQV 60

Query: 61  LSQKLFDGKTA---EEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEK 117
           LS+KLF  +      +  DRKI+AVDLQPMSPI+HV TLQADITHP+TL+RI +LFGN+K
Sbjct: 61  LSRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQK 120

Query: 118 ADFVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQ 177
           ADFVCSDGAPDVTGLHDLDEY+Q QLIMSALQLT C+LK+GG FVAKIFRGRDIDMLYSQ
Sbjct: 121 ADFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQ 180

Query: 178 LGYLFDKVVCAKPKSSRGTSLEAFIVCIGYNPPSDWVSTLDVNSSVEEFFSGCHMSKLSI 237
           LGYLF+K+VCAKP+SSRGTSLEAFIVCIGYNPP+ W   LDVNSSV EFF+ C + KLSI
Sbjct: 181 LGYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKLDVNSSVTEFFATCDLGKLSI 240

Query: 238 HDKLPSWQEDERTIAKFMSCGNLESFDSDATYHLDDFKEDLNTSLDPVQSPTNPPYKKAL 297
            D L  W++  R+IA FM+CG+L S+DSDATYH  D  +    +LDPVQ+PTNPPYK+AL
Sbjct: 241 DDTLQPWKDQPRSIADFMACGSLSSYDSDATYH--DLPK-YGVALDPVQAPTNPPYKRAL 297

Query: 298 ELKRSGKLTRAV 309
           ELKR GKLTR +
Sbjct: 298 ELKRDGKLTRNI 309

>Sklu_2357.3 YBR061C, Contig c2357 3590-4537 reverse complement
          Length = 315

 Score =  478 bits (1229), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 229/311 (73%), Positives = 268/311 (86%), Gaps = 4/311 (1%)

Query: 1   MGKNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQV 60
           MGK+SKDKRD+YYRKAKEQG+RARSAFKLLQLND FHFLD  N+ RVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHFHFLD--NVTRVVDLCAAPGSWSQV 58

Query: 61  LSQKLFDGKTAEEIK-DRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKAD 119
           LS+KLFD +   E K  +KIVAVDLQPMSPI+HVTTLQADITHP TL +IL+LFG +KAD
Sbjct: 59  LSRKLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKAD 118

Query: 120 FVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLG 179
           FVCSDGAPDVTGLHDLDEYVQQQLI+SALQLT C+LK+GG FVAKIFRGRD+DMLYSQLG
Sbjct: 119 FVCSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLG 178

Query: 180 YLFDKVVCAKPKSSRGTSLEAFIVCIGYNPPSDWVSTLDVNSSVEEFFSGCHMSKLSIHD 239
           YLF++VVCAKP+SSRG+SLE+FIVC+GY PP +W   LDVN S+E+FF GC + +L++ D
Sbjct: 179 YLFERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHLDVNQSIEDFFRGCDLGRLTLQD 238

Query: 240 KLPSWQEDERTIAKFMSCGNLESFDSDATYH-LDDFKEDLNTSLDPVQSPTNPPYKKALE 298
            L  + ++ R IA+F+SCG L+SFDSDATYH ++       ++LDPVQ+PTNPPYKKALE
Sbjct: 239 NLVEFYDEPRNIAEFVSCGGLDSFDSDATYHNVEGSDVTSKSALDPVQAPTNPPYKKALE 298

Query: 299 LKRSGKLTRAV 309
           LKRSGKL RA 
Sbjct: 299 LKRSGKLARAA 309

>KLLA0F18414g complement(1695869..1696774) similar to sp|P38238
           Saccharomyces cerevisiae YBR061c, start by similarity
          Length = 301

 Score =  475 bits (1223), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 228/309 (73%), Positives = 266/309 (86%), Gaps = 8/309 (2%)

Query: 1   MGKNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQV 60
           MGK+SKDKRD+YYRKAKEQG+RARSAFKLLQL+DDFHFL      RVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLDDDFHFLQ--QAVRVVDLCAAPGSWSQV 58

Query: 61  LSQKLFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKADF 120
           LS++LF    + +  DRKIVAVDLQPMSPI++V TLQADITHPKTL+ I +LF  +KADF
Sbjct: 59  LSRRLF--PQSSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKKADF 116

Query: 121 VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGY 180
           +CSDGAPDVTGLHDLDEYVQQQLI+SALQL+ C+L+KGG FVAKIFRGRDIDMLYSQLGY
Sbjct: 117 ICSDGAPDVTGLHDLDEYVQQQLILSALQLSTCLLRKGGNFVAKIFRGRDIDMLYSQLGY 176

Query: 181 LFDKVVCAKPKSSRGTSLEAFIVCIGYNPPSDWVSTLDVNSSVEEFFSGCHMSKLSIHDK 240
           LF+KV+CAKP+SSRGTSLE+FIVC+GYNPP++W   LDVNSSVE+FF GC + KL + DK
Sbjct: 177 LFEKVICAKPRSSRGTSLESFIVCLGYNPPANWEPKLDVNSSVEDFFQGCDIGKLRLEDK 236

Query: 241 LPSWQEDERTIAKFMSCGNLESFDSDATYHLDDFKEDLNTSLDPVQSPTNPPYKKALELK 300
            P++ E+ R+IA F++CG L SFDSDATYH+D        +LDPVQSPTNPPYKKALELK
Sbjct: 237 CPNYHEEPRSIATFIACGGLSSFDSDATYHVDTS----TPALDPVQSPTNPPYKKALELK 292

Query: 301 RSGKLTRAV 309
           R GK+TRA+
Sbjct: 293 RRGKMTRAI 301

>Kwal_27.10543
          Length = 303

 Score =  464 bits (1193), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 222/309 (71%), Positives = 265/309 (85%), Gaps = 6/309 (1%)

Query: 1   MGKNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQV 60
           MGK+SKDKRD+YYRKAKE+G+RARSAFKLLQL++ FHFLD  N+ RVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFLD--NVTRVVDLCAAPGSWSQV 58

Query: 61  LSQKLFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKADF 120
           LS++LF+ K  E    ++IV+VDLQPM PI +VTT+QADITHPKTL +I+DLF  EKADF
Sbjct: 59  LSRRLFE-KDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADF 117

Query: 121 VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGY 180
           VCSDGAPDVTGLHDLDEYVQQQLI+SALQLT C+L++GG+FVAKIFRGRDIDMLYSQL +
Sbjct: 118 VCSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSF 177

Query: 181 LFDKVVCAKPKSSRGTSLEAFIVCIGYNPPSDWVSTLDVNSSVEEFFSGCHMSKLSIHDK 240
           LF++VVCAKP+SSRGTSLE+FIVC+GY PP +W   LDVN SVE+FF GC + +LS+ DK
Sbjct: 178 LFERVVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHLDVNMSVEDFFQGCDIGRLSLDDK 237

Query: 241 LPSWQEDERTIAKFMSCGNLESFDSDATYHLDDFKEDLNTSLDPVQSPTNPPYKKALELK 300
           LP +    R++A+F+SCG L+SFDSDATYH  D   D   +L+PVQ PTNPPYK+ALELK
Sbjct: 238 LPDYHVQPRSVAEFISCGGLDSFDSDATYH--DVPVD-RVTLNPVQPPTNPPYKRALELK 294

Query: 301 RSGKLTRAV 309
           R GKLT+AV
Sbjct: 295 RKGKLTKAV 303

>AGR036W [4346] [Homologous to ScYBR061C - SH]
           complement(774279..775199) [921 bp, 306 aa]
          Length = 306

 Score =  428 bits (1101), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 224/315 (71%), Positives = 254/315 (80%), Gaps = 15/315 (4%)

Query: 1   MGKNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQV 60
           MGK+SKDKRD+YYRKAKEQGFRARSAFKLLQLND+FHFLD   ++RVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEFHFLD--GVQRVVDLCAAPGSWSQV 58

Query: 61  LSQKLF-DGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKAD 119
           LS++LF DGK  +    ++IVAVDLQPMS I HVTTLQADITHP+TL +I++LF  EKAD
Sbjct: 59  LSRELFPDGKNTK----KRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKAD 114

Query: 120 FVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLG 179
           FVCSDGAPDVTGLHDLDEYVQQQLI+SAL+LT  +L  GG FVAKIFRGRDIDMLYSQLG
Sbjct: 115 FVCSDGAPDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLG 174

Query: 180 YLFDKVVCAKPKSSRGTSLEAFIVCIGYNPPSDWVSTLDVNSSVEEFFSGCHMS-----K 234
            LFDKV CAKP+SSRGTSLE+FIVC GY PP  W   ++ N SVEEFF     +      
Sbjct: 175 LLFDKVTCAKPRSSRGTSLESFIVCQGYTPPLSWAPNIEKNVSVEEFFEEFFQNWSIQQP 234

Query: 235 LSIHDKLPSWQEDERTIAKFMSCGNLESFDSDATYHLDDFKEDLNTSLDPVQSPTNPPYK 294
           L+    LP + E  R IA F+SCG L+SFDSDATYH  D  +   T+LDPVQSPTNPPYK
Sbjct: 235 LTPGRPLPMYSEGHRGIAPFISCGGLDSFDSDATYH--DLPKS-ATALDPVQSPTNPPYK 291

Query: 295 KALELKRSGKLTRAV 309
           +ALELKRSGKL R+V
Sbjct: 292 RALELKRSGKLGRSV 306

>Scas_642.12
          Length = 839

 Score =  162 bits (411), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 122/209 (58%), Gaps = 11/209 (5%)

Query: 3   KNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDF-HFLDDPNLKRVVDLCAAPGSWSQVL 61
           KNSK + D YY  AKE+G+RARS+FK++Q+N+ F HFL+   +  V+DLCAAPGSW QV 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKSKV--VIDLCAAPGSWCQVA 64

Query: 62  SQKLFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKADFV 121
           S KL    +        I+ VD+ PM P+N+  T Q+DIT      ++       KAD V
Sbjct: 65  S-KLCPVNSL-------IIGVDIVPMKPMNNCITFQSDITTEDCRSKLRGYMKTWKADTV 116

Query: 122 CSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGYL 181
             DGAP+V      D + Q QL + AL+L A  L  GG FV K+FR +D + L      L
Sbjct: 117 LHDGAPNVGLGWVQDAFTQSQLTLQALKLAAENLVVGGTFVTKVFRSKDYNKLIWVFQQL 176

Query: 182 FDKVVCAKPKSSRGTSLEAFIVCIGYNPP 210
           FDKV   KP +SR  S E F+VC G+  P
Sbjct: 177 FDKVEATKPPASRNVSAEIFVVCKGFKAP 205

>Kwal_33.13054
          Length = 830

 Score =  159 bits (401), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 95/239 (39%), Positives = 127/239 (53%), Gaps = 12/239 (5%)

Query: 3   KNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDF-HFLDDPNLKRVVDLCAAPGSWSQVL 61
           KNSK + D YY  AKE+G+RARS+FK++Q+N+ F HF++   +  V+DLCAAPGSW QV 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFMEKSKV--VIDLCAAPGSWCQVA 64

Query: 62  SQKLFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKADFV 121
           S                I+ VD+ PM P+ +V T Q+DIT      ++       KAD V
Sbjct: 65  SNLCPVNSL--------IIGVDIVPMKPMPNVITFQSDITTEDCRSKLRGYMKTWKADTV 116

Query: 122 CSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGYL 181
             DGAP+V      D + Q  L + AL+L    L  GG FV KIFR +D + L      L
Sbjct: 117 LHDGAPNVGLGWAQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLIWVFSQL 176

Query: 182 FDKVVCAKPKSSRGTSLEAFIVCIGYNPPSDW-VSTLDVNSSVEEFFSGCHMSKLSIHD 239
           FDKV   KP +SR  S E F+VC G+  P       LD     EE   G   ++  I++
Sbjct: 177 FDKVEATKPPASRNVSAEIFVVCKGFKAPKKLDPRLLDAKEVFEELPDGPQNNEAKIYN 235

>AFR734C [3927] [Homologous to ScYCL054W (SPB1) - SH]
           (1785487..1788024) [2538 bp, 845 aa]
          Length = 845

 Score =  156 bits (395), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 92/210 (43%), Positives = 121/210 (57%), Gaps = 13/210 (6%)

Query: 3   KNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDF-HFLDDPNLKRVVDLCAAPGSWSQVL 61
           KNSK + D YY  AKE+G+RARS+FK++Q+N+ F HFL+   +  V+DLCAAPGSW QV 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKSKV--VIDLCAAPGSWCQVA 64

Query: 62  SQKLFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKADFV 121
           S                I+ VD+ PM P+ +V T Q+DIT      ++       KAD V
Sbjct: 65  SNLCPVNSL--------IIGVDIVPMQPMPNVITFQSDITTEDCRSKLRGYMKTWKADTV 116

Query: 122 CSDGAPDVTGLHDL-DEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGY 180
             DGAP+V GL+ + D + Q  L + AL+L    L  GG FV KIFR +D + L      
Sbjct: 117 LHDGAPNV-GLNWVQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLMWVFQQ 175

Query: 181 LFDKVVCAKPKSSRGTSLEAFIVCIGYNPP 210
           LFDKV   KP +SR  S E F+VC G+  P
Sbjct: 176 LFDKVEATKPPASRNVSAEIFVVCKGFKAP 205

>CAGL0B00484g 35991..38504 highly similar to sp|P25582 Saccharomyces
           cerevisiae YCL054w SPB1, start by similarity
          Length = 837

 Score =  155 bits (393), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 119/209 (56%), Gaps = 11/209 (5%)

Query: 3   KNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDF-HFLDDPNLKRVVDLCAAPGSWSQVL 61
           KNSK + D YY  AKE+G+RARS+FK++Q+N+ F HFL+    K V+DLCAAPGSW QV 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKS--KVVIDLCAAPGSWCQVA 64

Query: 62  SQKLFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKADFV 121
           S KL    +        I+ VD+ PM P+ +V T Q+DIT      R+       KAD V
Sbjct: 65  S-KLCPVNSL-------IIGVDIVPMKPMPNVITFQSDITTEDCRSRLRGYMKTWKADTV 116

Query: 122 CSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGYL 181
             DGAP+V      D + Q  L + AL+L    L   G FV KIFR +D + L      L
Sbjct: 117 LHDGAPNVGLGWAQDAFTQSHLTLQALKLAVENLVVNGTFVTKIFRSKDYNKLIWVFQQL 176

Query: 182 FDKVVCAKPKSSRGTSLEAFIVCIGYNPP 210
           F+KV   KP +SR  S E F+VC G+  P
Sbjct: 177 FEKVEATKPPASRNVSAEIFVVCKGFKAP 205

>YCL054W (SPB1) [493] chr3 (31449..33974) Putative
           S-adenosyl-methionine-dependent methyltransferase
           required for synthesis of the 60S ribosomal subunit,
           member of the 2-prime-O-RNA methyltransferase family,
           which includes Trm7p, Mrm2p, and E. coli FtsJ protein
           [2526 bp, 841 aa]
          Length = 841

 Score =  154 bits (390), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 120/209 (57%), Gaps = 11/209 (5%)

Query: 3   KNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDF-HFLDDPNLKRVVDLCAAPGSWSQVL 61
           KNSK + D YY  AKE+G+RARS+FK++Q+N+ + HFL+   +  V+DLCAAPGSW QV 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKYGHFLEKSKV--VIDLCAAPGSWCQVA 64

Query: 62  SQKLFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKADFV 121
           S KL    +        I+ VD+ PM P+ +V T Q+DIT      ++       KAD V
Sbjct: 65  S-KLCPVNSL-------IIGVDIVPMKPMPNVITFQSDITTEDCRSKLRGYMKTWKADTV 116

Query: 122 CSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGYL 181
             DGAP+V      D + Q QL + AL+L    L   G FV KIFR +D + L      L
Sbjct: 117 LHDGAPNVGLGWVQDAFTQSQLTLQALKLAVENLVVNGTFVTKIFRSKDYNKLIWVFQQL 176

Query: 182 FDKVVCAKPKSSRGTSLEAFIVCIGYNPP 210
           F+KV   KP +SR  S E F+VC G+  P
Sbjct: 177 FEKVEATKPPASRNVSAEIFVVCKGFKAP 205

>Sklu_2421.10 YCL054W, Contig c2421 13526-16075 reverse complement
          Length = 849

 Score =  150 bits (380), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 87/209 (41%), Positives = 116/209 (55%), Gaps = 11/209 (5%)

Query: 3   KNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDF-HFLDDPNLKRVVDLCAAPGSWSQVL 61
           KNSK + D YY  AKE+G+RARS+FK++Q+N+ F HFL+   +  V+DLCAAPGSW QV 
Sbjct: 7   KNSKGRLDRYYFLAKEKGYRARSSFKIIQINEKFGHFLEKSKV--VIDLCAAPGSWCQVA 64

Query: 62  SQKLFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKADFV 121
           S                I+ VD+ PM  + +V T Q+DIT      R+       KAD V
Sbjct: 65  SNLCPVNSL--------IIGVDIVPMKSMPNVITFQSDITTEDCRSRLRGYMKTWKADTV 116

Query: 122 CSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGYL 181
             DGAP+V      D + Q  L + AL+L    L  GG FV K+FR +D + L      L
Sbjct: 117 LHDGAPNVGLGWVQDAFTQSHLTLQALKLAVENLVVGGTFVTKVFRSKDYNKLIWLFQQL 176

Query: 182 FDKVVCAKPKSSRGTSLEAFIVCIGYNPP 210
           F++V   KP +SR  S E F+VC G+  P
Sbjct: 177 FERVEATKPPASRNVSAEIFVVCKGFKAP 205

>KLLA0C00737g 53188..55689 similar to sp|P25582 Saccharomyces
           cerevisiae YCL054w SPB1 required for ribosome synthesis,
           putative methylase, start by similarity
          Length = 833

 Score =  149 bits (376), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 115/209 (55%), Gaps = 11/209 (5%)

Query: 3   KNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDF-HFLDDPNLKRVVDLCAAPGSWSQVL 61
           KNSK + D YY  AKE+G+RARS+FK++Q+N+ + HFL+   +  V+DLCAAPGSW QV 
Sbjct: 8   KNSKGRLDKYYYLAKEKGYRARSSFKIIQINEKYGHFLEKSKV--VIDLCAAPGSWCQVA 65

Query: 62  SQKLFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKADFV 121
           S                I+ VD+ PM  + +V T Q+DIT      ++       KAD V
Sbjct: 66  SNLCPVNSL--------IIGVDIVPMKTMPNVITFQSDITTEDCRSKLRGYMKTWKADTV 117

Query: 122 CSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGYL 181
             DGAP+V      D + Q  L + AL+L    L  GG FV KIFR +D + L      L
Sbjct: 118 LHDGAPNVGLSWAQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLIWVFQQL 177

Query: 182 FDKVVCAKPKSSRGTSLEAFIVCIGYNPP 210
           F+KV   KP +SR  S E F+VC  +  P
Sbjct: 178 FEKVEATKPPASRNVSAEIFVVCKNFKAP 206

>KLLA0B01980g complement(173710..174579) similar to sp|P53123
           Saccharomyces cerevisiae YGL136c singleton, start by
           similarity
          Length = 289

 Score = 91.3 bits (225), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 73/251 (29%), Positives = 111/251 (44%), Gaps = 59/251 (23%)

Query: 5   SKDKRDMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQVLSQK 64
           ++ K D + + AKEQ FR+R+AFKL+ ++D + F      ++V+DL  APG+WSQV  ++
Sbjct: 35  ARQKNDHFTKAAKEQQFRSRAAFKLMDIDDKYRFFKQN--QKVLDLGFAPGAWSQVARKR 92

Query: 65  LFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKT------------------- 105
           +  G          I+ VDL   +P   V +LQA+I   KT                   
Sbjct: 93  IGSGGM--------IMGVDLLRCTPPKGVYSLQANILSKKTHELIRLCFARHIQLNKHDQ 144

Query: 106 -------LKRIL--------------DLFGNEK---------ADFVCSDGAPDVTGLHDL 135
                  L+ +L              +LF              D V SD   + TG+   
Sbjct: 145 LHKDHGYLQHMLEEELNHLKETEEYKELFSQTDISQNIERYPVDVVLSDMMANTTGIQSK 204

Query: 136 DEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGYLFDKVVCAKPKSSRG 195
           D Y+   L  +AL +   +LK GG F  K++ G +  +L  +L  +F KV   KP +SR 
Sbjct: 205 DHYMSMDLCDAALIVAIDLLKPGGSFTCKLYAGSEDTLLEKRLKKVFKKVDRFKPNASRN 264

Query: 196 TSLEAFIVCIG 206
            S E + V  G
Sbjct: 265 ESKELYFVARG 275

>CAGL0H08954g complement(875104..875949) similar to sp|P53123
           Saccharomyces cerevisiae YGL136c, hypothetical start
          Length = 281

 Score = 77.4 bits (189), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 102/243 (41%), Gaps = 53/243 (21%)

Query: 6   KDKRDMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQVLSQKL 65
           + K+D Y R++K    R+R+ FKL QL+D +H       +R++DL  APG+WSQV  ++ 
Sbjct: 32  RQKQDFYTRESKLDNLRSRAGFKLAQLDDVYHVFHKSVPQRILDLGYAPGAWSQVARKRT 91

Query: 66  FDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNE--------- 116
                     D  ++ VD+ P  P   V+++QA+I   +T + I   F  +         
Sbjct: 92  H--------PDSIVLGVDILPCDPPFGVSSMQANILSKRTHQLIRQFFMEQIFMNDSQVE 143

Query: 117 ---------------KADFVCSDG-------APDVTGLHDLDEYVQQQ------------ 142
                            + + SD        +P +  L ++  Y                
Sbjct: 144 SMARNDSDTEQQPQFPVNIILSDMYEPFPQLSPSLNNLTNMPYYRMSNTSGLNFKDHLNS 203

Query: 143 --LIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGYLFDKVVCAKPKSSRGTSLEA 200
             L  +AL     +L+  G F+ K F G +  +   ++  +FD+V   KP +SR  S E 
Sbjct: 204 IDLCDAALITAVDLLEPAGSFICKQFSGAETSLFEKRMKKVFDRVEITKPSASRDESKEI 263

Query: 201 FIV 203
           + +
Sbjct: 264 YFI 266

>Scas_720.46
          Length = 321

 Score = 73.9 bits (180), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 58/96 (60%), Gaps = 8/96 (8%)

Query: 10  DMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQVLSQKLFDGK 69
           D Y R+AK   FR+R+AFKL +++D FH  +   ++RV+DL  APG+WSQV  ++     
Sbjct: 42  DPYTREAKINNFRSRAAFKLTEIDDKFHIFNKSKIQRVLDLGFAPGAWSQVARER----- 96

Query: 70  TAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKT 105
                K+  I+ VD+ P  P + V+ +QA+I   KT
Sbjct: 97  ---TSKESMILGVDILPCDPPHGVSAIQANILSKKT 129

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 38/76 (50%)

Query: 128 DVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGYLFDKVVC 187
           + +GL   D      L  +AL     +L+  G FV K+F G +  +   ++  +F K + 
Sbjct: 230 NTSGLTVRDHQHSIDLCDAALVTALDLLRPKGSFVCKLFTGVEDKLFEKRVKMVFKKTIR 289

Query: 188 AKPKSSRGTSLEAFIV 203
            KPKSSR  S E +I+
Sbjct: 290 FKPKSSRNESKEVYII 305

>Kwal_56.24158
          Length = 307

 Score = 70.9 bits (172), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 62/111 (55%), Gaps = 8/111 (7%)

Query: 6   KDKRDMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQVLSQKL 65
           + K D + R AK QG R+R+AFKL+Q++D  H       + V+DL  APG+WSQV     
Sbjct: 35  RQKNDSFTRDAKVQGLRSRAAFKLMQIDDKVHLFRKNARQNVLDLGYAPGAWSQV----A 90

Query: 66  FDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNE 116
           FD    + +    I+ VD+ P +P   V+++QA+I   KT + I   F  +
Sbjct: 91  FDRTGPDGV----ILGVDILPCAPPRGVSSIQANILSRKTHELIRLFFSRQ 137

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 44/82 (53%)

Query: 124 DGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGYLFD 183
           D   + +G+   D Y    L  +AL     +LK GG FV K++ G++  +L ++L  +F+
Sbjct: 210 DRMANTSGVAIKDHYASMDLCDAALVAAIDLLKPGGSFVCKLYTGKEDRILENRLKQVFN 269

Query: 184 KVVCAKPKSSRGTSLEAFIVCI 205
           +V   KP +SR  S E + V +
Sbjct: 270 EVQRFKPTASRDESKELYFVGL 291

>Sklu_2160.2 YGL136C, Contig c2160 1404-2351
          Length = 315

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 61/109 (55%), Gaps = 8/109 (7%)

Query: 6   KDKRDMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQVLSQKL 65
           + + D Y ++AK Q  R+R+AFKL++L+D F F      +RV+DL  APG+WSQV     
Sbjct: 36  RQRNDFYTKEAKNQDLRSRAAFKLIELDDRFKFFLKNKSQRVLDLGFAPGAWSQV----A 91

Query: 66  FDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFG 114
           FD      +    ++ VD+ P  P   V+++QA+I   KT + I   F 
Sbjct: 92  FDRTKPNGM----VLGVDILPCKPPRGVSSIQANILSRKTHELIRLFFS 136

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 43/79 (54%)

Query: 128 DVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGYLFDKVVC 187
           + TG+   D Y+   L  +AL +   +L+ GG F  K++ G++  +L  ++  +F KV  
Sbjct: 224 NTTGVAIKDHYMSMDLCDAALVVAIDLLRPGGSFACKVYTGKEDKLLEKRMKMVFSKVCR 283

Query: 188 AKPKSSRGTSLEAFIVCIG 206
            KP SSR  S E + V +G
Sbjct: 284 FKPDSSRNESKELYFVGLG 302

>AFL117C [3078] [Homologous to ScYGL136C (MRM2) - SH]
           (218993..219904) [912 bp, 303 aa]
          Length = 303

 Score = 67.8 bits (164), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 59/101 (58%), Gaps = 10/101 (9%)

Query: 5   SKDKRDMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQVLSQK 64
           S+ +RD Y R+AK Q  R+R+AFKL+++++ F        +RV+DL  APG+WSQV  Q+
Sbjct: 32  SRQRRDPYTREAKVQELRSRAAFKLIEIDEQFRLFRAG--QRVLDLGFAPGAWSQVAQQR 89

Query: 65  LFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKT 105
              G         K++ VD+ P  P   V+++QA+    KT
Sbjct: 90  TQPGG--------KVMGVDVLPCKPPTGVSSIQANALSRKT 122

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%)

Query: 128 DVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGYLFDKVVC 187
           + +G+   D Y+   L  +AL     +L+ GG FV K++ G++  +L  +L  +F KV  
Sbjct: 212 NTSGVAVKDHYMSMDLCDAALLCAIALLRPGGSFVCKLYTGKEDQLLERRLRKVFTKVRR 271

Query: 188 AKPKSSRGTSLEAFIVCI 205
            KP++ R  S E + V +
Sbjct: 272 FKPEACRSESKELYFVGL 289

>YGL136C (MRM2) [1851] chr7 complement(252900..253862)
           Methyltransferase that methylates mitochondrial 21S rRNA
           at nucleotide U2791, member of the 2-prime-O-RNA
           methyltransferase family, which includes Trm7p, Spb1p,
           and E. coli FtsJ protein [963 bp, 320 aa]
          Length = 320

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 58/98 (59%), Gaps = 9/98 (9%)

Query: 9   RDMYYRKAKEQGFRARSAFKLLQLNDDFH-FLDDPNLKRVVDLCAAPGSWSQVLSQKLFD 67
           +D Y ++AK Q  R+R+AFKL+Q++D +  F  +   +R++DL  APG+WSQV  Q+   
Sbjct: 37  KDPYTKEAKVQNLRSRAAFKLMQIDDKYRLFSKNRTDQRILDLGYAPGAWSQVARQR--- 93

Query: 68  GKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKT 105
                   +  I+ VD+ P  P + V ++QA+I   +T
Sbjct: 94  -----SSPNSMILGVDILPCEPPHGVNSIQANILAKRT 126

>KLLA0A02541g 223318..224913 some similarities with sp|P53226
           Saccharomyces cerevisiae YGR041w BUD9 budding protein,
           hypothetical start
          Length = 531

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 6/62 (9%)

Query: 43  NLKRVVDLCAAP--GSWSQVLSQKLFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADI 100
           N+KR     + P  GS  QVL +++ +   ++E  D+K       P     H  +LQAD 
Sbjct: 200 NMKRSSKAVSTPALGSSDQVLDERIVEETESDETSDKKNRTSSFYPA----HTESLQADE 255

Query: 101 TH 102
           TH
Sbjct: 256 TH 257

>CAGL0L05258g complement(585873..586289) similar to sp|P36077
           Saccharomyces cerevisiae YKL086w, start by similarity
          Length = 138

 Score = 31.6 bits (70), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 2/60 (3%)

Query: 188 AKPKSSRGTSLEAFIVCIGYNPPSDWVSTLDVNSSVEEFFSGCHMSKLSIHDKLPSWQED 247
            KP +S+  SLE      G  PP D +   +   S    F GCH  +   +D+L   Q D
Sbjct: 41  GKPMASKTCSLEGATELNGQLPPIDVMCVRENGESYYFAFGGCH--RFQAYDRLAQEQND 98

>ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH]
           (612091..614112) [2022 bp, 673 aa]
          Length = 673

 Score = 32.3 bits (72), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 7/53 (13%)

Query: 109 ILDLFGNEKADFVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIF 161
           + DLFG    DF+C++G P   G H   + + +QLI S      C L   GI 
Sbjct: 340 VTDLFGKSIYDFMCNNGNPRFPGSH--VQAISRQLIRS-----VCFLHDLGII 385

>Kwal_56.23171
          Length = 438

 Score = 32.3 bits (72), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 71  AEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKADFVCSDGAPDVT 130
            EE K++K V +D++P  PIN    L  +  H + L  +L+   ++K  F+  DG   + 
Sbjct: 99  TEEGKEKK-VTIDIEPYKPINTSLYLCDNKFHTEVLSELLE--ADDKFGFIVMDGQGTLF 155

Query: 131 GL 132
           GL
Sbjct: 156 GL 157

>CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces
           cerevisiae YLL019c KNS1 ser/thr protein kinase,
           hypothetical start
          Length = 725

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 7/53 (13%)

Query: 109 ILDLFGNEKADFVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIF 161
           + DL+G    DF+CS+G     G H   + + +QLI S      C L   GI 
Sbjct: 366 VTDLYGRSVYDFMCSNGVARFPGSH--IQAIARQLIRS-----VCFLHDMGII 411

>Kwal_47.17345
          Length = 699

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 7/52 (13%)

Query: 109 ILDLFGNEKADFVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGI 160
           + DL G    DF+C++G P   G H   + + +QLI S      C L   GI
Sbjct: 368 VTDLLGKSIYDFMCNNGCPRFPGSH--VQAISKQLIRS-----VCFLHDLGI 412

>KLLA0C11231g 965524..966840 highly similar to sp|P12385
           Saccharomyces cerevisiae YBR143c SUP45 translational
           release factor singleton, start by similarity
          Length = 438

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 71  AEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKADFVCSDGAPDVT 130
            EE K++K V  D++P  PIN    L  +  H + L  +L+   ++K  F+  DG   + 
Sbjct: 99  TEEGKEKK-VTFDIEPYKPINTSLYLCDNKFHTEVLSELLE--ADDKFGFIVMDGQGALF 155

Query: 131 GL 132
           GL
Sbjct: 156 GL 157

>CAGL0L06754g 759181..760497 highly similar to sp|P12385
           Saccharomyces cerevisiae YBR143c SUP45 translational
           release factor, start by similarity
          Length = 438

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 65  LFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKADFVCSD 124
           L+ G    E    K V  D++P  PIN    L  +  H + L  +L+   ++K  F+  D
Sbjct: 92  LYCGDIITEDGKEKKVTFDIEPYKPINTSLYLCDNKFHTEVLSELLE--ADDKFGFIVMD 149

Query: 125 GAPDVTGL 132
           G   + GL
Sbjct: 150 GQGALFGL 157

>Scas_633.3
          Length = 437

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 65  LFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKADFVCSD 124
           L+ G    E    K V  D++P  PIN    L  +  H + L  +L+   ++K  F+  D
Sbjct: 92  LYCGDIITEDGKEKKVTFDIEPYKPINTSLYLCDNKFHTEVLSELLE--ADDKFGFIVMD 149

Query: 125 GAPDVTGL 132
           G   + GL
Sbjct: 150 GQGCLFGL 157

>CAGL0M07095g 720613..721944 highly similar to sp|P29704
           Saccharomyces cerevisiae YHR190w ERG9
           farnesyl-diphosphate farnesyltransferase, start by
           similarity
          Length = 443

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 36/85 (42%), Gaps = 3/85 (3%)

Query: 102 HPKTLKRILDLFGNEKADFVCSD--GAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGG 159
           + K +KRI  L GN  AD++  +      V  + D D+Y      +    LT  I+   G
Sbjct: 140 YQKVIKRITGLMGNGMADYILDENFNLNGVQTVKDYDKYCHYVAGLVGDGLTELIV-LAG 198

Query: 160 IFVAKIFRGRDIDMLYSQLGYLFDK 184
                ++ G++   LY  +G    K
Sbjct: 199 FGSDDLYHGKNSFQLYESMGLFLQK 223

>YDR311W (TFB1) [1139] chr4 (1085058..1086986) Component of RNA
           polymerase II transcription initiation factor TFIIH
           (factor b), 75 kDa subunit [1929 bp, 642 aa]
          Length = 642

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 37/87 (42%), Gaps = 20/87 (22%)

Query: 54  PGSWSQVLSQKLFDGKTAEEI--KDRKIVAVDLQPMSPINHVTTLQAD--------ITHP 103
           P  W++  S KLF     E+I   DR  V +D           TL  +        + HP
Sbjct: 281 PEFWARFFSSKLFRKLRGEKIMQNDRGDVIID--------RYLTLDQEFDRKDDDMLLHP 332

Query: 104 KTLKRILDLFGNEKADFVCSDGAPDVT 130
             +K+I+DL GN + D V     PD T
Sbjct: 333 --VKKIIDLDGNIQDDPVVRGNRPDFT 357

>CAGL0F02959g 286337..288244 similar to sp|Q04049 Saccharomyces
           cerevisiae YDR419w RAD30 DNA repair protein,
           hypothetical start
          Length = 635

 Score = 28.5 bits (62), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 40/85 (47%), Gaps = 6/85 (7%)

Query: 58  SQVLSQKLFDG--KTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGN 115
           S+ LS+ L     K  +EI D K  A D     P+ ++  + ++       K +LD+FGN
Sbjct: 468 SKYLSRDLLKTCVKLMQEIHD-KFAAKDPSKFYPLINLNVIISNFDILDHQKTVLDMFGN 526

Query: 116 EKADFVCSDGAPD---VTGLHDLDE 137
           +K  F     +P    VT + D DE
Sbjct: 527 QKQVFNTKTISPKIEPVTEVEDKDE 551

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,738,938
Number of extensions: 467019
Number of successful extensions: 1434
Number of sequences better than 10.0: 38
Number of HSP's gapped: 1388
Number of HSP's successfully gapped: 44
Length of query: 309
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 208
Effective length of database: 13,099,691
Effective search space: 2724735728
Effective search space used: 2724735728
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)