Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_718.4537637618250.0
YBR065C (ECM2)3643309361e-125
CAGL0L07458g3643306941e-88
Kwal_27.105503353416877e-88
Sklu_2357.63643386671e-84
AGR032W3312915953e-74
KLLA0F18502g3022452127e-19
KLLA0D03322g67743760.23
Scas_714.59233110740.27
Kwal_27.1083931892645.1
Scas_719.68135049646.8
YPR048W (TAH18)62367638.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_718.45
         (376 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_718.45                                                           707   0.0  
YBR065C (ECM2) [255] chr2 complement(368545..369639) Putative pr...   365   e-125
CAGL0L07458g complement(820608..821702) similar to sp|P38241 Sac...   271   1e-88
Kwal_27.10550                                                         269   7e-88
Sklu_2357.6 YBR065C, Contig c2357 7338-8432 reverse complement        261   1e-84
AGR032W [4342] [Homologous to ScYBR065C (ECM2) - SH] complement(...   233   3e-74
KLLA0F18502g complement(1699447..1700355) some similarities with...    86   7e-19
KLLA0D03322g complement(276591..278624) gi|123686|sp|P22121|HSF_...    34   0.23 
Scas_714.59                                                            33   0.27 
Kwal_27.10839                                                          29   5.1  
Scas_719.68                                                            29   6.8  
YPR048W (TAH18) [5480] chr16 (659177..661048) Protein of unknown...    29   8.7  

>Scas_718.45
          Length = 376

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/376 (92%), Positives = 349/376 (92%)

Query: 1   MNTVDYDSQPPSICDVCLGDSPNIRLTKLPNGAQCKICTMTFTSYHFKQQERSSNLTKTL 60
           MNTVDYDSQPPSICDVCLGDSPNIRLTKLPNGAQCKICTMTFTSYHFKQQERSSNLTKTL
Sbjct: 1   MNTVDYDSQPPSICDVCLGDSPNIRLTKLPNGAQCKICTMTFTSYHFKQQERSSNLTKTL 60

Query: 61  ICLRCATQRNVCQCCMLDMTWHIPVQLRDSIVSLVNQDKSMITKEAKNDIMKRFLALKDG 120
           ICLRCATQRNVCQCCMLDMTWHIPVQLRDSIVSLVNQDKSMITKEAKNDIMKRFLALKDG
Sbjct: 61  ICLRCATQRNVCQCCMLDMTWHIPVQLRDSIVSLVNQDKSMITKEAKNDIMKRFLALKDG 120

Query: 121 KLGGAQVTSDSKQTDELMQKLKDILLQNNSKENIHKKTEAISSGDSSNSTRLDNSKLKGI 180
           KLGGAQVTSDSKQTDELMQKLKDILLQNNSKENIHKKTEAISSGDSSNSTRLDNSKLKGI
Sbjct: 121 KLGGAQVTSDSKQTDELMQKLKDILLQNNSKENIHKKTEAISSGDSSNSTRLDNSKLKGI 180

Query: 181 DISHIIRKLPLRESFLDTTASVKSFFLYNIDPSIPEWKVSDQISNIVGTKDWKDPTSLSL 240
           DISHIIRKLPLRESFLDTTASVKSFFLYNIDPSIPEWKVSDQISNIVGTKDWKDPTSLSL
Sbjct: 181 DISHIIRKLPLRESFLDTTASVKSFFLYNIDPSIPEWKVSDQISNIVGTKDWKDPTSLSL 240

Query: 241 IIIHKAKCGGVRFKSEELGSKFVKNMLASGSFMKSNDGKVQRGILKIDHFQIFAIPWRXX 300
           IIIHKAKCGGVRFKSEELGSKFVKNMLASGSFMKSNDGKVQRGILKIDHFQIFAIPWR  
Sbjct: 241 IIIHKAKCGGVRFKSEELGSKFVKNMLASGSFMKSNDGKVQRGILKIDHFQIFAIPWRSG 300

Query: 301 XXXXXXXXNVNENIKLSLSMNKLIQLENGASTESELQSEPAKKSVKTPPGGSXXXXXXXX 360
                   NVNENIKLSLSMNKLIQLENGASTESELQSEPAKKSVKTPPGGS        
Sbjct: 301 FSGSSFGGNVNENIKLSLSMNKLIQLENGASTESELQSEPAKKSVKTPPGGSKTMAKKNK 360

Query: 361 XXXXXXXXXRISNLQL 376
                    RISNLQL
Sbjct: 361 ITKPKKSKKRISNLQL 376

>YBR065C (ECM2) [255] chr2 complement(368545..369639) Putative
           pre-mRNA splicing factor, also involved in cell wall
           structure or biosynthesis [1095 bp, 364 aa]
          Length = 364

 Score =  365 bits (936), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 181/330 (54%), Positives = 234/330 (70%), Gaps = 9/330 (2%)

Query: 5   DYDSQPPSICDVCLGDSPNIRLTKLPNGAQCKICTMTFTSYHFKQQERSSNLTKTLICLR 64
           + +  PP+IC+ CLGD  NIR+TK+P G++CKICT+ FT YHFK  +RS+N+ KTLIC+R
Sbjct: 4   EINEPPPNICEQCLGDEANIRMTKIPQGSECKICTLPFTLYHFKTSKRSNNIIKTLICVR 63

Query: 65  CATQRNVCQCCMLDMTWHIPVQLRDSIVSLVNQDKSMITKEAKNDIMKRFLALKDGKLGG 124
           CATQRN+CQCCMLD  WHIP+QLRD ++SLVN++  M T+EAKND+MKRFL+LK+ KLGG
Sbjct: 64  CATQRNICQCCMLDSRWHIPIQLRDHLISLVNEENVM-TEEAKNDMMKRFLSLKNVKLGG 122

Query: 125 AQVTSDSKQTDELMQKLKDILLQNNS---KENIHKKTEAISSGDSSNSTRLDNSKLKGID 181
           AQ+TSD  + D ++ KLK+ILL+  S      + K T A+   +   +   +  K   +D
Sbjct: 123 AQITSDPSEADNIVDKLKNILLRATSDGPSTPLIKNTTALYKNEKGANEVKNLEKYASVD 182

Query: 182 ISHIIRKLPLRESFLDTTASVKSFFLYNIDPSIPEWKVSDQISNIVGTKDWKDPTSLSLI 241
           ISHI++KLPL ESFL    S KSFFLYNID SIPEWK++D +S ++G K WKD  SLSLI
Sbjct: 183 ISHILKKLPLNESFLK-NPSTKSFFLYNIDASIPEWKITDTVSQLLGIKKWKDGNSLSLI 241

Query: 242 IIHKAKCGGVRFKSEELGSKFVKNMLASGSFMKSNDGKVQRGILKIDHFQIFAIPWRXXX 301
           + HKAKCGG+RF+S ELG +FV  +  +    K     ++RG+L ID F+IF IPW    
Sbjct: 242 VNHKAKCGGLRFQSSELGERFVSKISETLVTPKG----LKRGVLLIDRFRIFIIPWSSGF 297

Query: 302 XXXXXXXNVNENIKLSLSMNKLIQLENGAS 331
                  N  ENIKLSLS+NKLIQLE G S
Sbjct: 298 SAASFGTNTAENIKLSLSLNKLIQLELGLS 327

>CAGL0L07458g complement(820608..821702) similar to sp|P38241
           Saccharomyces cerevisiae YBR065c ECM2, start by
           similarity
          Length = 364

 Score =  271 bits (694), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 141/330 (42%), Positives = 208/330 (63%), Gaps = 17/330 (5%)

Query: 11  PSICDVCLGDS---PNIRLTKLPNGAQCKICTMTFTSYHFKQQERSSNLTKTLICLRCAT 67
           P IC+ CLG S    NIR+ ++PNGA CKICT+ +T YHFK+  RS+++ KTLIC +CA 
Sbjct: 12  PQICEKCLGTSNTNENIRMNEVPNGAACKICTLPYTLYHFKKSHRSADIIKTLICKKCAI 71

Query: 68  QRNVCQCCMLDMTWHIPVQLRDSIVSLVNQDKSMITKEAKNDIMKRFLALKDGKLGGAQV 127
           QRNVCQCCMLDM  HI +QLRD ++S+V+  K  IT+EAKN +MK+F+A+K G LG A +
Sbjct: 72  QRNVCQCCMLDMKLHISIQLRDKLMSIVS-GKETITEEAKNIMMKKFIAMKGGSLGSADL 130

Query: 128 TSDSKQTDELMQKLKDILLQNNSKENIHKKTEAISSGDSSNSTRLDNSKLKGIDISHIIR 187
           T +    ++++  L++ L      + ++ + E IS+    N    DN  LK +DI     
Sbjct: 131 TRNVDSIEDILLNLREKL----EGKPLNDENEPISA--LQNKELGDNPHLKSVDIQPYWD 184

Query: 188 KLPLRESFLDTTA------SVKSFFLYNIDPSIPEWKVSDQISNIVGTKDWKDPTSLSLI 241
           K PL+E+F +         S KSFF+YNID S+PEWK+SD+I+ ++G+  WK   S+ +I
Sbjct: 185 KFPLQETFPNAIQIPKGNDSFKSFFIYNIDSSVPEWKISDKITELLGSDSWKTKESIPII 244

Query: 242 IIHKAKCGGVRFKSEELGSKFVKNMLASGSFMKSN-DGKVQRGILKIDHFQIFAIPWRXX 300
           I HKA CG  R  + EL  KF++ +  S + ++ N    ++RGILK+DHFQ+F IPW+  
Sbjct: 245 INHKAMCGAFRIGNNELSEKFLQTINNSDNMIRINRSNGLRRGILKVDHFQLFIIPWKQG 304

Query: 301 XXXXXXXXNVNENIKLSLSMNKLIQLENGA 330
                     NE+ K++ ++ ++I  E G 
Sbjct: 305 FSVESFGRTPNESKKIAFALREIIVEEMGG 334

>Kwal_27.10550
          Length = 335

 Score =  269 bits (687), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 144/341 (42%), Positives = 212/341 (62%), Gaps = 32/341 (9%)

Query: 11  PSICDVCLGDSPNIRLTKLPNGAQCKICTMTFTSYHFKQQERSSNLTKTLICLRCATQRN 70
           P+IC+ CLGD    RLT+  NGA+CKICT+ FT YHFK   +   + +T+IC  C+ QRN
Sbjct: 3   PAICEACLGD--QTRLTRAVNGAECKICTLAFTVYHFKTHHK---VNRTVICHNCSKQRN 57

Query: 71  VCQCCMLDMTWHIPVQLRDSIVSLVNQDKSMITKEAKNDIMKRFLALKDG---KLGGAQV 127
           +CQCC+LD+ WHIPV+LRD ++SL+ Q   + T+EA+ND+MKRF+ALKDG   K+GGA+V
Sbjct: 58  ICQCCLLDLQWHIPVELRDRVLSLI-QGSEVATEEAQNDMMKRFIALKDGSTYKVGGAKV 116

Query: 128 TSDSKQTDELMQKLKDILLQNNSKENIHKKTEAISSGDSSNSTRLDNSKLKGIDISHIIR 187
           TSD+  T +++++++D L     K+N         S  +  S  +    +  +DISH+++
Sbjct: 117 TSDASATADVIERIRDTLQAVEDKDN---------SNANVKSAAIAPQSVTEVDISHLLK 167

Query: 188 KLPLRESFLDTTASVKSFFLYNIDPSIPEWKVSDQISNIVGTKDWKDPTSLSLIIIHKAK 247
           KLPL+ S  + TA    FFLYNIDP++PEW V D IS +V T  W++P S S+ I H A+
Sbjct: 168 KLPLKGSLSEGTA----FFLYNIDPALPEWAVVDAISEVVETPSWQEPVSASVAINHTAR 223

Query: 248 CGGVRFKSEELGSKFVKNMLASGSFMKSNDGKVQRGILKIDHFQIFAIPWRXXXXXXXXX 307
           CGG+RFK+ EL  KF  ++       K+  G + +G L + + ++  + W          
Sbjct: 224 CGGIRFKNAELAQKFRDSI----ETFKAESGLI-KGKLLVQNSRVHVVSWPQFHRAALGT 278

Query: 308 XNVNENIKLSLSMNKLIQLENGAS----TESELQSEPAKKS 344
            N  E  KL+LS++KL+Q +  AS    T ++ Q   AKKS
Sbjct: 279 KNA-ECRKLALSLDKLVQKDLTASSKNTTLTKKQGRVAKKS 318

>Sklu_2357.6 YBR065C, Contig c2357 7338-8432 reverse complement
          Length = 364

 Score =  261 bits (667), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 140/338 (41%), Positives = 210/338 (62%), Gaps = 33/338 (9%)

Query: 9   QPPSICDVCLG-DSPNIRLTKLPNGAQCKICTMTFTSYHFKQQERSSNLTKTLICLRCAT 67
           Q P+IC+ CL  DS  IR+TK P+GA CKICT+ FT ++FK      +LTKTLICL C+ 
Sbjct: 4   QHPAICESCLSRDSKFIRMTKAPDGATCKICTLPFTLFYFKLPGHR-HLTKTLICLNCSK 62

Query: 68  QRNVCQCCMLDMTWHIPVQLRDSIVSLVNQDKSMITKEAKNDIMKRFLALKDG---KLGG 124
           QRN+CQCC+LD++WH+P  +RD I+S++N D +++T+EA N+++KRF+ LKDG   K+GG
Sbjct: 63  QRNICQCCLLDLSWHVPTNVRDQILSMLN-DSAVVTEEASNEMVKRFIGLKDGDSFKMGG 121

Query: 125 AQVTSDSKQTDELMQKLKDILLQNNSKENIHKKTEAISSGDS----------SNSTRLDN 174
           A VTSD     ++M KL++IL  + S+      T   ++G+           +       
Sbjct: 122 ASVTSDYDSNQQVMLKLQNILNASTSQ-----GTSPATAGEPDPLNDVATLVTKDKHDKR 176

Query: 175 SKLKGIDISHIIRKLPLRESFLDTTASVKSFFLYNIDPSIPEWKVSDQISNIVGTKDWKD 234
            K   +DISHI+++LPL+ S +D   S +SFFLYNIDP IPEW + ++IS++V T  W+D
Sbjct: 177 EKYANLDISHILKRLPLKGS-IDKGDSTRSFFLYNIDPGIPEWSIVEKISSMVETTQWQD 235

Query: 235 PTSLSLIIIHKAKCGGVRFKSEELGSKFVKNMLASGSFMKSNDGKVQRGILKIDHFQIFA 294
             + S+II H AKCGG+RFKS +L ++F+  +  +GS          +G+L + + +I  
Sbjct: 236 RETTSVIINHTAKCGGIRFKSADLANRFITQLEKNGS----------KGVLAVRNCRIHV 285

Query: 295 IPWRXXXXXXXXXXNVNENIKLSLSMNKLIQLENGAST 332
           + W              E +KL LS++KL+Q +   ST
Sbjct: 286 VKW-SSMHSGAFGDKYAEFVKLGLSLDKLVQKDVSPST 322

>AGR032W [4342] [Homologous to ScYBR065C (ECM2) - SH]
           complement(770660..771655) [996 bp, 331 aa]
          Length = 331

 Score =  233 bits (595), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 173/291 (59%), Gaps = 30/291 (10%)

Query: 7   DSQPPSICDVCLGDSPNIRLTKLPNGAQCKICTMTFTSYHFKQQERSSNLTKTLICLRCA 66
           D + PSIC+ CL D+ ++R+T+   GA+CKICT+ FT YHFK    +  +TKTL+C RCA
Sbjct: 2   DEETPSICEQCLTDA-DLRMTRAARGAECKICTLPFTLYHFKPPG-APRVTKTLVCRRCA 59

Query: 67  TQRNVCQCCMLDMTWHIPVQLRDSIVSLVNQDKSMITKEAKNDIMKRFLALKDGKLGGAQ 126
            QRNVCQCCMLD+ W +PV LRD +VSLV Q     T EA N++++RFLAL+ G+LGGA+
Sbjct: 60  AQRNVCQCCMLDLAWKLPVALRDELVSLV-QGSDERTPEASNEMVRRFLALRGGQLGGAR 118

Query: 127 VTSDSKQTDELMQKLKDILLQNNSKENIHKKTEAISSGDSSNSTRLDNSKLKGIDISHII 186
           +T+DS    ELM K++ +          H   E   +G+   +                 
Sbjct: 119 LTADSAPLRELMGKMRAVAAAAAPAARAHGGRE--DAGEVPET----------------- 159

Query: 187 RKLPLRESFLDTTASVKSFFLYNIDPSIPEWKVSDQISNIVGTKDWKDPTSLSLIIIHKA 246
            +LP   +    T + +SFF+Y +DP++PEW++ D +S +V T DW+D  S+S+++   A
Sbjct: 160 -QLPFGGAL--ATPASRSFFIYGVDPALPEWELVDAVSQLVRTPDWRDAGSVSVVVRQDA 216

Query: 247 KCGGVRFKSEELGSKFVKNMLASGSFMKSNDGKVQRGILKIDHFQIFAIPW 297
           +C G+RF+ EEL   FV  +      + +  G   +G+L+I H ++  + W
Sbjct: 217 RCAGIRFRREELAQAFVARL----ETLPAAAG-APKGVLRIRHLRMHVVAW 262

>KLLA0F18502g complement(1699447..1700355) some similarities with
           sp|P38241 Saccharomyces cerevisiae YBR065c ECM2 involved
           in cell wall biogenesis and architecture singleton,
           hypothetical start
          Length = 302

 Score = 86.3 bits (212), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 110/245 (44%), Gaps = 56/245 (22%)

Query: 13  ICDVCLGDSPNI-RLTKLPNGAQCKICTMTFTSYHFKQQERSSNLTKTLICLRCATQRNV 71
           IC+ CL    N   L + PNG +CK CT  F SY +     + +   T+ C +CAT+  +
Sbjct: 10  ICERCLPLGENTPTLIRYPNGRECKFCTFPFDSYSYTINHTTFH---TICCPKCATKNLI 66

Query: 72  CQCCMLDMTWHIPVQLRDSIVSLVNQDKSMITKEAKNDIMKRFLALKDGKLGGAQVTSDS 131
           CQ C+ D    IP+ LR+S+  L+N++   +    KND+MKRF+ L   ++    +    
Sbjct: 67  CQVCLNDFEHGIPMHLRNSMKQLLNENADSVI--PKNDMMKRFIGLSSKQVAPLNI---- 120

Query: 132 KQTDELMQKLKDILLQNNSKENIHKKTEAISSGDSSNSTRLDNSKLKGIDISHIIRKLPL 191
              D+L Q            E+I K                             +R+LP 
Sbjct: 121 ---DKLKQ-----------AESIRKWR---------------------------VRELPF 139

Query: 192 RESFLDTTASVKSFFLYNIDPSIPEWKVSDQISNIVGTKDWKDPTSLSLIIIHKAKCGGV 251
             +  DT     +FFLYNIDP++ E ++  Q+  IV T +  +  + SL +  K +   +
Sbjct: 140 NSNVNDTK---DTFFLYNIDPNLTESQIVSQL--IVATNNNLERENTSLKLNSKLRIATL 194

Query: 252 RFKSE 256
            FK +
Sbjct: 195 TFKQD 199

>KLLA0D03322g complement(276591..278624)
           gi|123686|sp|P22121|HSF_KLULA Kluyveromyces lactis Heat
           shock factor protein (HSF) (Heat shock transcription
           factor) (HSTF), start by similarity
          Length = 677

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 210 IDPSI-PEWKVSDQISNIVGTKDWKDPTSLSLIIIHKAKCGGV 251
           ++PS+ PE  VS + SN VGT   + P SL  +I   A  GGV
Sbjct: 66  VNPSLDPEGVVSAEPSNEVGTPLLQQPISLDHVITRPASAGGV 108

>Scas_714.59
          Length = 233

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 49/110 (44%), Gaps = 7/110 (6%)

Query: 48  KQQERSSNLTKTLICLRCATQRNVCQCCMLDMTWHIPVQLRDSIVSLVNQDKSMITKEAK 107
           + Q+     TKT++C  C       QC   ++   I   L D    L  ++++M+  +  
Sbjct: 58  RYQKEKGTTTKTVVCRHCGNDHYTMQCPFKNILNEISA-LEDPAAGLDEEEENMVPSQMG 116

Query: 108 NDIMKRFLALKDGKLGGAQVTSDS----KQTDELMQKLKDILLQNNSKEN 153
            D  + ++     +LG    +SD+    ++ D+L   LK + L  N+ EN
Sbjct: 117 GDGTRSYVP-PSRRLGARDPSSDAYRDPRERDDLCT-LKIMQLNENADEN 164

>Kwal_27.10839
          Length = 318

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 44/92 (47%), Gaps = 3/92 (3%)

Query: 90  SIVSLVNQDKSMITKE-AKNDIMKRFLALKDGKLGGAQVTSDSKQTDELMQKLKDILLQN 148
           SI   ++ + ++I KE  K + + R + + D K     +  D   T   + K  D+L +N
Sbjct: 183 SIADKLDLNFALIHKERQKANEVSRMILVGDVKGKSCILVDDMADTCGTLVKASDMLFEN 242

Query: 149 NSKENIHKKTEAISSGDSSNSTRLDNSKLKGI 180
            +KE I   T  I SG  S   +L NSKL  I
Sbjct: 243 GAKEVIALVTHGIFSG--SAREKLKNSKLSRI 272

>Scas_719.68
          Length = 1350

 Score = 29.3 bits (64), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 6/49 (12%)

Query: 27 TKLPNGAQCKICTMTFTSYHFKQQERSSNLTKTLICL---RCATQRNVC 72
          T  P    C ICT T    H K+ +RS    K  +C+   RC  +R++ 
Sbjct: 35 TDKPRPFLCPICTRT---EHLKRHQRSHTREKPFVCVFCGRCFARRDLV 80

>YPR048W (TAH18) [5480] chr16 (659177..661048) Protein of unknown
           function, has similarity to NAPDH-cytochrome P450
           reductases [1872 bp, 623 aa]
          Length = 623

 Score = 28.9 bits (63), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 10/67 (14%)

Query: 217 WKVSDQISNIVGTKD---------WKDPTSLSLIIIHKAKCGGVRFKSEELGSKFVKNML 267
           W++ ++I+N+V  KD          K P  + L  I   K  G  F  EE   K++K M 
Sbjct: 555 WRLGEEITNLVVNKDAVFFLCGSSGKMPIQVRLTFIEMLKKWG-NFSDEETAKKYLKEME 613

Query: 268 ASGSFMK 274
            S  +++
Sbjct: 614 KSDRYIQ 620

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.131    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,299,995
Number of extensions: 464038
Number of successful extensions: 1862
Number of sequences better than 10.0: 42
Number of HSP's gapped: 1885
Number of HSP's successfully gapped: 44
Length of query: 376
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 273
Effective length of database: 13,030,455
Effective search space: 3557314215
Effective search space used: 3557314215
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)