Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_718.4259559529830.0
YDR046C (BAP3)60459821470.0
YBR068C (BAP2)60960121250.0
Scas_569.559357821170.0
CAGL0H08393g61260019720.0
CAGL0L07546g63462419690.0
AGR038C58055118150.0
Kwal_27.1053860256117650.0
CAGL0B01012g62362216390.0
CAGL0K05753g66062116190.0
YDR508C (GNP1)66363216120.0
AGR039C58655915380.0
Kwal_33.1320460759914990.0
Kwal_33.1321559859814690.0
Scas_517.267964214740.0
KLLA0C01606g62057614390.0
YCL025C (AGP1)59554114310.0
AFR698C60959414160.0
AGR040C57358513650.0
YBR069C (TAT1)61959613131e-175
Scas_718.4161456712061e-159
Sklu_2390.160557512001e-158
Kwal_27.1268159355711771e-155
Sklu_2029.259849711631e-153
ADL272W56452211451e-150
YKR039W (GAP1)60255711281e-147
CAGL0L03267g59759411271e-147
Kwal_33.1540758753511201e-146
YGR191W (HIP1)60359611091e-144
KLLA0A06886g58755710961e-143
AGR319W62661410821e-140
CAGL0B03773g60552410801e-140
Kwal_33.1427659659810781e-140
KLLA0A11770g58153610741e-139
KLLA0F01012g55653210671e-139
AFR230C60456810641e-138
Scas_607.459956010461e-135
Scas_507.159253510401e-134
Scas_479.159555110281e-132
CAGL0D02178g57759610161e-131
YOL020W (TAT2)59256010101e-130
KLLA0A06930g5875919941e-127
AEL030W7395699941e-126
KLLA0A10813g5845689451e-120
Kwal_34.162544814788891e-113
Scas_536.13723728181e-104
Kwal_56.229515966118331e-103
KLLA0B06776g5885887921e-97
YPL274W (SAM3)5876077791e-95
YLL061W (MMP1)5835637712e-94
YNL268W (LYP1)6115927191e-86
CAGL0J08162g5975906981e-83
AER405C4975136902e-83
Scas_706.36d6075876946e-83
Scas_706.375445526783e-81
Kwal_33.134115605516732e-80
KLLA0C02365g5795456701e-79
CAGL0J08184g5725216691e-79
KLLA0E16335g6055986702e-79
Scas_520.2*3723826503e-79
YEL063C (CAN1)5905256622e-78
YPL265W (DIP5)6085266571e-77
Kwal_33.134015595346497e-77
AFR667C5635616453e-76
CAGL0A01199g6135566432e-75
KLLA0C02343g5814716342e-74
AFR668W5564946288e-74
YNL270C (ALP1)5735166141e-71
Scas_486.25975826037e-70
Kwal_26.96125435595902e-68
Scas_84.12132065622e-68
Kwal_33.155455765405903e-68
Scas_377.24904965548e-64
KLLA0B14685g5715405599e-64
KLLA0F23419g5735445553e-63
Scas_552.35585345473e-62
KLLA0F27093g5635175466e-62
ACL135W5885565468e-62
CAGL0E05632g5985525433e-61
YFL055W (AGP3)5585305387e-61
YOR348C (PUT4)6276155392e-60
Sklu_2438.145585415352e-60
AFR156W5585515263e-59
Kwal_23.28175805435257e-59
CAGL0M00154g5505565211e-58
Kwal_26.69405705325152e-57
Kwal_8.5906295915112e-56
Kwal_23.40265344394589e-50
Scas_377.11481494148e-48
Kwal_26.80975445344379e-47
Scas_460.35845874257e-45
Sklu_2365.98055764052e-41
YBR132C (AGP2)5965373904e-40
AAR038W5664763851e-39
KLLA0C15873g5685333824e-39
Kwal_23.38475794683762e-38
CAGL0E01089g8536043662e-36
Kwal_53.194615655663523e-35
CAGL0C00539g5724443514e-35
KLLA0D16830g8325933502e-34
YDR160W (SSY1)8525673441e-33
KLLA0B09922g7975773413e-33
Scas_682.308455683362e-32
AGL171W8515553183e-30
Kwal_27.119007265083083e-29
Scas_619.2*4714852821e-26
Scas_485.4*2371902631e-25
Scas_476.42371902631e-25
Scas_642.222372112561e-24
Scas_233.114195900.002
CAGL0I08415g1308142820.078
Sklu_2147.4568114800.14
Scas_689.19612118740.75
CAGL0H03399g55693721.4
YGL077C (HNM1)56399711.5
Scas_720.18569103711.7
Scas_622.10562191702.0
CAGL0M08272g62170702.3
Scas_710.3058430692.9
YKL174C61871674.5
AFL081W542109665.9
ABL003C561127667.1
YMR081C (ISF1)33853657.6
Scas_429.2183139638.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_718.42
         (595 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_718.42                                                          1153   0.0  
YDR046C (BAP3) [899] chr4 complement(548758..550572) Branched ch...   831   0.0  
YBR068C (BAP2) [258] chr2 complement(373821..375650) Branched-ch...   823   0.0  
Scas_569.5                                                            820   0.0  
CAGL0H08393g 821998..823836 highly similar to sp|P41815 Saccharo...   764   0.0  
CAGL0L07546g complement(831824..833728) highly similar to sp|P38...   763   0.0  
AGR038C [4348] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C (...   703   0.0  
Kwal_27.10538                                                         684   0.0  
CAGL0B01012g 91330..93201 similar to sp|P25376 Saccharomyces cer...   635   0.0  
CAGL0K05753g 564282..566264 highly similar to sp|P48813 Saccharo...   628   0.0  
YDR508C (GNP1) [1322] chr4 complement(1466441..1468432) High aff...   625   0.0  
AGR039C [4349] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C (...   597   0.0  
Kwal_33.13204                                                         582   0.0  
Kwal_33.13215                                                         570   0.0  
Scas_517.2                                                            572   0.0  
KLLA0C01606g complement(123485..125347) similar to sp|P48813 Sac...   558   0.0  
YCL025C (AGP1) [519] chr3 complement(76131..77918) Broad substra...   555   0.0  
AFR698C [3891] [Homologous to ScYDR508C (GNP1) - SH; ScYCL025C (...   550   0.0  
AGR040C [4350] [Homologous to ScYBR069C (TAT1) - SH] (782289..78...   530   0.0  
YBR069C (TAT1) [259] chr2 complement(376534..378393) Amino acid ...   510   e-175
Scas_718.41                                                           469   e-159
Sklu_2390.1 YGR191W, Contig c2390 5453-7270 reverse complement        466   e-158
Kwal_27.12681                                                         457   e-155
Sklu_2029.2 , Contig c2029 2095-3891                                  452   e-153
ADL272W [1469] [Homologous to ScYDR508C (GNP1) - NSH] complement...   445   e-150
YKR039W (GAP1) [3292] chr11 (514705..516513) General amino acid ...   439   e-147
CAGL0L03267g 372787..374580 highly similar to sp|P19145 Saccharo...   438   e-147
Kwal_33.15407                                                         436   e-146
YGR191W (HIP1) [2141] chr7 (880423..882234) Histidine permease, ...   431   e-144
KLLA0A06886g complement(621646..623409) similar to sp|P19145 Sac...   426   e-143
AGR319W [4630] [Homologous to ScYGR191W (HIP1) - SH] complement(...   421   e-140
CAGL0B03773g 373956..375773 highly similar to sp|P06775 Saccharo...   420   e-140
Kwal_33.14276                                                         419   e-140
KLLA0A11770g 1014918..1016663 similar to sp|P06775 Saccharomyces...   418   e-139
KLLA0F01012g complement(90772..92442) similar to sp|P48813 Sacch...   415   e-139
AFR230C [3422] [Homologous to ScYKR039W (GAP1) - NSH] (855416..8...   414   e-138
Scas_607.4                                                            407   e-135
Scas_507.1                                                            405   e-134
Scas_479.1                                                            400   e-132
CAGL0D02178g 222597..224330 highly similar to sp|P38967 Saccharo...   395   e-131
YOL020W (TAT2) [4796] chr15 (286172..287950) High affinity trypt...   393   e-130
KLLA0A06930g complement(625498..627261) similar to sp|P19145 Sac...   387   e-127
AEL030W [2476] [Homologous to ScYOL020W (TAT2) - SH] complement(...   387   e-126
KLLA0A10813g complement(936126..937880) similar to sp|P38967 Sac...   368   e-120
Kwal_34.16254                                                         347   e-113
Scas_536.1                                                            319   e-104
Kwal_56.22951                                                         325   e-103
KLLA0B06776g 594172..595938 similar to sgd|S0006195 Saccharomyce...   309   1e-97
YPL274W (SAM3) [5177] chr16 (22938..24701) High affinity S-adeno...   304   1e-95
YLL061W (MMP1) [3363] chr12 (17956..19707) High affinity S-methy...   301   2e-94
YNL268W (LYP1) [4340] chr14 (138549..140384) High affinity lysin...   281   1e-86
CAGL0J08162g complement(801555..803348) Highly similar to sp|P32...   273   1e-83
AER405C [2905] [Homologous to ScYPL274W (SAM3) - NSH] (1413790.....   270   2e-83
Scas_706.36d                                                          271   6e-83
Scas_706.37                                                           265   3e-81
Kwal_33.13411                                                         263   2e-80
KLLA0C02365g 208462..210201 similar to sp|P32487 Saccharomyces c...   262   1e-79
CAGL0J08184g 804507..806225 similar to sp|P04817 Saccharomyces c...   262   1e-79
KLLA0E16335g 1455271..1457088 gi|28565044|gb|AAO32605.1 Kluyvero...   262   2e-79
Scas_520.2*                                                           254   3e-79
YEL063C (CAN1) [1365] chr5 complement(31694..33466) Permease for...   259   2e-78
YPL265W (DIP5) [5186] chr16 (41043..42869) Dicarboxylic amino ac...   257   1e-77
Kwal_33.13401                                                         254   7e-77
AFR667C [3860] [Homologous to ScYNL268W (LYP1) - SH] (1657064..1...   253   3e-76
CAGL0A01199g 121067..122908 similar to sp|P53388 Saccharomyces c...   252   2e-75
KLLA0C02343g complement(203552..205297) similar to sp|P04817 Sac...   248   2e-74
AFR668W [3861] [Homologous to ScYEL063C (CAN1) - SH; ScYNL270C (...   246   8e-74
YNL270C (ALP1) [4339] chr14 complement(135939..137660) Arginine ...   241   1e-71
Scas_486.2                                                            236   7e-70
Kwal_26.9612                                                          231   2e-68
Scas_84.1                                                             221   2e-68
Kwal_33.15545                                                         231   3e-68
Scas_377.2                                                            218   8e-64
KLLA0B14685g complement(1289025..1290740) similar to sp|P15380 S...   219   9e-64
KLLA0F23419g complement(2187386..2189107) similar to sp|P15380 S...   218   3e-63
Scas_552.3                                                            215   3e-62
KLLA0F27093g 2501049..2502740 similar to sp|P43548 Saccharomyces...   214   6e-62
ACL135W [914] [Homologous to ScYPL265W (DIP5) - NSH] complement(...   214   8e-62
CAGL0E05632g complement(556619..558415) similar to sp|P15380 Sac...   213   3e-61
YFL055W (AGP3) [1629] chr6 (17004..18680) Amino acid permease fo...   211   7e-61
YOR348C (PUT4) [5125] chr15 complement(986894..988777) High affi...   212   2e-60
Sklu_2438.14 YOR348C, Contig c2438 29357-31033                        210   2e-60
AFR156W [3348] [Homologous to ScYOR348C (PUT4) - NSH] complement...   207   3e-59
Kwal_23.2817                                                          206   7e-59
CAGL0M00154g 22039..23691 similar to sp|P32487 Saccharomyces cer...   205   1e-58
Kwal_26.6940                                                          202   2e-57
Kwal_8.590                                                            201   2e-56
Kwal_23.4026                                                          181   9e-50
Scas_377.1                                                            164   8e-48
Kwal_26.8097                                                          172   9e-47
Scas_460.3                                                            168   7e-45
Sklu_2365.9 YDR160W, Contig c2365 13522-15939                         160   2e-41
YBR132C (AGP2) [319] chr2 complement(499608..501398) Plasma memb...   154   4e-40
AAR038W [224] [Homologous to ScYBR132C (AGP2) - SH] complement(4...   152   1e-39
KLLA0C15873g 1381699..1383405 similar to sp|P38090 Saccharomyces...   151   4e-39
Kwal_23.3847                                                          149   2e-38
CAGL0E01089g complement(96582..99143) similar to sp|Q03770 Sacch...   145   2e-36
Kwal_53.19461                                                         140   3e-35
CAGL0C00539g 57784..59502 highly similar to sp|P38090 Saccharomy...   139   4e-35
KLLA0D16830g 1426856..1429354 similar to sp|Q03770 Saccharomyces...   139   2e-34
YDR160W (SSY1) [1002] chr4 (776157..778715) Component of an extr...   137   1e-33
KLLA0B09922g complement(867748..870141) weakly similar to sp|Q03...   135   3e-33
Scas_682.30                                                           134   2e-32
AGL171W [4141] [Homologous to ScYDR160W (SSY1) - SH] complement(...   127   3e-30
Kwal_27.11900                                                         123   3e-29
Scas_619.2*                                                           113   1e-26
Scas_485.4*                                                           105   1e-25
Scas_476.4                                                            105   1e-25
Scas_642.22                                                           103   1e-24
Scas_233.1                                                             39   0.002
CAGL0I08415g 820503..824429 some similarities with tr|Q06211 Sac...    36   0.078
Sklu_2147.4 YKL174C, Contig c2147 6541-8247 reverse complement         35   0.14 
Scas_689.19                                                            33   0.75 
CAGL0H03399g complement(316110..317780) highly similar to sp|P19...    32   1.4  
YGL077C (HNM1) [1905] chr7 complement(362226..363917) Choline pe...    32   1.5  
Scas_720.18                                                            32   1.7  
Scas_622.10                                                            32   2.0  
CAGL0M08272g complement(823019..824884) highly similar to sp|P36...    32   2.3  
Scas_710.30                                                            31   2.9  
YKL174C (YKL174C) [3097] chr11 complement(120385..122241) Member...    30   4.5  
AFL081W [3112] [Homologous to ScYGL077C (HNM1) - SH] complement(...    30   5.9  
ABL003C [589] [Homologous to ScYGR055W (MUP1) - SH] (390867..392...    30   7.1  
YMR081C (ISF1) [4040] chr13 complement(430078..431094) Protein t...    30   7.6  
Scas_429.2                                                             29   8.8  

>Scas_718.42
          Length = 595

 Score = 1153 bits (2983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/595 (94%), Positives = 564/595 (94%)

Query: 1   MESSKKNETSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAEVNHN 60
           MESSKKNETSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAEVNHN
Sbjct: 1   MESSKKNETSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAEVNHN 60

Query: 61  GIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYF 120
           GIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYF
Sbjct: 61  GIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYF 120

Query: 121 MVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELI 180
           MVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELI
Sbjct: 121 MVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELI 180

Query: 181 TASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSI 240
           TASMTIKYWNDKINAD                GVRAYGEAEFIFNSCKILMIGGFVILSI
Sbjct: 181 TASMTIKYWNDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSI 240

Query: 241 VVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQ 300
           VVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQ
Sbjct: 241 VVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQ 300

Query: 301 ENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAVSIH 360
           ENPRRSTPAAAKQS               GFNVPHNSDQLMGAGGSATHASPYVLAVSIH
Sbjct: 301 ENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHASPYVLAVSIH 360

Query: 361 GVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALIL 420
           GVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALIL
Sbjct: 361 GVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALIL 420

Query: 421 CSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELG 480
           CSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELG
Sbjct: 421 CSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELG 480

Query: 481 YISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGY 540
           YISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGY
Sbjct: 481 YISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGY 540

Query: 541 MLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
           MLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC
Sbjct: 541 MLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595

>YDR046C (BAP3) [899] chr4 complement(548758..550572) Branched chain
           amino acid permease, also transports threonine, alanine
           and aromatic and sulfur containing amino acids [1815 bp,
           604 aa]
          Length = 604

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/598 (66%), Positives = 468/598 (78%), Gaps = 5/598 (0%)

Query: 3   SSKKNETSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTH---FNRFVDSFKRAEVN- 58
           +S K E S E     S+     N +      P+       +     +RFVDSF+RAE   
Sbjct: 7   TSSKMEKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQR 66

Query: 59  -HNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVI 117
                DLEDGT S++S+++LKK+MKSRHV+MMSLGTGIGTGLLVANAKGL LAGP SLVI
Sbjct: 67  LEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVI 126

Query: 118 GYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPL 177
           GY MVSF+TYF++QAAGEM VTYPTLPG FN Y SIF+SK FGFAT WLFCIQWLTVLPL
Sbjct: 127 GYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPL 186

Query: 178 ELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVI 237
           ELIT+SMT+KYWND INAD                GV+AYGE EFIFNSCKILM+ GF+I
Sbjct: 187 ELITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFII 246

Query: 238 LSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSV 297
           LS+V+NCGGAGVDGYIGGKYWRDPG+FA  + A+RFKG+ ++LV+AYFS+GG+ELF LS+
Sbjct: 247 LSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIELFVLSI 306

Query: 298 NEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAV 357
           NEQ NPR+STP AAK+S               GFNVPHN+DQLMG+GGSATHASPYVLA 
Sbjct: 307 NEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAA 366

Query: 358 SIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRA 417
           SIH V+V+PHIINAVILISV SVANSALYA+PRL+ SLA+QGYAPK+ NY+DREGRPLRA
Sbjct: 367 SIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRA 426

Query: 418 LILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLN 477
           L++CS+ GV+ F ACS QEE  FTWLAAIAGLSELFTWS I+LSH+RFR AMK QG+SL+
Sbjct: 427 LVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLD 486

Query: 478 ELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFY 537
           E+GY + TGIWGS YG FFN+LVF+AQFWVALSP G+ G   A+AFFESYLA P+W+F Y
Sbjct: 487 EVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMY 546

Query: 538 LGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
           +GYM+Y RDFTFL  L KIDLD HRR+YDPE++RQEDEE KER++N     ++  FWC
Sbjct: 547 VGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKNSSIFVRVYKFWC 604

>YBR068C (BAP2) [258] chr2 complement(373821..375650) Branched-chain
           amino acid permease, also transports alanine and
           aromatic and sulfur containing amino acids [1830 bp, 609
           aa]
          Length = 609

 Score =  823 bits (2125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/601 (66%), Positives = 463/601 (77%), Gaps = 8/601 (1%)

Query: 3   SSKKNETSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAE------ 56
           SS K ETSP+  SI S +      +   E              +RF DSFKRAE      
Sbjct: 9   SSGKKETSPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRT 68

Query: 57  --VNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPAS 114
             +N N  DLEDG  SI SD  LKK+MKSRHV+MMSLGTGIGTGLLVANAKGL+  GPA+
Sbjct: 69  KQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAA 128

Query: 115 LVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTV 174
           L+IGY +VSF TYF+IQAAGEMAVTYPTLP  FN Y+SIF+SK FGFATVWL+C QWLTV
Sbjct: 129 LIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTV 188

Query: 175 LPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGG 234
           LPLELITASMTI++ NDKIN D                GV+AYGE EFIFN CKILMI G
Sbjct: 189 LPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAG 248

Query: 235 FVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFA 294
           F+ILSIV+NCGGAG DGYIG  YW +PGAFA D +  RFK V ++LVTAYFS+GG+ELFA
Sbjct: 249 FIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFA 308

Query: 295 LSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYV 354
           LSV EQ NPR+STP AAK+S               GFNVP+N DQLMGAGGSATHASPYV
Sbjct: 309 LSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYV 368

Query: 355 LAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRP 414
           LA SIHGVK+VPHIINAVILISV SVANS+LYA PRL+ SLA+QGYAPK+ +YVDREGRP
Sbjct: 369 LAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRP 428

Query: 415 LRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGK 474
           LRALI+C +FGVIAF A S +EE++FTWLAAIAGLSELFTW+SI+LSH+RFR AMK QG+
Sbjct: 429 LRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGR 488

Query: 475 SLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWL 534
           SL+ELGY + TGIWGS+YG FFN+LVF+AQFWVAL+P G+ G   AE+FF++YLAFP+WL
Sbjct: 489 SLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWL 548

Query: 535 FFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFW 594
            FY GYM+Y+RDFT L  L KIDLD HRR+YDPEL+RQEDEE KE++RN    +K  +FW
Sbjct: 549 AFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRNMSLMRKAYHFW 608

Query: 595 C 595
           C
Sbjct: 609 C 609

>Scas_569.5
          Length = 593

 Score =  820 bits (2117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/578 (68%), Positives = 454/578 (78%), Gaps = 1/578 (0%)

Query: 18  SSTLKTPNVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAEVNHNGIDLEDGTNSIQSDDNL 77
           SST   PN  E      D T        +RFVDSFKRA+ +    DLEDGT  +    +L
Sbjct: 17  SSTEYLPNELESPSFNLDATEESRSGLVHRFVDSFKRAQDSTEN-DLEDGTKPLGDASHL 75

Query: 78  KKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMA 137
           KKAMKSRHVIMM +GTGIGTGLLVANA GL   GP SLVIGY +VSF+TYF+IQAAGEMA
Sbjct: 76  KKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAGEMA 135

Query: 138 VTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADX 197
           V YPTLPG FN+Y S+F+SKPFGFATVWLF IQWLTV PLELITAS+TIKYWNDKINAD 
Sbjct: 136 VAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYWNDKINADV 195

Query: 198 XXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKY 257
                          GV+AYGEAEFIFNSCK+LMI GF+ILSIV+NCGGAG DGYIG KY
Sbjct: 196 FIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYIGAKY 255

Query: 258 WRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXX 317
           WRDPG+FA  ++  +FKG+ ++LVTAYFSYGG ELF+LSVNEQENPR+STP AAKQS   
Sbjct: 256 WRDPGSFAEGDSVEKFKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQAAKQSIYR 315

Query: 318 XXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISV 377
                       GFNVPHN+DQLMG+GGSATHASPYVLA SIHGVKVVPH INAVILISV
Sbjct: 316 ILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHGVKVVPHFINAVILISV 375

Query: 378 TSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEE 437
            SVANSALYASPRL+ SLAEQGYAPK+ +YVDREGRPLRALILC++FGVI F + S +EE
Sbjct: 376 ISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVIGFVSASSKEE 435

Query: 438 VIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFN 497
            +FTWLAAIAGLSELFTWS I+LSHVRFR  MK  G+S  E+G+ ++TGIWGS+YG  FN
Sbjct: 436 EVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGIWGSMYGISFN 495

Query: 498 VLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKID 557
           +LVFIAQFWVAL+PP   G   AE+FF+SYLA P+WLFFY GYMLY RDFTFL  L KID
Sbjct: 496 MLVFIAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLFFYFGYMLYKRDFTFLVPLDKID 555

Query: 558 LDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
           L+ HRR+YDPEL+RQEDEE KE+I+N     ++ +FWC
Sbjct: 556 LNFHRRIYDPELIRQEDEENKEKIKNSSVWVRMFHFWC 593

>CAGL0H08393g 821998..823836 highly similar to sp|P41815
           Saccharomyces cerevisiae YDR046c PAP1, hypothetical
           start
          Length = 612

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/600 (63%), Positives = 444/600 (74%), Gaps = 17/600 (2%)

Query: 4   SKKNETSPEVNSITSSTLKTP-------NVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAE 56
           SK N+   E N I               N+  +F+       VK+R H   F+DSFKRA+
Sbjct: 22  SKSNDYVHEQNHIIEGDYDDDDKSSSSHNLRSRFD-----VQVKNR-HLQGFIDSFKRAD 75

Query: 57  VNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLV 116
            + +  DLE  T + Q     KK MKSRHVIMMSLGTGIGTGLLV+N KGL LAGPASLV
Sbjct: 76  DSPDHNDLEKTTTAHQEQ---KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLV 132

Query: 117 IGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLP 176
           I Y +VSF+TYF+IQAAGEMAVTYPTLPG FN Y S F+SKPFGFAT WLFCIQWLTVLP
Sbjct: 133 IAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLP 192

Query: 177 LELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFV 236
           LELITA+MTIKYWN  I+ D                GV+AYGE EFIFN+CKILMIGGF+
Sbjct: 193 LELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFI 252

Query: 237 ILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALS 296
           I +IVVNCGGAG DGYIGGKYW DPGAFAS N ASRFKG+ + LV AYFSYGG ELF LS
Sbjct: 253 IFAIVVNCGGAGKDGYIGGKYWHDPGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLS 312

Query: 297 VNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGA-GGSATHASPYVL 355
           VN+Q+NPR+STPAAAK +               GF VPHNS +L+GA GG+  HASPYVL
Sbjct: 313 VNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVL 372

Query: 356 AVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPL 415
           A SIHG+KVVPHIINAVILI++ SVANS+LYA PRLL SLA+QGYAP++ +YVDR GRPL
Sbjct: 373 AASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPL 432

Query: 416 RALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKS 475
            AL+L ++ GVI F A S +EE +FTWLAAI+GLSELFTW+SI+ SH+RFR AMK Q KS
Sbjct: 433 TALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKS 492

Query: 476 LNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLF 535
           L+ LGY + TG+WGS +G  FN+LVF AQFWVALSPP S G   A +FF SYLA P+WL 
Sbjct: 493 LDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLV 552

Query: 536 FYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
           FY GYM + +DFT LTDL ++DLDNHR++YDPE LRQED E KER+RN  +  K+  FWC
Sbjct: 553 FYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRNSSFLVKIYEFWC 612

>CAGL0L07546g complement(831824..833728) highly similar to sp|P38084
           Saccharomyces cerevisiae YBR068c BAP2 or sp|P41815
           Saccharomyces cerevisiae YDR046c PAP1, start by
           similarity
          Length = 634

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/624 (62%), Positives = 460/624 (73%), Gaps = 31/624 (4%)

Query: 3   SSKKNETSPEVN----SITSSTLKTPNVTEKFEPYPDTTAVKH--RTHF-NRFVDSFKRA 55
           SSKK  T+ E      S         N  +  +   D T+++   RT   +RFVDSFKRA
Sbjct: 11  SSKKESTAEEFTIPEYSRDDGEKYAGNSNDYSQRDSDNTSIESEPRTKLVHRFVDSFKRA 70

Query: 56  ----------EVNHNG------------IDLEDGT-NSIQSDDNLKKAMKSRHVIMMSLG 92
                     E+ +NG            +DLE    +SI ++ +LKKAMKSRHV+MMSLG
Sbjct: 71  QDVPTGRKSKEIGNNGGSKTKGGFEEDSLDLEGSDHDSIITNTHLKKAMKSRHVMMMSLG 130

Query: 93  TGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYAS 152
           TGIGTGLLVANAKGL+  GPA+LVIGY +VSF+TYF+IQAAGEMAVTYPTLPG FN Y+S
Sbjct: 131 TGIGTGLLVANAKGLHFGGPAALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPGNFNAYSS 190

Query: 153 IFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXX 212
           IFVS  FGFATVW+FCIQWLTVLPLELITAS+TIKYWNDKINAD                
Sbjct: 191 IFVSNAFGFATVWIFCIQWLTVLPLELITASLTIKYWNDKINADVFIVIFYVFLLCIHLF 250

Query: 213 G-VRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAAS 271
           G V AYGE EF+FN CKILM+ GF+I+SIV+N GGAG   YIGGK+W DPGAFA   A S
Sbjct: 251 GGVIAYGETEFLFNLCKILMVIGFIIMSIVINAGGAGNREYIGGKFWHDPGAFAGKTAGS 310

Query: 272 RFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGF 331
           RFKG+ +VLV+ YFSYGG ELFALSVNEQ NPRRSTP A+K S               GF
Sbjct: 311 RFKGICYVLVSGYFSYGGTELFALSVNEQSNPRRSTPQASKSSLYRILIIYLLTMILIGF 370

Query: 332 NVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRL 391
           NVP++SD+LMG+GGSATHASPYVLA S++GVK+ PH INAVILISV SVANS+LYA+PRL
Sbjct: 371 NVPYDSDELMGSGGSATHASPYVLAASLNGVKIAPHFINAVILISVISVANSSLYAAPRL 430

Query: 392 LRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSE 451
           + SLA+QGYAPK+ +YVDR+GRPL ALI C + GVI F A S +EE +FTWLAAIAGLSE
Sbjct: 431 MCSLAQQGYAPKFLDYVDRQGRPLLALIACLLVGVIGFVAASPKEEEVFTWLAAIAGLSE 490

Query: 452 LFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSP 511
           LFTWSSI+LSHVRFR+AMK Q +SL ELGY + TGI+GS+YG  FN+LVF AQFW AL P
Sbjct: 491 LFTWSSIMLSHVRFRMAMKLQNRSLEELGYKATTGIYGSIYGVCFNLLVFAAQFWTALFP 550

Query: 512 PGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLR 571
            G  G  +A +FF +YLA P+WL FY GYML++RDF  L  L KIDLD HRR+YDPEL+R
Sbjct: 551 FGGDGKANANSFFANYLAMPIWLVFYFGYMLWTRDFQLLKPLDKIDLDFHRRIYDPELMR 610

Query: 572 QEDEETKERIRNGGWTQKLLNFWC 595
           QEDEE+KER+RNG +  ++ +FWC
Sbjct: 611 QEDEESKERLRNGSFMMRMYHFWC 634

>AGR038C [4348] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C
           (BAP2) - SH] (777535..779277) [1743 bp, 580 aa]
          Length = 580

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/551 (60%), Positives = 413/551 (74%), Gaps = 2/551 (0%)

Query: 45  FNRFVDSFKRAEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANA 104
           F RFVDSF+R + + +G DLEDG  +      L++ M++RHV+MMSLGTGIGTGLLVANA
Sbjct: 32  FRRFVDSFRREDTSRSG-DLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANA 90

Query: 105 KGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATV 164
             L+  GPA L+IGY +VS ++Y ++ AAGEMAV YPTLPG FN Y+SIF+SKPFGFATV
Sbjct: 91  ASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATV 150

Query: 165 WLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIF 224
           WLFC+QWLTV PLELITA++ IKYW   +NA+                G R YGE EFIF
Sbjct: 151 WLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIF 210

Query: 225 NSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAY 284
           N CK+LMI GFVI+ I++N G  G  GYIG +YWR+PG+F S     + KG A+VLVTAY
Sbjct: 211 NMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAY 270

Query: 285 FSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAG 344
           FS+GG+EL+ALSVNE  NP+ + P+A K+                GF VPH+SD+LMG+G
Sbjct: 271 FSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSG 330

Query: 345 GSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKY 404
            +  H SPYVLA+ +HGVKV+PHI+NAVILISV SV NSA+Y++PRLL +LA+QGYAPK 
Sbjct: 331 SNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQ 390

Query: 405 FNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVR 464
            +Y+DREGRPL +LILC+IFG+IAF A SD +E IF WLAAIAGLSELFTW+SI LSH R
Sbjct: 391 LDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFR 450

Query: 465 FRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFF 524
           FR AMK QG+SL  LGY +ITG WGSLY  FFN+LVFIAQFWVAL P   K V    +FF
Sbjct: 451 FRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKV-DVLSFF 509

Query: 525 ESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNG 584
           ++Y+AFP+WL  +LGYM+YSR++T L  L K+DLD HRR+YD E+L+QE+ E KER+RN 
Sbjct: 510 QNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRNS 569

Query: 585 GWTQKLLNFWC 595
            W  K+LNFWC
Sbjct: 570 PWYVKVLNFWC 580

>Kwal_27.10538
          Length = 602

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/561 (60%), Positives = 414/561 (73%), Gaps = 6/561 (1%)

Query: 40  KHRTHFNRFVDSFKRAEVNH---NGIDLEDGT-NSIQSDDNLKKAMKSRHVIMMSLGTGI 95
           ++R  + RFV+SFKRAE +    NG DLE  T +S+ S   LK+++K RHV MMS+ TGI
Sbjct: 43  ENRNAWGRFVNSFKRAEKHSTPSNG-DLEHATTHSVASSSPLKRSIKPRHVAMMSICTGI 101

Query: 96  GTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFV 155
           GTGLLVAN K L   GPA L+IGY  VS + Y ++QAAGEMAV YP+LPG FN Y+S  +
Sbjct: 102 GTGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLI 161

Query: 156 SKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVR 215
           S+PFGFATVWL+CIQWLTVLPLELITAS+TIKYWND INAD                G R
Sbjct: 162 SRPFGFATVWLYCIQWLTVLPLELITASLTIKYWNDSINADVFIAIFYVFILFIHFFGSR 221

Query: 216 AYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKG 275
            YGE+EFIF  CK+LMI GFVILSIV+NCGGAG   YIG KYW DPGAFA  + A++FKG
Sbjct: 222 GYGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIGAKYWYDPGAFAVGSGATKFKG 281

Query: 276 VAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPH 335
           VA+VLVT YFSYGG EL+A++VNEQ NPRR+  +  KQ                GF VPH
Sbjct: 282 VAYVLVTGYFSYGGTELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPH 341

Query: 336 NSDQLMGAGG-SATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRS 394
            S +LMG+ G SATHASPYVLAVS+HGVK+VPHIINAVILI+V SV NSA+Y+ PR+L +
Sbjct: 342 TSSELMGSSGKSATHASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNT 401

Query: 395 LAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFT 454
           LAEQGYAP++  YVDR GRPL ALI CS+FG++AF A SD EE +FTWLAAIAGLSELFT
Sbjct: 402 LAEQGYAPRFLAYVDRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFT 461

Query: 455 WSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGS 514
           WS+I+LSHVRFR AM+   + L+ELGY + TG+ GS+ G  FN+LVFIAQFWV+++P G 
Sbjct: 462 WSAIMLSHVRFRQAMRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFWVSIAPFGK 521

Query: 515 KGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQED 574
            G     +FF+SYLAFP+W+  + GYM+  R++  +  LK IDLD++R +YD + L QED
Sbjct: 522 DGKLDVLSFFQSYLAFPLWVVLFFGYMIVFRNWEIIKPLKDIDLDHYRSIYDQDRLYQED 581

Query: 575 EETKERIRNGGWTQKLLNFWC 595
            E K  I+N  W +KL NFWC
Sbjct: 582 LEHKILIQNSSWARKLHNFWC 602

>CAGL0B01012g 91330..93201 similar to sp|P25376 Saccharomyces
           cerevisiae YCL025c AGP1 Asparagine/glutamine permease or
           sp|P48813 Saccharomyces cerevisiae YDR508c GNP1,
           hypothetical start
          Length = 623

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/622 (51%), Positives = 407/622 (65%), Gaps = 43/622 (6%)

Query: 3   SSKKNE-TSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAEVNHNG 61
           S K+ E  SP   S+T  T  TPN      P P        + F RFVDSFKRAE  +N 
Sbjct: 16  SDKEVEYMSPREVSVTPETSATPNT-----PAP--------SQFRRFVDSFKRAEQQNNS 62

Query: 62  ----------------------IDLEDGTNSI------QSDDNLKKAMKSRHVIMMSLGT 93
                                  DLE   N +      Q +  LK+ +K RHVI++SLGT
Sbjct: 63  EITSAASCDGSSENLDKDGKEVADLEVQENQVLTEKSNQKNKELKQTIKPRHVILISLGT 122

Query: 94  GIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASI 153
           GIGTGLLV NAK L+ AGPA L+IGY ++    Y +IQAAGE+AV+Y +L GGFN Y S 
Sbjct: 123 GIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQAAGELAVSYSSLSGGFNVYPSF 182

Query: 154 FVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXG 213
            V   FGF+  W++CIQWL V PLEL+TASMTIKYW   +NAD                G
Sbjct: 183 LVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTTVNADIFVGIFYVLIIVINTFG 242

Query: 214 VRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRF 273
            R Y EAEF FN CKILM+ GF IL IV+N GGAG DGYIG +YW  PGAFA D     F
Sbjct: 243 ARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGYIGDRYWHTPGAFAGDRPIDHF 302

Query: 274 KGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNV 333
           KG+   +VTA F++G  E  AL+  EQ NPR++ P+AAK+                GF V
Sbjct: 303 KGIMATMVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLV 362

Query: 334 PHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLR 393
           P++SDQLMG+GGSAT ASPYVLAVS HGVKVVPH INAVIL+SV SV NSA Y+S RLL 
Sbjct: 363 PYDSDQLMGSGGSATKASPYVLAVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLY 422

Query: 394 SLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELF 453
           SLA+QG APK+F+YVDREGRP RA++   +F +I+FCA S +EE +FTWL AI+GLS++F
Sbjct: 423 SLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVF 482

Query: 454 TWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPG 513
           TW +I LSH+RFR AM  Q +SL E+G+ + TG+WGS Y CF  V++ IAQFWVA++P G
Sbjct: 483 TWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGVWGSYYVCFMLVMILIAQFWVAIAPIG 542

Query: 514 SKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQE 573
            +G   A+ FFE+YLA P+ + FY+GY ++ +D++       IDLD HR+++D ELL+QE
Sbjct: 543 -EGKLDAQGFFENYLAMPILILFYVGYKIWKKDWSLFIRANNIDLDKHRQIFDEELLKQE 601

Query: 574 DEETKERIRNGGWTQKLLNFWC 595
           DEE +E+++NGG+ +++  FWC
Sbjct: 602 DEEYREKLKNGGYLKRIAAFWC 623

>CAGL0K05753g 564282..566264 highly similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1, start by
           similarity
          Length = 660

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/621 (51%), Positives = 404/621 (65%), Gaps = 26/621 (4%)

Query: 1   MESSKKNETSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKH-RTHFNRFVDSFKRAEVNH 59
           + S  +  T+  V       +   N+ EK +   +    +  R +  RF+DSFKRAE   
Sbjct: 40  LGSGSRGATTSAVEYFDKENVDGVNIDEKLQSTTEFGGDEMPRGNIRRFIDSFKRAEQQP 99

Query: 60  N-----GIDLE-DGTNSIQ-------------------SDDNLKKAMKSRHVIMMSLGTG 94
           N       DLE D T +I                     ++ LKK++K RHV+M+SLGTG
Sbjct: 100 NQQHNLAEDLENDLTTAISMNSLDRVQNKPTGNGQMKFEEEALKKSIKPRHVVMISLGTG 159

Query: 95  IGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIF 154
           IGTGLLV NAK L+ AGPA LVIGY ++    Y +IQAAGEMAV Y  L GGFN Y S+ 
Sbjct: 160 IGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGGFNTYPSML 219

Query: 155 VSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGV 214
           V   FGFA  W++C+QWL V PLEL+T S+TIKYW   +N D                G 
Sbjct: 220 VDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTTVNPDAFVVIFYVVIIFIQIFGA 279

Query: 215 RAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFK 274
           R Y EAEF FN CKILMI GF IL I++N GGAG DGY+G KYW DPGAF   N   RFK
Sbjct: 280 RGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGAKYWHDPGAFRGTNGIQRFK 339

Query: 275 GVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVP 334
           G+    V+A F++G  E  AL+  EQ NPR++ P+AAK+                GF VP
Sbjct: 340 GIMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRVICIFVGTIALLGFLVP 399

Query: 335 HNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRS 394
            +SDQLMGAGGSAT ASPYVLA+SIHGV+VVPH INAVILISV SVANSA Y+S RLL  
Sbjct: 400 WDSDQLMGAGGSATKASPYVLAISIHGVRVVPHFINAVILISVFSVANSAFYSSSRLLLG 459

Query: 395 LAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFT 454
           LA+QGYAPK+F+YVDR+GRP RA+   ++FGVIAFCA S +E+ +FTWL AI+GLS+LFT
Sbjct: 460 LAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASPKEDQVFTWLLAISGLSQLFT 519

Query: 455 WSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGS 514
           W +I +SH+RFR AM  QG+SL E+G+ +  G++GS Y     VL  IAQFWVA++P G+
Sbjct: 520 WIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYYATIMMVLALIAQFWVAIAPIGN 579

Query: 515 KGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQED 574
            G   AE FFE+YLA P+ + FY GY L+ RD+      K IDLD++R+++D ELL+QED
Sbjct: 580 NGDLDAEGFFENYLAMPILIAFYFGYKLWKRDWRLFIRAKDIDLDSYRQVFDEELLKQED 639

Query: 575 EETKERIRNGGWTQKLLNFWC 595
           EE KE+++NG   +++++FWC
Sbjct: 640 EEYKEKLKNGPMWKRVVDFWC 660

>YDR508C (GNP1) [1322] chr4 complement(1466441..1468432) High
           affinity glutamine permease, may also transports
           leucine, cysteine, methionine, serine, threonine and
           asparagine, member of the amino acid-polyamine-choline
           (APC) family of membrane transporters [1992 bp, 663 aa]
          Length = 663

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/632 (49%), Positives = 403/632 (63%), Gaps = 45/632 (7%)

Query: 7   NETSPEVNSITSSTLKTPNVTEKFEPYPDTT-------AVKHRTHFNRFVDSFKRAEVNH 59
            E  P+   I S  ++  N  E FE   + T          H ++  RF+DSF+RAE +H
Sbjct: 34  KEIQPKEKQIGS--IEPENEVEYFEKTVEKTIENMEYEGEHHASYLRRFIDSFRRAEGSH 91

Query: 60  ---------NG---IDLEDGTNSI------------------------QSDDNLKKAMKS 83
                    NG   I  +D ++ +                        Q  +NLKK++K 
Sbjct: 92  ANSPDSSNSNGTTPISTKDSSSQLDNELNRKSSYITVDGIKQSPQEQEQKQENLKKSIKP 151

Query: 84  RHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTL 143
           RH +MMSLGTGIGTGLLV N+K L  AGP  L+IGY ++    Y +IQA GE+AV Y  L
Sbjct: 152 RHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDL 211

Query: 144 PGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXX 203
            GGFN Y    V    GF+  WLFC+QWL V PLEL+TASMTIKYW   +N D       
Sbjct: 212 IGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVVIFY 271

Query: 204 XXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGA 263
                    G + Y EA+F FN CKILMI GF IL+I+++CGGAG DGYIG KYWRDPGA
Sbjct: 272 VLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGYIGSKYWRDPGA 331

Query: 264 FASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXX 323
           F  D    RFKGV    VTA F++G  E  A++ +EQ NPR++ P+AAK+          
Sbjct: 332 FRGDTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFL 391

Query: 324 XXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANS 383
                 GF VP+ SDQL+GA GSAT ASPYV+AVS HGV+VVPH INAVIL+SV SVAN 
Sbjct: 392 ASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANG 451

Query: 384 ALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWL 443
           A Y S R+L SLA+QG APK F+Y+DREGRP  A+++ ++FGVIAFCA S +EE +FTWL
Sbjct: 452 AFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVIAFCASSKKEEDVFTWL 511

Query: 444 AAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIA 503
            AI+GLS+LFTW +I LSH+RFR AMK QG+SL E+GY S  G+WGS Y     VL  IA
Sbjct: 512 LAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMVLALIA 571

Query: 504 QFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRR 563
           QFWVA++P G  G  SA++FFE+YLA P+W+  Y+ Y ++ +D++      K+DL +HR 
Sbjct: 572 QFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKVWKKDWSLFIPADKVDLVSHRN 631

Query: 564 LYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
           ++D ELL+QEDEE KER+RNG + +++L+FWC
Sbjct: 632 IFDEELLKQEDEEYKERLRNGPYWKRVLDFWC 663

>AGR039C [4349] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C
           (BAP2) - SH] (779726..781486) [1761 bp, 586 aa]
          Length = 586

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/559 (53%), Positives = 380/559 (67%), Gaps = 6/559 (1%)

Query: 41  HRTHFNRFVDSFKRAEVNHNGIDLE--DGTNSI-QSDDNLKKAMKSRHVIMMSLGTGIGT 97
           +R  + RF DSFKRA+V+   +DLE  D  N + ++   LK  +K+RH+ M+SLGTGIGT
Sbjct: 30  NRNAWTRFTDSFKRAQVD-TAVDLEGKDADNGLNKTQQTLKHNIKTRHLTMISLGTGIGT 88

Query: 98  GLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSK 157
           GLLVA+ K L+  GPA LVIGY   S + Y V+QA  E+ V Y TLPG +N Y +  V K
Sbjct: 89  GLLVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDK 148

Query: 158 PFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAY 217
            FGFA   ++ +QW TVLPLEL+TASMT+KYW   +N D                G R Y
Sbjct: 149 GFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGY 208

Query: 218 GEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVA 277
            EAEFIFNS K+L++ GF+I++I +  G A   GYIGG+YW DPGAF  D A  RFKG+ 
Sbjct: 209 AEAEFIFNSLKVLLMAGFIIMAISLTAG-ASEQGYIGGQYWHDPGAFGGDRAIDRFKGIC 267

Query: 278 FVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNS 337
            V V A F+YGG E  AL+  EQ NPR S P A K+                GF VPHNS
Sbjct: 268 SVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNS 327

Query: 338 DQLMGA-GGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLA 396
           DQL+ A GGS + ASP+V+A ++HGV+VVPHIIN +IL SV SV NSA+Y++PR+L SLA
Sbjct: 328 DQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLA 387

Query: 397 EQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWS 456
           E G  PK F YVDR+GRPL  LI  S+FG+IAF A S+QEE +FTWL+AIAGLS+LFTW+
Sbjct: 388 EHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWT 447

Query: 457 SILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKG 516
           +I +SHVRFR AM+ QG+SL ELGY + TG  GS Y  FFNV+V IAQFW+A++P    G
Sbjct: 448 AIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHG 507

Query: 517 VYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEE 576
               E FF++YLAFPV + FYLGY L+ RDF  +    ++DL +HR+++D E+L QE+ E
Sbjct: 508 ELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAE 567

Query: 577 TKERIRNGGWTQKLLNFWC 595
            KER+RN    ++LL+FWC
Sbjct: 568 RKERLRNSTLFKRLLDFWC 586

>Kwal_33.13204
          Length = 607

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/599 (49%), Positives = 394/599 (65%), Gaps = 16/599 (2%)

Query: 1   MESSKKNETSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAE---V 57
           M+  K N  S  V  I+      P    KF  + D +    ++ F RF  +F RA+    
Sbjct: 21  MQELKSNTGSESVERIS-----LPGDDYKF--HEDDS----KSRFRRFARTFHRADGLGD 69

Query: 58  NHNGIDLEDGTN-SIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLV 116
             +G D+E G   + Q++  LK+ +  RHV MMSLGTGIGTG+LV N K L+  GPA LV
Sbjct: 70  GASGNDVEFGAEVARQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLV 129

Query: 117 IGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLP 176
           IGY ++    Y +IQAAGE+AV+Y +L G FN Y S+ + + FGF+  W++C+QWL VLP
Sbjct: 130 IGYAIMGSCLYCIIQAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLP 189

Query: 177 LELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFV 236
           LEL+TAS+TIKYW   +N D                G R Y EAEF FN CK+LMI GF 
Sbjct: 190 LELVTASITIKYWTTSVNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFF 249

Query: 237 ILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALS 296
           IL I+VNCGGAG DGYIGG+YW +PGAF        FKG+   +VTA F++G  E  AL+
Sbjct: 250 ILGIIVNCGGAGNDGYIGGRYWNNPGAFYGTKPIHHFKGIISTMVTAAFAFGATEFIALT 309

Query: 297 VNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLA 356
             EQ NPRR+ P+AAK+                GF VPHNS +LMG+G SATHASPYV+A
Sbjct: 310 AAEQANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHASPYVIA 369

Query: 357 VSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLR 416
           V+ HGV+VVPH INAVIL+SV SV NSA Y+S RLL +LA+Q YAP +  ++DR GRP+R
Sbjct: 370 VASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMR 429

Query: 417 ALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSL 476
           A+++  +FG+I+F A S +EE +FTWL AI+GLS+LFTW SI +SH+RFR A+  QGK +
Sbjct: 430 AMLVSCVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPI 489

Query: 477 NELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFF 536
            ELGY S TG+ GS Y  F    + I QFWVA++P GS  +  A +FFE+YLA P+++  
Sbjct: 490 GELGYKSQTGVAGSYYATFIMGCILIGQFWVAIAPMGSAKL-DANSFFENYLALPLFVVL 548

Query: 537 YLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
           Y G+ ++ RD+     L++IDLD+HR+ +D ELL+QED E +E IRN GW +++ ++WC
Sbjct: 549 YFGFKIWKRDWRLYIPLEQIDLDSHRKTFDEELLKQEDAEYEENIRNKGWLRRIAHYWC 607

>Kwal_33.13215
          Length = 598

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/598 (50%), Positives = 398/598 (66%), Gaps = 16/598 (2%)

Query: 7   NETSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAEVNHNGIDLED 66
           N  SP+ N +  S   +  V ++  P  D+   +    F RF DSF+R E  HNG   + 
Sbjct: 8   NMKSPD-NGVVES-FDSVEVLKEESPRSDS---RSDGLFRRFADSFRRHEA-HNGGGGDG 61

Query: 67  GT---------NSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVI 117
                       S      LK+ ++ RHV+M+SL TGIGTG+LV N K L+  GPASLVI
Sbjct: 62  DDEDHEGLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVI 121

Query: 118 GYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPL 177
           GY +VS + Y VIQ+A E+A+ Y +L GGFN Y S+ V K FGF+  W++C+QWL VLPL
Sbjct: 122 GYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPL 181

Query: 178 ELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVI 237
           EL+TASMTIKYWN  IN D                G   Y EAEF FN CK+LMI GF I
Sbjct: 182 ELVTASMTIKYWNQTINPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFI 241

Query: 238 LSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSV 297
           L I++NCGGAG DGY+G +YW DPGAF   ++ +RFKG+  VLV A F+YGG E   L+ 
Sbjct: 242 LGIIINCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTA 301

Query: 298 NEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAV 357
            EQ+NP++S  +A+K+                GF VP NSD+L+G+GGSATHASP+V+AV
Sbjct: 302 AEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAV 361

Query: 358 SIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRA 417
           + HGV+VVPH INAVIL+SV SVANSALY+S R+L SL+EQG+AP++ NYVDR GRP+  
Sbjct: 362 ASHGVRVVPHFINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLC 421

Query: 418 LILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLN 477
           L++  +FG+++F A S +EE +FTWL AI+GLSELFTW SI LSHVR R AM  QG+S +
Sbjct: 422 LLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSAD 481

Query: 478 ELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFY 537
           ELGY++ TG+WG+ Y     V + + QFWVA+SP GS  +  A  FFE+YLA P+ +F Y
Sbjct: 482 ELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKL-DANNFFENYLAMPILIFLY 540

Query: 538 LGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
           LGY +++RD+  L    ++DL  HR+++D E+LR E  E KE++R+  WT +L NFWC
Sbjct: 541 LGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598

>Scas_517.2
          Length = 679

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/642 (48%), Positives = 394/642 (61%), Gaps = 50/642 (7%)

Query: 4   SKKNETSPEVNSI-TSSTLKTPNVTEKF-EPYPDTTAV--------------KHRTHFNR 47
           S+  +  P+   I T+S  +  N+ E F E   D T+               +H T  +R
Sbjct: 38  SEMKDVKPKEREIGTASITEQENIIEYFGEKSNDDTSSSPVTRQYVSGADFEEHTTKPSR 97

Query: 48  ---FVDSFKRAE-----VNHNGI----DLE-------DGT------------NSIQSDDN 76
              F+DSFKRAE     VN+NG     DLE       DGT            N     D 
Sbjct: 98  IRNFMDSFKRAEQHPTNVNNNGANSESDLENMILYNEDGTPKPLPHHHDAQINDNSKSDE 157

Query: 77  LKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEM 136
           LKK +K RHV+M+SLGTGIGTGLLV     L  AGPA L+IG+ ++    Y +IQA GE+
Sbjct: 158 LKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQAVGEL 217

Query: 137 AVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINAD 196
           AV Y  L GGFN Y S  V + F FA  WL+ IQWL V PLEL+TASMTIKYW  K++ D
Sbjct: 218 AVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTKVDPD 277

Query: 197 XXXXXXXXXXXXXXXXGVRA-YGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGG 255
                           G  A Y EAEFIFNSCKI+M+ GF IL I V CGGAG DGYIG 
Sbjct: 278 IFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDGYIGA 337

Query: 256 KYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSX 315
           KYW DPGA   D +  RFKG    LV A F++G  E   ++ +EQ NPR++ P+AAK+  
Sbjct: 338 KYWHDPGALRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMI 397

Query: 316 XXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILI 375
                         GF VP+NSDQL+G+ GS   ASPYVLA+S HGV+VVPH INAVILI
Sbjct: 398 YRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAISTHGVRVVPHFINAVILI 457

Query: 376 SVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQ 435
           SV SVANSA Y+S R+L SLAEQGYAPK ++Y+DREGRPL  +   +IFGVIAFCA S +
Sbjct: 458 SVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGVIAFCATSPK 517

Query: 436 EEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCF 495
           E+ +F WL AI+GLS+LFTW +I +SH+RFR AM  QG+S+ ELG+ S  G +GS Y   
Sbjct: 518 EDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVGWYGSAYAAI 577

Query: 496 FNVLVFIAQFWVALSPPGSKGVYSAEA--FFESYLAFPVWLFFYLGYMLYSRDFTFLTDL 553
              ++ IAQFWVAL P  +      +A  FFE+YLA P+ L FY GY ++ +D+      
Sbjct: 578 MMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGYKIWKKDWKLFIRA 637

Query: 554 KKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
           K IDL +HR ++D EL++QE++E +ER+R G   +++ +FWC
Sbjct: 638 KNIDLISHRNIFDEELIKQEEDEYRERLRTGPKWRRVYDFWC 679

>KLLA0C01606g complement(123485..125347) similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1 high-affinity
           glutamine permease, start by similarity
          Length = 620

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/576 (50%), Positives = 378/576 (65%), Gaps = 12/576 (2%)

Query: 27  TEKFEPYPDTTAVKHRTHFNRFVDSFKRAE-VN---HNGIDLE-DGTNSI--QSDDNLKK 79
           ++  E Y   ++V HR     F DSFKRA+ +N   H   +LE + + S+  +   +LK+
Sbjct: 50  SQSDEEYAAKSSVWHR-----FKDSFKRADHINTNIHGNAELELNPSQSLLPEKGASLKR 104

Query: 80  AMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVT 139
            +K RHV+MMSL TGIGTGLLV N K L   GPA L IGY ++    Y +IQAAGE+AV 
Sbjct: 105 DIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQAAGELAVA 164

Query: 140 YPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXX 199
           YPTL G FNNY S  V     FAT  L+CIQWL V PLE+I+A++TIKYWN  IN +   
Sbjct: 165 YPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTSINPNVWC 224

Query: 200 XXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWR 259
                        G   Y EA+F FN+CKILM  GF IL I++NCGGAG   YIGGKYW 
Sbjct: 225 VIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVYIGGKYWN 284

Query: 260 DPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXX 319
           DPGAF  D   SRFK +   LVTA F++G  E  AL+ +EQ NPR++ P+AAKQ      
Sbjct: 285 DPGAFNGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAIPSAAKQVLYRII 344

Query: 320 XXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTS 379
                     GF VP+NS +LMG+G S+ H+SPYV+AV+ HGVKVVP  INAVILISV S
Sbjct: 345 AIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVPSFINAVILISVLS 404

Query: 380 VANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVI 439
           V N + Y+S R+L  L+E GYAPK+F YVDR+GRPL A+I+ ++ G I F + S  EE +
Sbjct: 405 VGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCICFVSASSAEESV 464

Query: 440 FTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVL 499
           FTWL A++GLS+LFTW++I +SHVRFR AM+ Q +S+ ELG+ S  G+WGS YG F  +L
Sbjct: 465 FTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGVWGSYYGIFMMIL 524

Query: 500 VFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLD 559
           VFI QFWVAL P G      AE FF +YLA PV+L  Y G+ ++ +D+       +IDL 
Sbjct: 525 VFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFKIWKKDWRLYIPASEIDLI 584

Query: 560 NHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
           +HR+++D E+L+QEDEE K ++++     KL NFWC
Sbjct: 585 SHRKIFDEEILKQEDEEYKIKMKHASIWVKLSNFWC 620

>YCL025C (AGP1) [519] chr3 complement(76131..77918) Broad substrate
           range amino acid permease with high affinity for
           asparagine and glutamine [1788 bp, 595 aa]
          Length = 595

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/541 (51%), Positives = 355/541 (65%), Gaps = 35/541 (6%)

Query: 35  DTTAVKHRTHFNRFVDSFKRA----------------------------EVNHNGIDLED 66
           +T+AV+      RF DSFKRA                            E+  N      
Sbjct: 52  NTSAVR------RFFDSFKRADQGPQDEVEATQMNDLTSAISPSSRQAQELEKNESSDNI 105

Query: 67  GTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFIT 126
           G N+    D+LKK ++ RHV+M++LGTGIGTGLLV N   L  AGPA L+IGY ++  I 
Sbjct: 106 GANTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSIL 165

Query: 127 YFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTI 186
           Y +IQA GEMA+ Y  L GG+N Y S  V   FGFA  W++C+QWL V PLEL+TASMTI
Sbjct: 166 YCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTI 225

Query: 187 KYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGG 246
           KYW   +N D                G R Y EAEF FN CKILM+ GF IL I+++ GG
Sbjct: 226 KYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGG 285

Query: 247 AGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRS 306
           AG DG+IGGKYW DPGAF   +A  RFKGVA  LVTA F++GG E  A++  EQ NPR++
Sbjct: 286 AGNDGFIGGKYWHDPGAFNGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKA 345

Query: 307 TPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVP 366
            P AAKQ                GF VP+NSDQL+G+ G  T ASPYV+AV+ HGV+VVP
Sbjct: 346 IPGAAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVP 405

Query: 367 HIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGV 426
           H INAVIL+SV S+ANS+ Y+S RL  +L+EQGYAPK F+Y+DR GRPL A+ + ++F V
Sbjct: 406 HFINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAV 465

Query: 427 IAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITG 486
           IAFCA S +EE +FTWL AI+GLS+LFTW++I LSH+RFR AMK QG+SL ELG+ S TG
Sbjct: 466 IAFCAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTG 525

Query: 487 IWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRD 546
           +WGS Y C   +L+ IAQFWVA++P G +G   A+AFFE+YLA P+ +  Y+GY ++ +D
Sbjct: 526 VWGSAYACIMMILILIAQFWVAIAPIG-EGKLDAQAFFENYLAMPILIALYVGYKVWHKD 584

Query: 547 F 547
           +
Sbjct: 585 W 585

>AFR698C [3891] [Homologous to ScYDR508C (GNP1) - SH; ScYCL025C
           (AGP1) - SH] (1725946..1727775) [1830 bp, 609 aa]
          Length = 609

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/594 (48%), Positives = 367/594 (61%), Gaps = 15/594 (2%)

Query: 12  EVNSITSSTLKTPNVTEKFEPYPDTTAVK--------HRTHFNRFVDSFKRAEVNHNGID 63
           E+  I S  + T   TE FE    T+A K          T F RF+ SFKRA  +     
Sbjct: 21  ELKDIKSGKVVTTETTEFFE---KTSAQKSDFEYLEGDDTRFKRFLSSFKRAHGSGGTDT 77

Query: 64  LEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVS 123
              G  + +  +NLK+ +KSRH+IM+SLGTGIGTGLLV +   L+  GPA   IG+ ++ 
Sbjct: 78  EGGGGQNAK-HENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMG 136

Query: 124 FITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITAS 183
              Y VIQAAGE+AV Y +L GGFN Y S  +    GFAT W++C+QWL V PLEL+TAS
Sbjct: 137 LCVYCVIQAAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTAS 196

Query: 184 MTIKYW--NDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIV 241
           +TIK+W  +  +N D                G R Y EAEF FNSCK+LM+ GF I+ I+
Sbjct: 197 ITIKFWPGSRSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGIL 256

Query: 242 VNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQE 301
           +N G  G  GYIGGKYWRDPG+         FKG+   LV A FS G  E  AL+  EQ 
Sbjct: 257 INTGAVGTSGYIGGKYWRDPGSLGGRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQA 316

Query: 302 NPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAVSIHG 361
           NPR+S PAAAK+                GF VP +S +LMG+  S  H SPYV+AV +HG
Sbjct: 317 NPRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHG 376

Query: 362 VKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILC 421
           V VVP  INAVIL+SV SV NSA Y+S RLL SLAEQ YAPK F Y+DR GRPL A+I+ 
Sbjct: 377 VNVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIIS 436

Query: 422 SIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGY 481
            +FG I F A S +EE +F WL AI+GLS+LFTWS+I LSH+RFR A+  QG S +ELG+
Sbjct: 437 ILFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGF 496

Query: 482 ISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYM 541
            + TGI GS       VL  I QFWV+L P G+     AE+FF  YLA P++L FY GY 
Sbjct: 497 KAQTGIIGSYVSAIMMVLALIGQFWVSLVPMGATEP-DAESFFTGYLAMPMFLLFYFGYK 555

Query: 542 LYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
           ++++D+       +IDL +HRR++D ++L+QED E + ++RN     ++ NFWC
Sbjct: 556 IWNKDWRLFIRADQIDLVSHRRIFDADVLKQEDIEYRAKLRNSSIWHRIANFWC 609

>AGR040C [4350] [Homologous to ScYBR069C (TAT1) - SH]
           (782289..784010) [1722 bp, 573 aa]
          Length = 573

 Score =  530 bits (1365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/585 (46%), Positives = 374/585 (63%), Gaps = 20/585 (3%)

Query: 14  NSITSSTLKTPNVTEKFEPYPDTTAVKHRTHFNR-FVDSFKRA-EVN-HNGIDLEDGTNS 70
           +SI+SS  K      K  P    +  + RT   R F+DSF+R  +V+     D EDGT +
Sbjct: 6   SSISSS--KKDESYVKVSPNTVGSGDERRTGIMRGFIDSFRRGRDVDLMCKADAEDGTTA 63

Query: 71  IQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVI 130
                 +KK +K+RH++M++LGTGIGTGLLV N   L  AGPA L++GY + S + Y ++
Sbjct: 64  -----KMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIV 118

Query: 131 QAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWN 190
           +AAGE+ + Y  + G +  Y+S+ V    GF+  W++CIQW+TV PL+L+TA+M I+YW 
Sbjct: 119 EAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWT 178

Query: 191 DKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVD 250
           D IN D                G + Y EAEF FN CK+LMI GFVIL +V+NCGGAG  
Sbjct: 179 D-INPDIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTS 237

Query: 251 GYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAA 310
           GYIG KYW +P  F +      FKG+ FV   A F+YGG+E+  LS +EQENPR+S  +A
Sbjct: 238 GYIGDKYWHEPRPFMNG-----FKGLCFVFCYAAFAYGGIEVMVLSASEQENPRKSISSA 292

Query: 311 AKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIIN 370
            K+                 F VP +   L   G   + ASP V+AVS HGVK+VPHIIN
Sbjct: 293 CKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEG---SRASPLVIAVSFHGVKIVPHIIN 349

Query: 371 AVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFC 430
           AVILI+V SV NS+LY++PRLL SLAEQGYAPK F Y+DR+GRPL A  +  +FG++AF 
Sbjct: 350 AVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGLLAFL 409

Query: 431 ACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGS 490
           A S  ++ +F WL AI+GLS++F W SI +SH+RFR AMKAQG+S+ E+GY + TG WGS
Sbjct: 410 AASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKARTGYWGS 469

Query: 491 LYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFL 550
                   L+ IAQFWVA+SP  +KGV  A +FF+SYLAFP+ L  Y GY +Y +D+   
Sbjct: 470 WIAVVTAFLILIAQFWVAISPVETKGV-DARSFFQSYLAFPILLLAYFGYKIYHKDWRIC 528

Query: 551 TDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
               ++DL +HR+++D + L+QED E K ++++     ++ +FWC
Sbjct: 529 IPASEVDLISHRQVFDEDELKQEDLEWKLKLKSSPIWVRIYHFWC 573

>YBR069C (TAT1) [259] chr2 complement(376534..378393) Amino acid
           permease that transports valine, leucine, isoleucine,
           tyrosine, tryptophan, and threonine, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1860 bp, 619 aa]
          Length = 619

 Score =  510 bits (1313), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 277/596 (46%), Positives = 360/596 (60%), Gaps = 36/596 (6%)

Query: 25  NVTEKFEPYPDTTAVKHRT--------HFNRFVDSFKRAEVNHNGIDLEDGTNSIQSDDN 76
            +TEK +     TA   RT            F DSFKR        +LE      Q  +N
Sbjct: 35  TITEKQDEVSGQTAEPRRTDSKSILQRKCKEFFDSFKRQLPPDRNSELES-----QEKNN 89

Query: 77  LKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEM 136
           L K++KSRH++M+SLGTGIGTGLLV N + L  AGPA LV+GY + S + Y +IQAAGE+
Sbjct: 90  LTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQAAGEL 149

Query: 137 AVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINAD 196
            + Y  L G +  Y SI V    GFA   ++ IQWLTVLPL+L+TA+MT+KYW   +NAD
Sbjct: 150 GLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTS-VNAD 208

Query: 197 XXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGK 256
                           G R Y EAEFIFNSCKILM+ GFVIL+I++NCGGAG   YIG +
Sbjct: 209 IFVAVVFVFVIIINLFGSRGYAEAEFIFNSCKILMVIGFVILAIIINCGGAGDRRYIGAE 268

Query: 257 YWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXX 316
           YW +PG FA       FKGV  V   A FSYGG+E+  LS  EQENP +S P A K+   
Sbjct: 269 YWHNPGPFAHG-----FKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNACKKVVY 323

Query: 317 XXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHAS-PYVLAVSIHGVKVVPHIINAVILI 375
                         F VP+NSD+L+G+  S+   + P+V+AV+ HGVKVVPH INAVILI
Sbjct: 324 RILLIYMLTTILVCFLVPYNSDELLGSSDSSGSHASPFVIAVASHGVKVVPHFINAVILI 383

Query: 376 SVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQ 435
           SV SVANS+LY+ PRLL SLAEQG  PK   YVDR GRPL    +  +FG I F A SD 
Sbjct: 384 SVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFFVSLVFGCIGFVATSDA 443

Query: 436 EEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCF 495
           EE +FTWL AI+ LS+LF W S+ LSH+RFR AM  QG+S+NE+GY + TG WGS     
Sbjct: 444 EEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQTGYWGSWLAVL 503

Query: 496 FNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKK 555
             +   + QFWVA++P    G  + + FF++YLA P+ LF Y G+ +Y + ++F    +K
Sbjct: 504 IAIFFLVCQFWVAIAPVNEHGKLNVKVFFQNYLAMPIVLFAYFGHKIYFKSWSFWIPAEK 563

Query: 556 IDLDNHRRLY-DPELLR----QEDEETKE-----------RIRNGGWTQKLLNFWC 595
           IDLD+HR ++  P L       ++++ KE             R+  + +++ NFWC
Sbjct: 564 IDLDSHRNIFVSPSLTEIDKVDDNDDLKEYENSESSENPNSSRSRKFFKRMTNFWC 619

>Scas_718.41
          Length = 614

 Score =  469 bits (1206), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 267/567 (47%), Positives = 348/567 (61%), Gaps = 17/567 (2%)

Query: 3   SSKKNETSPEVNSITSSTLKTPNVTEKFEPYPDTTA----VKHRTHFNRFVDSFKRAEVN 58
           SS + E S     I S+  +   V+EK     DTT        +T+F  F  SFKR + +
Sbjct: 30  SSIQGEPSMVSIEIESTKKREIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKDSD 89

Query: 59  HNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIG 118
            +  D+E        D  L K +KSRH++M+SLGTGI TGLLV N + L  AGPA L+IG
Sbjct: 90  LDS-DVE------AQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIG 142

Query: 119 YFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLE 178
           Y + S + Y +I AAGE+ + Y  L G F  Y SI +    GFA   L+ +QWLTVLPL+
Sbjct: 143 YTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQ 202

Query: 179 LITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVIL 238
           L+TA++TI +W D +N D                G R Y E EF  N CKILMI GF+IL
Sbjct: 203 LVTAAITISFWTD-VNPDIFVLCVFIVVIIVNLFGARGYAETEFFCNCCKILMITGFIIL 261

Query: 239 SIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVN 298
           SIV+  GGAG DGYIG KYW  PG FA       FKGV  V   A FSYGG+E+  LS++
Sbjct: 262 SIVIITGGAGKDGYIGAKYWIHPGPFAHG-----FKGVCTVFTYAAFSYGGIEVVVLSID 316

Query: 299 EQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAVS 358
           EQE+P  + P A K+                 F VP++S  L+G+  S +HASP+V+A+ 
Sbjct: 317 EQEDPVSAVPNACKKVVYRILLIYLLTTILVCFLVPYDSPNLLGSSHSGSHASPFVIAIE 376

Query: 359 IHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRAL 418
            HGVKVVPH INAVILISV SVANS+LY+S RLL SL+EQG  P++ N++D  GRP+R  
Sbjct: 377 SHGVKVVPHFINAVILISVISVANSSLYSSSRLLLSLSEQGSLPQWLNFIDMNGRPIRCF 436

Query: 419 ILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNE 478
           I+  +FG+I F A SD+ E +FTWL AI+GLS+LF W S+ LSH+R R AMK+QGKSL+E
Sbjct: 437 IISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDE 496

Query: 479 LGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYL 538
           +GY + TG WGS    F      + QFWVA++P    G      FF++YLAFP+ L  YL
Sbjct: 497 IGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYL 556

Query: 539 GYMLYSRDFTFLTDLKKIDLDNHRRLY 565
           G+ +Y +++       KIDLD+HRR+Y
Sbjct: 557 GHKIYYKNWRLWIPADKIDLDSHRRIY 583

>Sklu_2390.1 YGR191W, Contig c2390 5453-7270 reverse complement
          Length = 605

 Score =  466 bits (1200), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 244/575 (42%), Positives = 345/575 (60%), Gaps = 9/575 (1%)

Query: 27  TEKFEPYPDTTAVKHRTHFNRFVDSFK-----RAEVNHNGIDLEDGTNSIQSDDNLKKAM 81
           TE  + +    AV++  H +    SF      +++V H   D E+      +D  L K +
Sbjct: 34  TEVVDGFKPGNAVEYGEHTSLKSSSFDSKENIKSDVPHVS-DFENNVYDTANDSKLNKDL 92

Query: 82  KSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYP 141
             RH++ +++G  IGTGL V +   L   GPASL++ + +VS   + ++ A GE+A  +P
Sbjct: 93  SVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIVNALGELAAVFP 152

Query: 142 TLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXX 201
            + GGFN Y + FV   FGFA    +  QW  +LPLEL+ AS+TI+YWN+ IN+D     
Sbjct: 153 VV-GGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYWNNTINSDAWVAI 211

Query: 202 XXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDP 261
                       V+++GE EF+ +  KIL I GF IL IV+ CGG     YIGG+YW DP
Sbjct: 212 FYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSGEYIGGRYWNDP 271

Query: 262 GAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXX 321
           GAF  D    RFKGV  V VTA FSY G EL A+S  E  NPR + P A+K++       
Sbjct: 272 GAFVGDTPGRRFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRVTLPKASKRTFWLITLC 331

Query: 322 XXXXXXXXGFNVPHNSDQLMGAGGSA-THASPYVLAVSIHGVKVVPHIINAVILISVTSV 380
                   G  VP+N ++L+    S    ASP V+A+   G+K +P ++NA+ILI++ SV
Sbjct: 332 YITVLTIIGCLVPYNDERLLNGNSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAILSV 391

Query: 381 ANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIF 440
           ANSA+YA  R + ++AE G  PK  NY+D+ GRPL A+    IFG+++F A SD++E +F
Sbjct: 392 ANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIFGLLSFIAASDKQEEVF 451

Query: 441 TWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLV 500
           TWL+A++GLS LF W SI LSH+RFR AMKAQ +SLNEL ++SITG++GS YGC    LV
Sbjct: 452 TWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNELPFVSITGVYGSWYGCIVIFLV 511

Query: 501 FIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDN 560
            IA FW +L P GS G   AE+FFE YL+ P+++  YLG+ +Y +D+      K +DLD 
Sbjct: 512 LIASFWTSLFPVGSDGA-DAESFFEGYLSLPIFIVCYLGHKVYKKDWRLYVKTKDMDLDT 570

Query: 561 HRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
            RR  D ++L+QE    +E++    +  + LN WC
Sbjct: 571 GRREIDLDILKQEIRLEREQMAQKPFYIRFLNVWC 605

>Kwal_27.12681
          Length = 593

 Score =  457 bits (1177), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 247/557 (44%), Positives = 345/557 (61%), Gaps = 6/557 (1%)

Query: 42  RTHFNRFVDSFKRAEVNHNGIDLEDGTNS--IQSDDNLKKAMKSRHVIMMSLGTGIGTGL 99
           ++ +  F D FKR E+     +L +      I +   L++ +K+RH+ M+++G  IGTGL
Sbjct: 40  KSRWQDFKDGFKRVELEELDPNLTEAEKIAIITAQSPLQRHLKNRHLQMIAIGGAIGTGL 99

Query: 100 LVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPF 159
            V + K L   GPA ++IG+ ++  + Y V+ + GE+AVT+P + GGF  YA+ FV + F
Sbjct: 100 FVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGELAVTFP-VSGGFTTYATRFVDESF 158

Query: 160 GFATVWLFCIQWLTVLPLELITASMTIKYWNDKIN-ADXXXXXXXXXXXXXXXXGVRAYG 218
           GFA  + + +QWL VLPLE++ AS+T+ +W       D                GVR YG
Sbjct: 159 GFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYRDGFVALFYIVIVIINFFGVRGYG 218

Query: 219 EAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAF 278
           EAEF+F+  K++ + GF+IL IV+ CGG  V GYIGGKYW +PGAF+ D+A SRFKGV  
Sbjct: 219 EAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGGKYWHNPGAFSGDDAGSRFKGVCS 278

Query: 279 VLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSD 338
           V VTA FS+ G EL  L+  E  NPR++ P AAKQ                G  VPH S+
Sbjct: 279 VFVTAAFSFAGTELVGLASAETANPRKALPRAAKQVFWRILLFYIISLCLIGLLVPHTSE 338

Query: 339 QLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQ 398
           +L+G       ASP+VLA+  HG+K +P +IN VILISV SV NSA+YA  R + +LAEQ
Sbjct: 339 RLIGTSSVDAAASPFVLAIQTHGIKGLPSVINVVILISVLSVGNSAVYACSRSMVALAEQ 398

Query: 399 GYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSI 458
           G  P  F Y+DR+GRPL A+I   +FG+++F A S++E  +F WL A++GLS LF+W +I
Sbjct: 399 GSLPHIFAYIDRKGRPLVAIITTCVFGLLSFIAQSEKEGDVFNWLLALSGLSTLFSWGAI 458

Query: 459 LLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVY 518
            + H+RFR A+ AQG+S +EL ++S  GI GS +G    +LV IAQFWVA+ P G  G  
Sbjct: 459 CICHIRFRRALSAQGRSTDELAFVSYAGIAGSYFGVILVLLVLIAQFWVAVWPIG--GSP 516

Query: 519 SAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETK 578
           +AE FF +YL+FPV L FY+ + ++ R++   T  K ID+D  RR  D E LRQE  E K
Sbjct: 517 NAEDFFSAYLSFPVLLAFYIFHKIWKRNWKLFTRAKDIDIDTGRREMDTEALRQEIAEEK 576

Query: 579 ERIRNGGWTQKLLNFWC 595
             +    W  +L  FWC
Sbjct: 577 MLLSTRPWWYRLYFFWC 593

>Sklu_2029.2 , Contig c2029 2095-3891
          Length = 598

 Score =  452 bits (1163), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 229/497 (46%), Positives = 310/497 (62%), Gaps = 5/497 (1%)

Query: 74  DDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAA 133
           ++ LK+++K  HV M+++ TGIGTGLLV N K +  AG    ++GYF++  +    +Q+ 
Sbjct: 67  NEKLKQSIKPYHVFMITMATGIGTGLLVGNGKSISDAGVGGTLVGYFIIGSMLVCCMQSV 126

Query: 134 GEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKI 193
           GE+ V +P+L GGFN+Y   FV   FGF   WLFC+QW  VLPLEL+TASMTIKYWN+ +
Sbjct: 127 GELVVAFPSLAGGFNSYGKRFVDPSFGFTVAWLFCLQWQIVLPLELVTASMTIKYWNNSL 186

Query: 194 NADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYI 253
           N                  G R Y +AEF+FN  K+LMI GF+IL I+++ G AG  GYI
Sbjct: 187 NPSIFVAIFYSLILGISFFGARGYADAEFLFNLSKVLMITGFIILGIIISFGAAGTSGYI 246

Query: 254 GGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQE--NPRRSTPAAA 311
           G KY + PGAF + N    FK +   LV A FS GGVE  ALS  EQ   N  +S   A 
Sbjct: 247 GIKYLKTPGAFNTRNT---FKSICSTLVNACFSCGGVEFLALSAAEQARGNISKSIKRAC 303

Query: 312 KQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINA 371
            Q                G  VP+NS +LMG+     H+SPYV+AV+ HGVKVVPH+INA
Sbjct: 304 GQVLVRMCVFYILSIFVIGLLVPYNSPELMGSSSEIIHSSPYVIAVASHGVKVVPHLINA 363

Query: 372 VILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCA 431
           VILI+V SVANSA+Y+S R L +LAEQG+AP YF  +D +GRP R L++  +FG+++F A
Sbjct: 364 VILIAVVSVANSAMYSSSRTLHALAEQGFAPSYFAKLDSKGRPFRCLVVSGVFGLLSFIA 423

Query: 432 CSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSL 491
               +E +F WL +I+GLS +FTW+ I ++H+RFR AMK Q  SL ELG+ + +GI+GS 
Sbjct: 424 EYKDQESVFVWLLSISGLSTIFTWTMICVAHLRFRAAMKDQNHSLEELGHRAWSGIYGSY 483

Query: 492 YGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLT 551
           Y    N L  + QFWV+L P    G      FF++Y+A P  L  Y+G+ +Y+R + F+ 
Sbjct: 484 YVIAINSLTLVVQFWVSLFPLDGDGRPDFVNFFQNYMAVPFALCLYVGHKIYTRSWQFII 543

Query: 552 DLKKIDLDNHRRLYDPE 568
              KID+D  R +Y  E
Sbjct: 544 PADKIDVDTSRDIYGVE 560

>ADL272W [1469] [Homologous to ScYDR508C (GNP1) - NSH]
           complement(227416..229110) [1695 bp, 564 aa]
          Length = 564

 Score =  445 bits (1145), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 227/522 (43%), Positives = 322/522 (61%), Gaps = 8/522 (1%)

Query: 63  DLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMV 122
           D E  ++      +L++++K RHV M+S+ TGIGTGLLV N K +  AG    +IGY ++
Sbjct: 11  DAEKLSSEGSEPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIGYLII 70

Query: 123 SFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITA 182
             +    +Q+ GE+ V +P+L GGFN+Y   F+    GF   WLFC+QW+ VLPLEL+TA
Sbjct: 71  GVMVVCCMQSVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLELVTA 130

Query: 183 SMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVV 242
           SMTIKYWN  ++                  G   Y EAEFIFN  K++++  F++L IV+
Sbjct: 131 SMTIKYWNSNLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVLGIVI 190

Query: 243 NCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQ-- 300
             GG G  G IG +Y + PGAF ++   + FK  A  LV A FS GGVE  ALS  EQ  
Sbjct: 191 ITGGLGNSGPIGFQYLKTPGAFNTNY--NVFKATAGTLVNAAFSCGGVEFLALSAAEQNR 248

Query: 301 ENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAVSIH 360
           +N  +S   A +Q                G  VP++S  LMG+G   TH SPYV A+++H
Sbjct: 249 DNMPKSIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTSPYVAAIALH 308

Query: 361 GVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALIL 420
           GV++VPHIINAVILI+V SVANSA+Y+S R L SLAEQ +AP+YF  +++ G+P+R L++
Sbjct: 309 GVRIVPHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQPMRCLVV 368

Query: 421 CSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELG 480
            +I G+I+F A    +E +F WL +I+GLS +FTW++I ++H+RFR A+K QG+SL+ LG
Sbjct: 369 SAIVGLISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSLDTLG 428

Query: 481 YISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGY 540
           Y S TG+ GS      NV+V I QFWV+L P  + G   A  FF++Y+A PV +  YLG+
Sbjct: 429 YRSNTGVIGSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPVAVLLYLGH 488

Query: 541 MLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIR 582
            LY+ D+T       +D++  R +Y P     +D  TK  ++
Sbjct: 489 KLYTNDWTPWIRTHCVDINTDRDVYAPS----DDLSTKGVVK 526

>YKR039W (GAP1) [3292] chr11 (514705..516513) General amino acid
           permease, proton symport transporter for all
           naturally-occurring L-amino acids, 4-aminobutyric acid
           (GABA), ornithine, citrulline, some D-amino acids, and
           some toxic analogs [1809 bp, 602 aa]
          Length = 602

 Score =  439 bits (1128), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 243/557 (43%), Positives = 345/557 (61%), Gaps = 8/557 (1%)

Query: 43  THFNRFVDSFKRA---EVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGL 99
           + +  F DSFKR    EV+ N  + E     I +   LK  +K+RH+ M+++G  IGTGL
Sbjct: 50  SKWQDFKDSFKRVKPIEVDPNLSEAEK-VAIITAQTPLKHHLKNRHLQMIAIGGAIGTGL 108

Query: 100 LVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPF 159
           LV +   L   GPASL+IG+     + Y ++ A GE+AV +P + GGF  YA+ F+ + F
Sbjct: 109 LVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIFP-ISGGFTTYATRFIDESF 167

Query: 160 GFATVWLFCIQWLTVLPLELITASMTIKYW-NDKINADXXXXXXXXXXXXXXXXGVRAYG 218
           G+A  + + +QWL VLPLE+++AS+T+ +W  D    D                GV+ YG
Sbjct: 168 GYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLAIVIINMFGVKGYG 227

Query: 219 EAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAF 278
           EAEF+F+  K++ + GF+IL I++NCGG    GYIGGKYW DPGAFA D   ++FKGV  
Sbjct: 228 EAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYIGGKYWHDPGAFAGDTPGAKFKGVCS 287

Query: 279 VLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSD 338
           V VTA FS+ G EL  L+ +E   PR+S P AAKQ                G  VP+N  
Sbjct: 288 VFVTAAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDK 347

Query: 339 QLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQ 398
            L+GA      ASP+V+A+  HG+K +P ++N VILI+V SV NSA+YA  R + +LAEQ
Sbjct: 348 SLIGASSVDAAASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQ 407

Query: 399 GYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSI 458
            + P+ F+YVDR+GRPL  + + S FG+IAF A S +E  +F WL A++GLS LFTW  I
Sbjct: 408 RFLPEIFSYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGEVFNWLLALSGLSSLFTWGGI 467

Query: 459 LLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVY 518
            + H+RFR A+ AQG+ L+EL + S TG+WGS +G F  +++FIAQF+VA+ P G     
Sbjct: 468 CICHIRFRKALAAQGRGLDELSFKSPTGVWGSYWGLFMVIIMFIAQFYVAVFPVGDSP-- 525

Query: 519 SAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETK 578
           SAE FFE+YL+FP+ +  Y+G+ +Y R++      +K+D+D  RR  D +LL+QE  E K
Sbjct: 526 SAEGFFEAYLSFPLVMVMYIGHKIYKRNWKLFIPAEKMDIDTGRREVDLDLLKQEIAEEK 585

Query: 579 ERIRNGGWTQKLLNFWC 595
             +       ++ NFWC
Sbjct: 586 AIMATKPRWYRIWNFWC 602

>CAGL0L03267g 372787..374580 highly similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, hypothetical start
          Length = 597

 Score =  438 bits (1127), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 249/594 (41%), Positives = 354/594 (59%), Gaps = 11/594 (1%)

Query: 6   KNETSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTHFNRFVDSFK---RAEVNHNGI 62
           KNE   +   +    L+  N  E              + + +F DSFK    A V  +  
Sbjct: 11  KNELQIDSEFLREEPLEISNFEESSS---SQGPQPSGSRWRKFKDSFKPLDEAVVTDDMS 67

Query: 63  DLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMV 122
           D+E   +   +   LK  +K+RH+ M+++G  IGTGL V +   L  AGPA ++IG+ + 
Sbjct: 68  DIEKIAHR-TAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLT 126

Query: 123 SFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITA 182
             + Y ++ A GE++V +P + GGF  YA+ F+ + FGFA  + + +QWL VLPLE++ A
Sbjct: 127 GTMIYCMVMAMGELSVVFP-ISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLEIVAA 185

Query: 183 SMTIKYW-NDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIV 241
           S+T+ YW  D    D                GV+ YGEAEF+F+  K+L + GF+I+ IV
Sbjct: 186 SITVNYWGTDPKYRDGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFIIMGIV 245

Query: 242 VNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQE 301
           +NCGG    GYIGGKY+ DPGAF  D A +RF+GV  V VTA FS+ G EL  ++  E  
Sbjct: 246 LNCGGGPEGGYIGGKYFHDPGAFVGDTAGARFQGVCSVFVTAAFSFAGSELIGIAAAESA 305

Query: 302 NPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAVSIHG 361
            PR+S P AAKQ                G  VP+  ++L+GA      ASP+V+A++ HG
Sbjct: 306 EPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAAASPFVIAITSHG 365

Query: 362 VKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILC 421
           ++ +P ++N VILI+V SV NSA+Y   R L +LA+Q + PK F Y+DR GRPL  +   
Sbjct: 366 IRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGRPLFGIAFT 425

Query: 422 SIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGY 481
           S FG++AF A S +E  +F WL A++GLS LFTW  I   H+RFR A+ AQG+S +EL +
Sbjct: 426 SAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQGRSTDELPF 485

Query: 482 ISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYM 541
            +  GI+GS++G F  VL+F+AQF+VAL PPG K   SAE FF+SYL+FPV L FY G+ 
Sbjct: 486 KAPAGIYGSMWGLFMIVLMFMAQFYVALFPPGGKP--SAEVFFQSYLSFPVVLAFYFGHK 543

Query: 542 LYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
           LY+R++  L  L K+D+D  RR  D ++LRQE  E K+ +    W  +  +FWC
Sbjct: 544 LYARNWKLLIPLSKLDIDTGRREMDLDVLRQEIAEEKQMMSTRPWWYRWYSFWC 597

>Kwal_33.15407
          Length = 587

 Score =  436 bits (1120), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 228/535 (42%), Positives = 333/535 (62%), Gaps = 4/535 (0%)

Query: 62  IDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFM 121
           ++   GT+  + D    K +  RH++ +++G  IGTGL V +   L   GP SLVI + +
Sbjct: 56  VESTSGTSDAE-DSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVI 114

Query: 122 VSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELIT 181
           +S   + ++ A GE++ T+P + GGFN Y S FV   FGFA    +  QW  +LPLEL+ 
Sbjct: 115 ISTCLFTIVNALGELSSTFPVV-GGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVA 173

Query: 182 ASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIV 241
           AS+TI+YWN  IN+D                 V+++GE EF+ +  KIL I GF IL IV
Sbjct: 174 ASLTIRYWNSTINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIV 233

Query: 242 VNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQE 301
           + CGG    GYIGGKYW +PGAF  + ++ RF G+  V VTA FSY G EL A+S  E  
Sbjct: 234 LTCGGGPEGGYIGGKYWSNPGAFVGNTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAESV 293

Query: 302 NPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLM-GAGGSATHASPYVLAVSIH 360
           NPR + P A K++               G  VP +  +L+ G+      ASP V+A+   
Sbjct: 294 NPRITLPKACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENG 353

Query: 361 GVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALIL 420
           G+K +P ++NA+ILI+V SVANSA+YA  R + S+A  G  PK F+YVDR+GRPL A++ 
Sbjct: 354 GIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILA 413

Query: 421 CSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELG 480
             IFG+++F A S+++E +FTWL+A++GLS LF W +I +SH+RFR  MK +G+SL+EL 
Sbjct: 414 TLIFGLLSFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELP 473

Query: 481 YISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGY 540
           ++S+TG+WGS YGC    +V +  FW AL  P ++GV SAE+FFE+YL+FP+ L  Y+G+
Sbjct: 474 FVSMTGVWGSYYGCVIIFVVLVVCFWTALF-PSTEGVASAESFFETYLSFPILLVCYIGH 532

Query: 541 MLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
            LY++ +  LT   +ID+D+ RR  D E+L+ E    ++ +R   +  + L+ WC
Sbjct: 533 KLYTKSWRLLTPTTEIDIDSGRRAVDIEVLKDEKRMEEQAMREKSYLTRFLHLWC 587

>YGR191W (HIP1) [2141] chr7 (880423..882234) Histidine permease,
           member of the amino acid permease family of membrane
           transporters [1812 bp, 603 aa]
          Length = 603

 Score =  431 bits (1109), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 247/596 (41%), Positives = 353/596 (59%), Gaps = 17/596 (2%)

Query: 6   KNETSPEVNSITSSTLKTPNVTEKFE-PYP----DTTAVKHRTHFNRFVDSFKRAEVNHN 60
           K  TSP   +   ST     +T K +  +P    D+  +   T+     D F+R E    
Sbjct: 19  KPATSPAFENEKESTTFVTELTSKTDSAFPLSSKDSPGINQTTNDITSSDRFRRNE---- 74

Query: 61  GIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYF 120
             + ED  N+     NL K +  RH++ +++G  IGTGL V     L   GPASLVI + 
Sbjct: 75  DTEQEDINNT-----NLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWV 129

Query: 121 MVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELI 180
           ++S   + VI + GE++  +P + GGFN Y+  F+   F FA    +  QWL +LPLEL+
Sbjct: 130 IISTCLFTVINSLGELSAAFPVV-GGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELV 188

Query: 181 TASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSI 240
            AS+TIKYWNDKIN+D                 V+++GE EF+ +  KIL I GF IL I
Sbjct: 189 AASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGI 248

Query: 241 VVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQ 300
           V++CGG    GYIGGKYW DPGAF   ++ ++FKG+  V VTA FSY G+E+ A+S  E 
Sbjct: 249 VLSCGGGPHGGYIGGKYWHDPGAFVGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAES 308

Query: 301 ENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHAS-PYVLAVSI 359
           +NPR + P AAK++               G  VP N  +L+    S   AS P V+A+  
Sbjct: 309 KNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIEN 368

Query: 360 HGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALI 419
            G+K +P ++NA+ILI+V SVANSA+YA  R + ++A  G  PK+ N VD+ GRP+ A++
Sbjct: 369 GGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAIL 428

Query: 420 LCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNEL 479
           L   FG+++F A SD++  +FTWL+A++GLS +F W +I LSH+RFR AMK Q +SL+EL
Sbjct: 429 LTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDEL 488

Query: 480 GYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLG 539
            +IS TG+ GS YG     LV IA FW +L P G  G  SAE+FFE YL+FP+ +  Y+G
Sbjct: 489 PFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGGSGA-SAESFFEGYLSFPILIVCYVG 547

Query: 540 YMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
           + LY+R++T +  L+ +DLD  R+  D  L R+E    +E +    +  + L+FWC
Sbjct: 548 HKLYTRNWTLMVKLEDMDLDTGRKQVDLTLRREEMRIERETLAKRSFVTRFLHFWC 603

>KLLA0A06886g complement(621646..623409) similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, start by similarity
          Length = 587

 Score =  426 bits (1096), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 238/557 (42%), Positives = 342/557 (61%), Gaps = 13/557 (2%)

Query: 43  THFNRFVDSFKRAEVNHNGIDLEDGTNS--IQSDDNLKKAMKSRHVIMMSLGTGIGTGLL 100
           T + RF DSFKRA+      +L D      + ++  LK+ +KSRH+ M+++G  IGTGL 
Sbjct: 40  TRWERFRDSFKRADTQDLDPNLTDAEKMAILTANAPLKRTLKSRHLQMIAIGGAIGTGLF 99

Query: 101 VANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFG 160
           V + K L  AGPA ++IG+ +   + Y ++ A GE+AVT+P + GGF  YAS FV + FG
Sbjct: 100 VGSGKALATAGPAGILIGWALTGTMIYCMVMAMGELAVTFP-IAGGFTTYASRFVDESFG 158

Query: 161 FATVWLFCIQWLTVLPLELITASMTIKYWN--DKINADXXXXXXXXXXXXXXXXGVRAYG 218
           FA   ++ +QWL VLPLE++ AS+T+ YW   DK   D                GV+ YG
Sbjct: 159 FAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYR-DGFVALFYVVIVAINFFGVKGYG 217

Query: 219 EAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAF 278
           EAEFIF+  K++ + G++IL +++ CGG    GYIGG+ W +PGAFA+      FKGV  
Sbjct: 218 EAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGRLWHNPGAFANG-----FKGVCS 272

Query: 279 VLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSD 338
           V VTA FS+ G EL  L+  E  NPR+S P+AAKQ                G  VP+ SD
Sbjct: 273 VFVTAAFSFAGSELVGLAAAETANPRKSLPSAAKQVFWRITLFYILALLMVGLLVPYTSD 332

Query: 339 QLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQ 398
           +L+G       ASP+V+++   G+K +P +IN VILI+V SV NSA++A  R + +LA Q
Sbjct: 333 RLIGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNSAVFACSRSMAALANQ 392

Query: 399 GYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSI 458
           G  PK F Y+DR GRPL  +I+  +FG+++F A S +E  +F WL A++GLS LFTW  I
Sbjct: 393 GSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGI 452

Query: 459 LLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVY 518
           +L H+R R A+ AQ ++  EL + + TG+WGS+YG    +L+ +AQFW+AL P G K   
Sbjct: 453 MLCHIRVRRALAAQNRTTAELSFTAPTGVWGSVYGFVLIILILMAQFWIALFPIGDKP-- 510

Query: 519 SAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETK 578
           SA AFFE+YL+FP+ + FY+G+ ++ +++      K ID+D  RR  D E L+QE  E K
Sbjct: 511 SASAFFEAYLSFPILIAFYIGHKIWKKNWKLFIRAKNIDIDTGRRETDIEALKQEIAEEK 570

Query: 579 ERIRNGGWTQKLLNFWC 595
             I +  +  ++  FWC
Sbjct: 571 AFIASKPFYYRMYKFWC 587

>AGR319W [4630] [Homologous to ScYGR191W (HIP1) - SH]
           complement(1327939..1329819) [1881 bp, 626 aa]
          Length = 626

 Score =  421 bits (1082), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 234/614 (38%), Positives = 349/614 (56%), Gaps = 22/614 (3%)

Query: 2   ESSKKNETSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAEVNHNG 61
           ++S K E S   + +T++  ++ +         D  + +    + R ++ FKRA+     
Sbjct: 15  DTSTKQEMSNSRSYLTTTAHQSLSSEALSMGSLDARSPQKDVWYTRLLNDFKRADEGETT 74

Query: 62  IDLEDG-------------------TNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVA 102
             + D                     ++ ++   L K +  RH++ +++G  IGTGL V 
Sbjct: 75  RSVADSDMEVDGKRYKEMTDVERAVCDAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVN 134

Query: 103 NAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFA 162
           +   L   GP S++I + ++S   + ++ + GE+A  +P + GGFN Y + FV   FGFA
Sbjct: 135 SGASLNTGGPGSILIAWTLISTCLFTIVNSLGELASAFPVV-GGFNVYITRFVEPSFGFA 193

Query: 163 TVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEF 222
               +  QW  +LPLEL  AS+TIKYWN+KIN+D                 V+++GE EF
Sbjct: 194 VNISYLAQWAVLLPLELAAASITIKYWNNKINSDAWVAIFYVCIALANMLDVKSFGETEF 253

Query: 223 IFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVT 282
           + +  KIL I GF IL  V+ CGG  V G+IG KYW DPGAF  D   ++FKG+  V VT
Sbjct: 254 VLSMVKILAIFGFAILGTVLICGGGPVGGFIGAKYWHDPGAFVGDTPGAQFKGLCSVFVT 313

Query: 283 AYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLM- 341
           A FSY G EL  +S  E  NPR + P A+K+S               G  VP N  +L+ 
Sbjct: 314 AAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLN 373

Query: 342 GAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYA 401
           G       ASP V+A+   G++ VP ++NA+ILI++ SVANS++YA  R + S+A+ G  
Sbjct: 374 GMSSVDVAASPLVIAIENGGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNL 433

Query: 402 PKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLS 461
           PK FNY+DR+GRPL A++   +FG+++F A SD++E IFTWL+A++GLS LF W +I +S
Sbjct: 434 PKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINIS 493

Query: 462 HVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAE 521
           H+RFR AM AQ +SL+EL Y+S+TG+ GS YG    + V +  FW +L PPGS G  SAE
Sbjct: 494 HIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGP-SAE 552

Query: 522 AFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERI 581
           +FFE YL+FP++L  Y+ + LY RD+       +ID+D+ RR  D E L+++    +   
Sbjct: 553 SFFEGYLSFPIFLICYISHKLYKRDWRLFIPAGQIDVDSGRRALDIEELKEQKLREQAET 612

Query: 582 RNGGWTQKLLNFWC 595
               +  +   FWC
Sbjct: 613 AKKPFYVRWWIFWC 626

>CAGL0B03773g 373956..375773 highly similar to sp|P06775
           Saccharomyces cerevisiae YGR191w HIP1 Histidine
           permease, start by similarity
          Length = 605

 Score =  420 bits (1080), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 228/524 (43%), Positives = 329/524 (62%), Gaps = 3/524 (0%)

Query: 73  SDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQA 132
           ++ NL K +  RH++ +++G  IGTGL V +   L   GPASLVIG+ +VS   + VI +
Sbjct: 84  NNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVINS 143

Query: 133 AGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDK 192
            GE+A  +P + GGFN Y + F+   F FA    +  QWL +LPLEL+ AS+TI+YWNDK
Sbjct: 144 LGELAAAFPVV-GGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWNDK 202

Query: 193 INADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGY 252
           IN+D                 V+++GE EFI +  KIL I GF IL IV+ CGG    GY
Sbjct: 203 INSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGGY 262

Query: 253 IGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAK 312
           IGGKYW +PGAF   +A S+FKG+  V VTA FSY G+E+ A+S  E  NP+ + P AAK
Sbjct: 263 IGGKYWHNPGAFVGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKETIPKAAK 322

Query: 313 QSXXXXXXXXXXXXXXXGFNVPHNSDQLM-GAGGSATHASPYVLAVSIHGVKVVPHIINA 371
           ++               G  VP+N  +L+ G+      ASP V+A+   G+K +P ++NA
Sbjct: 323 RTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIAIENGGIKGLPSLMNA 382

Query: 372 VILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCA 431
           +ILI++ SVANSA+YA  R + S+A  G  PK+ + VD+ GRPL A++L   FG+++F A
Sbjct: 383 IILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFGLLSFIA 442

Query: 432 CSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSL 491
            SD++E +FTWL+A++GLS +F W +I LS +RFR AMKAQG+SL+E+ ++S +G WG+ 
Sbjct: 443 ASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQSGTWGAW 502

Query: 492 YGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLT 551
           YG     LV +A FW +L P GS    SA++FFE YL+ P+ +  Y+G+ L+ RD+  L 
Sbjct: 503 YGVIVLFLVLVASFWTSLFPVGSS-TASAKSFFEGYLSLPILIACYVGHKLWKRDWRLLV 561

Query: 552 DLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
            L ++DLD+ RR+ D E   +E    +E + N  +  + L+ WC
Sbjct: 562 PLMEMDLDSGRRVLDAETREEELRVEREYLANASFFTRFLHIWC 605

>Kwal_33.14276
          Length = 596

 Score =  419 bits (1078), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 228/598 (38%), Positives = 343/598 (57%), Gaps = 12/598 (2%)

Query: 2   ESSKKNETSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAEVNHNG 61
           +  ++ +   + N   +  ++T +  E ++ Y   +    ++  + FVD F+  +++   
Sbjct: 7   DVDRELDLKKDQNLYFTQDIETSSENEGYDKYERESKSSSKSWIHNFVDGFREYKLDDVD 66

Query: 62  IDLEDGTNSI--QSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGY 119
            +L     +    +   LK+ +K+RH+ M+++G  IGTGL V + K L + GPA++++ +
Sbjct: 67  PNLSSTERAAIATARSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAW 126

Query: 120 FMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLEL 179
            +   + Y V+QA GE+ V  P + G + +Y S F+   FGFA  + + +  L  +PLE+
Sbjct: 127 ILTGSMVYSVVQAIGELCVALP-VSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEI 185

Query: 180 ITASMTIKYWN-DKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVIL 238
           + AS+T+ YWN D   AD                GV+ YGEAEF+F+  K+L I GF+IL
Sbjct: 186 VAASITVDYWNVDHKYADGFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIIL 245

Query: 239 SIVVNCGGAGVD-GYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSV 297
            IV+ CGG   + GYIG KYW +PG FA       FKG A + VT+ FS+ G E+FAL  
Sbjct: 246 GIVLVCGGGSNNTGYIGTKYWHNPGGFAHG-----FKGFAAIFVTSAFSFSGSEMFALGA 300

Query: 298 NEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAV 357
            E +NPRR  P AAKQ                G  VP+ +  L  +      ASP+V+A+
Sbjct: 301 AESKNPRRDLPKAAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASASPFVIAI 360

Query: 358 SIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRA 417
              G+  +P +IN VIL++V SV N+ ++AS R   SLA  GY PK F YVDR+GRPL  
Sbjct: 361 KEAGISGLPSVINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAG 420

Query: 418 LILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLN 477
           LIL  +FG+++F + S  + V+F W+ A++GL   FTW SI + H+RFR  ++AQG+S +
Sbjct: 421 LILSMVFGLLSFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTD 480

Query: 478 ELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFY 537
           EL + + TGIWGS+YG     +V   QFWVAL P       SA  FFE YL+ PV + FY
Sbjct: 481 ELAFKAQTGIWGSIYGITLISVVLCFQFWVALFPLSKSP--SAYHFFEQYLSLPVVIVFY 538

Query: 538 LGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
           +G+ +YSR++  +   K++DLD  RR  D ELL+QE +E  E IR+     ++  FWC
Sbjct: 539 MGHKVYSRNWRLVIPAKELDLDTGRREVDLELLKQEIKEENESIRSRPIWYRIYRFWC 596

>KLLA0A11770g 1014918..1016663 similar to sp|P06775 Saccharomyces
           cerevisiae YGR191w HIP1 histidine permease, start by
           similarity
          Length = 581

 Score =  418 bits (1074), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 226/536 (42%), Positives = 322/536 (60%), Gaps = 5/536 (0%)

Query: 63  DLEDGTNSI--QSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYF 120
           D+ D   +I    D  L K +  RH++ +++G  IGTGL V +   L   GPASLVI + 
Sbjct: 48  DMNDVEKAIYNTKDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWT 107

Query: 121 MVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELI 180
           ++S   + ++ + GE++ T+P + GGFN Y + FV   FGFA  + +  QW  +LPLEL 
Sbjct: 108 IISTCLFTIVNSLGELSATFPVV-GGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELC 166

Query: 181 TASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSI 240
            AS+TI+YWN  IN D                 V+++GE EF+ +  KIL I GF IL I
Sbjct: 167 AASITIRYWNKSINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGI 226

Query: 241 VVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQ 300
           V+ CGG    G+IGGKYW DPGAF  D  A RFKG++ V +TA FSY G+EL  +S  E 
Sbjct: 227 VLICGGGPSGGFIGGKYWNDPGAFVGDTPAQRFKGLSAVFITAAFSYSGLELVGVSAAES 286

Query: 301 ENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLM-GAGGSATHASPYVLAVSI 359
            NPR + P AAK++               G  VP N   L+ G       ASP V+A+  
Sbjct: 287 RNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASPLVIAIQN 346

Query: 360 HGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALI 419
            G+K +P ++NA+ILI++ SVANSA+YA  R + S+AE G  P+   +VD++GRPL A+ 
Sbjct: 347 GGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIA 406

Query: 420 LCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNEL 479
           +  + G+++F A S++ + +FTWL+A++GLS LF W +I L+H+RFR AMK Q +SL EL
Sbjct: 407 ITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEEL 466

Query: 480 GYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLG 539
            Y+S+TG WGS YGC    LV IA FW +L P G  G   A +FFESYL+ P+++  YLG
Sbjct: 467 PYVSMTGEWGSWYGCIVIGLVLIASFWTSLFPAGGNGA-DATSFFESYLSLPIFIACYLG 525

Query: 540 YMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
           + ++ R+      L ++D+D+ R   D   L+QE E   E ++   +  +L NFWC
Sbjct: 526 HKIWKRNLRLYIKLSEVDVDSGRTDTDAATLKQEKEAEAELMKTKPFYIRLWNFWC 581

>KLLA0F01012g complement(90772..92442) similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1 high-affinity
           glutamine permease, hypothetical start
          Length = 556

 Score =  415 bits (1067), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 216/532 (40%), Positives = 308/532 (57%), Gaps = 11/532 (2%)

Query: 68  TNSIQS-------DDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYF 120
           TNSI +        + LK+++K  HV MMS  TGIGTGLLV N + + +AG    ++GY 
Sbjct: 21  TNSIDTTADVTLPKNELKQSIKPFHVFMMSTATGIGTGLLVGNGRSIAIAGVGGTLVGYL 80

Query: 121 MVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELI 180
           ++  +    +Q  GE+ V +P++PGGF +Y   F+    GF   WLF + W  VLPLE+ 
Sbjct: 81  IIGIMLTCCMQTVGELVVAFPSMPGGFTSYGKRFIDPSVGFTISWLFFLNWTVVLPLEIC 140

Query: 181 TASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSI 240
            ASMTI +WN+ IN                  G R Y +A+ IFN  K+LMI GF+IL I
Sbjct: 141 VASMTINFWNENINPSIVVALCYSLVCGVNFFGARCYADADCIFNCLKVLMILGFIILGI 200

Query: 241 VVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQ 300
            VN G  G  GY+G KY+  PG F +D     FK +A  L+TA FS GG E  ALS  EQ
Sbjct: 201 FVNTGVVGTSGYLGFKYFHSPGFFRNDEGL--FKSIAATLITACFSTGGTEFVALSCAEQ 258

Query: 301 --ENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAVS 358
             E+  RS   A+ Q                G  VP NS  LMG+G   THASPYV+A++
Sbjct: 259 NTEDMPRSIKRASIQVVVRIAIIFCVSLMIIGLLVPFNSPYLMGSGSELTHASPYVVALT 318

Query: 359 IHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRAL 418
            +GV+++PHI+NA+IL+S+ SVAN+A+Y+S R L SLAEQG+A KYF  +D  G+P R L
Sbjct: 319 TNGVRIIPHIVNAIILLSIISVANNAMYSSSRTLHSLAEQGFAMKYFCKLDESGKPFRCL 378

Query: 419 ILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNE 478
            + +  G+ +F A    +E +F WL +I+GLS +FTWS   +SH+RFR AMK Q ++L++
Sbjct: 379 CVSAFTGLFSFIAEYKDQETVFVWLLSISGLSTIFTWSMTCVSHLRFRKAMKDQDQALDQ 438

Query: 479 LGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYL 538
           LGY S  G++GS    F   ++ I QFWV+L P  S G  +  +F ++Y+A P+ +  YL
Sbjct: 439 LGYQSPCGVYGSYISLFICAIILIVQFWVSLFPLESNGRLNVVSFLQNYMAVPITIVLYL 498

Query: 539 GYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKL 590
           G+  Y+ ++       +ID+   R +Y  + +  +     E + +G    KL
Sbjct: 499 GHKAYTGNWKPFIRAPEIDIQTDRDIYCVDEVTGKKSVFVELLDSGDMCSKL 550

>AFR230C [3422] [Homologous to ScYKR039W (GAP1) - NSH]
           (855416..857230) [1815 bp, 604 aa]
          Length = 604

 Score =  414 bits (1064), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 220/568 (38%), Positives = 336/568 (59%), Gaps = 7/568 (1%)

Query: 34  PDTTAVKHRTHFNRFVDSFKRAEVNHNGIDLEDGTN-SIQSDDN-LKKAMKSRHVIMMSL 91
           P +   + R  +N FVD+F+RAE+     +L +    +I++    L + +K+RH+ M+++
Sbjct: 38  PISVQPEPRKGWNGFVDTFRRAEMPVIDPNLSEAEKLAIRTAAAPLSRRLKNRHLQMIAI 97

Query: 92  GTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYA 151
           G  IG GL V + K L  AGPA ++IG+ + + +   +  + GE+AVT+P + GG+  YA
Sbjct: 98  GGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGELAVTFP-VSGGYITYA 156

Query: 152 SIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWN-DKINADXXXXXXXXXXXXXX 210
           + F+ + +GFA  + + +Q + V+PLE++ AS+T+ YW+ D                   
Sbjct: 157 ARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKYKLAFVALFWVVIVSIN 216

Query: 211 XXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAA 270
             GVR +GEAE IF+  K++ I GF+I+ +V+  GG      IGGKYW DPG F  +  +
Sbjct: 217 LFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIGGKYWNDPGPFVGNAPS 276

Query: 271 SRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXG 330
            +FKGV  V VTA FS+ G EL  L+  E   PR+S P AAKQ                G
Sbjct: 277 DKFKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIPKAAKQVFWRITLFYILSLLIVG 336

Query: 331 FNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPR 390
             VP N++ L+         SP+V+A+ +H ++V+P IIN VIL +V SV NS++Y+S R
Sbjct: 337 LLVPSNNEHLLAPQQIDAAHSPFVIAMDMHRIRVLPSIINVVILTAVISVGNSSVYSSSR 396

Query: 391 LLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLS 450
            + +LAE G+ PK F Y+DR+GRPL A+   S+FG++ F A + +E  IF WL AI+GLS
Sbjct: 397 TMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLCFVAGAKEEGEIFDWLLAISGLS 456

Query: 451 ELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALS 510
             FTW +I L+H+RFR+A+KAQG++ NEL + S TG  GS Y      +V +AQFWVAL 
Sbjct: 457 SFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTGFIGSCYAVGLICVVLVAQFWVALY 516

Query: 511 PPGSKGVYSAEA---FFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDP 567
           PP   G  +  +   FF+ YL+F V +  YL + ++SR++ F    K++D+D  RR  D 
Sbjct: 517 PPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIWSRNWKFFIKAKEMDIDTGRRELDL 576

Query: 568 ELLRQEDEETKERIRNGGWTQKLLNFWC 595
           EL ++E  + +  +    +  ++ NFWC
Sbjct: 577 ELFKEELAQERALLAQKPFIIRVFNFWC 604

>Scas_607.4
          Length = 599

 Score =  407 bits (1046), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 223/560 (39%), Positives = 322/560 (57%), Gaps = 28/560 (5%)

Query: 42  RTHFNRFVDSFKRAEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLV 101
           R  F R +DSFK        +D    TN      NLK+++K+RH+IM+++G  IGTGL V
Sbjct: 62  RNIFQRCIDSFKPP------LDGSFDTN------NLKRSLKARHLIMIAIGGSIGTGLFV 109

Query: 102 ANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGF 161
            + + +   GP ++VIG+ +        I   GE+ V +P + G F NY++ F+     F
Sbjct: 110 GSGQAIATGGPLAVVIGWAIAGSQIIGTIHGLGEITVRFPVV-GAFANYSTRFLDPSLSF 168

Query: 162 ATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAE 221
               ++ IQW  VLPLE+I+++MT++YWN  I+                  G R +GEAE
Sbjct: 169 VISTIYVIQWFFVLPLEIISSAMTVQYWNQSIDPVVWVAIFYCAIVSINLFGARGFGEAE 228

Query: 222 FIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLV 281
           F+F+S K+L I GF+IL IV+ CGG     ++G KYW DPG  A       F GV  VLV
Sbjct: 229 FVFSSVKVLTICGFIILCIVLICGGGPDHDFVGAKYWHDPGCLAHG-----FPGVLSVLV 283

Query: 282 TAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLM 341
            A +S GG E+  L+  E +   +  P+A KQ+               GF VP+ ++ L+
Sbjct: 284 VASYSLGGTEMVCLASGETDP--KELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLL 341

Query: 342 GAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYA 401
           G  GS+ + SP+V+A+ +H +KV+P I+NAVILIS+ SV NS ++AS R L S+A QG  
Sbjct: 342 G--GSSVNNSPFVIAIKLHQIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLI 399

Query: 402 PKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLS 461
           P++F Y+DR GRPL  +I  S+FG++AF   S     +F WL AIAGL+    W SI +S
Sbjct: 400 PRFFGYIDRAGRPLTGIITNSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINIS 459

Query: 462 HVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPG--SKGVYS 519
           H+RFRLAMKAQG+SL+EL ++S  GIWGS Y    N L+ +AQF+ AL P G        
Sbjct: 460 HIRFRLAMKAQGRSLDELEFVSAVGIWGSAYSAVINSLILVAQFYCALWPIGGWENSSIR 519

Query: 520 AEAFFESYLAFPVWLFFYLGYMLYSRDFT----FLTDLKKIDLDNHRRLYDPELLRQEDE 575
           A+ FF+SYL   + +  ++G+ ++ R  T     +  L KIDL+  R+  D E+L+QE  
Sbjct: 520 AKKFFQSYLCALIMIVLFVGHKIFYRYKTGKWWSMLPLNKIDLETDRKNIDIEILKQEIA 579

Query: 576 ETKERIRNGGWTQKLLNFWC 595
           E    +R   W  +  +FWC
Sbjct: 580 ERNRHLRASPWYVRWYHFWC 599

>Scas_507.1
          Length = 592

 Score =  405 bits (1040), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 224/535 (41%), Positives = 320/535 (59%), Gaps = 7/535 (1%)

Query: 62  IDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFM 121
           I  ED  N++    NL K +  RH++ +++G  IG GL V +   L   GPASLVI + +
Sbjct: 64  ISHEDDINNV----NLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWII 119

Query: 122 VSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELIT 181
           +S   + VI A GEMA  +P + GGFN Y + F+    GFA    +  QWL +LPLEL+ 
Sbjct: 120 ISTCLFTVINALGEMAAAFPVV-GGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVA 178

Query: 182 ASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIV 241
           ASMTIKYWN+ IN+D                 V+++GE EF+ +  KIL I GF IL IV
Sbjct: 179 ASMTIKYWNETINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIV 238

Query: 242 VNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQE 301
           + CGG    G+IGGKYW  PG+F   N+ ++FKG+  V VTA FSY G+E+ A+S  E +
Sbjct: 239 LACGGGPHGGFIGGKYWNHPGSFVGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESK 298

Query: 302 NPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHAS-PYVLAVSIH 360
           +PR + P AAK++               G  VP++  +L+    S   AS P V+A+   
Sbjct: 299 DPRTTIPKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIEND 358

Query: 361 GVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALIL 420
           G+K +P ++NA+ILIS+ SVANSA+YA  R + ++A  G  P+  N VD +GRP+ A+I 
Sbjct: 359 GIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIF 418

Query: 421 CSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELG 480
              FG+++F A SD++  +FTWL+A++GLS +F W +I LSH+RFR +M  Q +SL+EL 
Sbjct: 419 TLFFGLLSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELP 478

Query: 481 YISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGY 540
           ++S TG+WGS YG     LV +A FW +L P G      AE+FFE YL+FP+ L  Y G+
Sbjct: 479 FLSQTGVWGSWYGTIVLFLVLVASFWTSLFPLGGTSA-DAESFFEGYLSFPILLACYFGH 537

Query: 541 MLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
            LY R   F+  L  +DLD  RR  D ++ R+E    +E +    + +  L+ WC
Sbjct: 538 KLYVRKREFMVGLADMDLDTGRRQVDLDVRREELRREREELAKQSFFKSFLHVWC 592

>Scas_479.1
          Length = 595

 Score =  400 bits (1028), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 218/551 (39%), Positives = 329/551 (59%), Gaps = 6/551 (1%)

Query: 48  FVDSFKRAEVNHNGIDLEDGTNSIQSDDN--LKKAMKSRHVIMMSLGTGIGTGLLVANAK 105
           F +  K + +  N ID+   ++  + D N  L K +  RH++ +++G  IG GL V +  
Sbjct: 48  FNEKSKDSPIEDN-IDITSQSSVTKEDINKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGA 106

Query: 106 GLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVW 165
            L   GPASLVI + ++S   + VI + GE+A  +P + GGFN Y + FV   F FA   
Sbjct: 107 ALASGGPASLVIDWVIISTCLFTVINSLGELAAAFPVV-GGFNVYITRFVDPSFAFAVNL 165

Query: 166 LFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFN 225
            +  QWL +LPLEL+ AS+TIKYWN  IN+D                 V+++GE EF+ +
Sbjct: 166 NYLAQWLVLLPLELVAASITIKYWNSTINSDAWVAIFYTVITLANMLDVKSFGETEFVLS 225

Query: 226 SCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYF 285
             KIL I GF IL IV++CGG    GY+GGKYW +PGAF    + ++FKG+  V VTA F
Sbjct: 226 MVKILAIIGFTILGIVLSCGGGPKGGYLGGKYWHNPGAFVGHTSGTKFKGLCSVFVTAAF 285

Query: 286 SYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLM-GAG 344
           SY G+E+ A+S  E ++PR++ P AAK++               G  VP++  +LM G  
Sbjct: 286 SYSGIEMTAVSAAESKDPRKTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTS 345

Query: 345 GSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKY 404
                ASP V+A+   G+K +  ++NA+ILIS+ SVANSA+YA  R + S+A  G  PK 
Sbjct: 346 SVDAAASPLVIAIENGGIKGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKK 405

Query: 405 FNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVR 464
              VD+ GRP+ A ++   FG+++F A SD++  +FTWL+A++GLS +F W +I +SH+R
Sbjct: 406 LGKVDKRGRPINATLVTLFFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIR 465

Query: 465 FRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFF 524
           FR AM  Q +SL+E+ Y+S TG+WGSLYG     LV +A FW +L P G       ++FF
Sbjct: 466 FRQAMIKQNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSA-DVQSFF 524

Query: 525 ESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNG 584
           E YL+ P+ +  Y+G+ LY ++++++  L+++DLD  R+  DP L R E    +  +   
Sbjct: 525 EGYLSLPILIVCYIGHKLYFKNWSWVVTLEEMDLDTGRKALDPHLHRAEVLAEEAAVAKM 584

Query: 585 GWTQKLLNFWC 595
            + ++  + WC
Sbjct: 585 SFIKRFWHVWC 595

>CAGL0D02178g 222597..224330 highly similar to sp|P38967
           Saccharomyces cerevisiae YOL020w SCM2 high affinity
           tryptophan transport protein, hypothetical start
          Length = 577

 Score =  395 bits (1016), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 225/596 (37%), Positives = 326/596 (54%), Gaps = 31/596 (5%)

Query: 6   KNETSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAEVNHNGIDLE 65
           K E     +  T    + P  +    P P    V  R  F R VDSFK            
Sbjct: 7   KEEIHTSTSEFTKYDSQKPYYSSGESPEP---VVTKRNIFQRCVDSFKPPV--------- 54

Query: 66  DGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFI 125
           DG+       NLK+ +KSRH+IM+++G  IGTGL + + + L   GP +++IG+ +    
Sbjct: 55  DGSFD---TSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQ 111

Query: 126 TYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMT 185
               I   GE+ V +P + G F +Y++ F+     F    ++ IQW  VLPLE+I +++T
Sbjct: 112 IVGTIHGLGEITVRFPVV-GAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAIT 170

Query: 186 IKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCG 245
           I+YWN  I+                  G R +GEAEF+F++ K + I GF+IL IV+ CG
Sbjct: 171 IQYWNSSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICG 230

Query: 246 GAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRR 305
           G     +IG KYW DPGA A       F GV  VLV A +S GG E+  L+  E +   +
Sbjct: 231 GGPDHEFIGAKYWHDPGALAHG-----FPGVLSVLVVASYSLGGTEMTCLASGETDP--K 283

Query: 306 STPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVV 365
             P+A KQ                GF VP+ ++ L+G  GS+   SP+V+A+ +H +K +
Sbjct: 284 ELPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLG--GSSVDNSPFVIAIKLHHIKAL 341

Query: 366 PHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFG 425
           P I+NAVILIS+ SV NS ++AS R L S+A QG  P++F Y+DR GRPL  ++  S+FG
Sbjct: 342 PSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFG 401

Query: 426 VIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISIT 485
           ++AF   S     +F WL AIAGL+    W SI LSH+RFRLAMKAQ K+L+EL ++S  
Sbjct: 402 LLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSAV 461

Query: 486 GIWGSLYGCFFNVLVFIAQFWVALSPPG--SKGVYSAEAFFESYLAFPVWLFFYLGYMLY 543
           GIWGS Y    NVL+ IAQF+++L P G  +     A+ FF+SYL   + L  +  + +Y
Sbjct: 462 GIWGSAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIHKVY 521

Query: 544 SR----DFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
            R     +  +  LK IDL+  R+  D ++++ E  E K  ++   W  +  +FWC
Sbjct: 522 YRVSFGKWWDVKPLKDIDLETGRKNVDIDVIKAEIAERKMYLKKKPWIVRWYHFWC 577

>YOL020W (TAT2) [4796] chr15 (286172..287950) High affinity
           tryptophan permease, also transports other aromatic
           amino acids, alanine and glycine, member of the amino
           acid permease family [1779 bp, 592 aa]
          Length = 592

 Score =  393 bits (1010), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 223/560 (39%), Positives = 315/560 (56%), Gaps = 28/560 (5%)

Query: 42  RTHFNRFVDSFKRAEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLV 101
           R  F R VDSFK            DG+       NLK+ +K RH+IM+++G  IGTGL V
Sbjct: 55  RNIFQRCVDSFKSPL---------DGSFD---TSNLKRTLKPRHLIMIAIGGSIGTGLFV 102

Query: 102 ANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGF 161
            + K +   GP  +VIG+ +        I   GE+ V +P + G F NY + F+     F
Sbjct: 103 GSGKAIAEGGPLGVVIGWAIAGSQIIGTIHGLGEITVRFPVV-GAFANYGTRFLDPSISF 161

Query: 162 ATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAE 221
               ++ +QW  VLPLE+I A+MT++YWN  I+                  GVR +GEAE
Sbjct: 162 VVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGVRGFGEAE 221

Query: 222 FIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLV 281
           F F++ K + + GF+IL +V+ CGG     +IG KYW DPG  A+      F GV  VLV
Sbjct: 222 FAFSTIKAITVCGFIILCVVLICGGGPDHEFIGAKYWHDPGCLANG-----FPGVLSVLV 276

Query: 282 TAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLM 341
            A +S GG+E+  L+  E +   +  P+A KQ                GF VP+ +  L+
Sbjct: 277 VASYSLGGIEMTCLASGETDP--KGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLL 334

Query: 342 GAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYA 401
           G  GS+   SP+V+A+ +H +K +P I+NAVILISV SV NS ++AS R L S+A QG  
Sbjct: 335 G--GSSVDNSPFVIAIKLHHIKALPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLI 392

Query: 402 PKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLS 461
           P +F Y+DR GRPL  ++  S+FG++AF   S     +F WL AIAGL+    W SI LS
Sbjct: 393 PWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLS 452

Query: 462 HVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPG--SKGVYS 519
           H+RFRLAMKAQGKSL+EL ++S  GIWGS Y    N L+ IAQF+ +L P G  + G   
Sbjct: 453 HIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWTSGKER 512

Query: 520 AEAFFESYLAFPVWLFFYLGYMLYSRDFT----FLTDLKKIDLDNHRRLYDPELLRQEDE 575
           A+ FF++YL   + LF ++ + +Y +  T     +  LK IDL+  R+  D E+++QE  
Sbjct: 513 AKIFFQNYLCALIMLFIFIVHKIYYKCQTGKWWGVKALKDIDLETDRKDIDIEIVKQEIA 572

Query: 576 ETKERIRNGGWTQKLLNFWC 595
           E K  + +  W  +  +FWC
Sbjct: 573 EKKMYLDSRPWYVRQFHFWC 592

>KLLA0A06930g complement(625498..627261) similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, hypothetical start
          Length = 587

 Score =  387 bits (994), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 237/591 (40%), Positives = 345/591 (58%), Gaps = 23/591 (3%)

Query: 15  SITSSTLKTPNVTEKFEPY---PDTTAVKHRTHFNRFVDSFKRAEVNHNGIDLEDGTNS- 70
           SI   T   P   ++   Y    DT+ V   T + RF DSF+ AE     +DL+      
Sbjct: 10  SIVQETQLEPGEFDELNSYVSQSDTSRVGG-TRWERFKDSFREAET----VDLDPSLTPA 64

Query: 71  -----IQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFI 125
                + ++  LK+ +KSRH+ M+ +G  IGTGL V + K L  AGPA ++IG+ +   +
Sbjct: 65  EKMAILTANAPLKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTM 124

Query: 126 TYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMT 185
            Y ++ A GE+AVT+P + GG+  YAS FV + FGFA   ++ + WL  LPLE++ AS+T
Sbjct: 125 IYCMVMAMGELAVTFP-VAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASIT 183

Query: 186 IKYWNDKIN-ADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNC 244
           + YW       D                GV+ YGEAEFIF+  K++ + GF+IL +++ C
Sbjct: 184 VNYWGTPAKYRDAFVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVC 243

Query: 245 GGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPR 304
           GG    GYIGG+ W +PGAFA+      FKGV  V VTA FS+ G EL  L+  E  NPR
Sbjct: 244 GGGPQGGYIGGRLWHNPGAFANG-----FKGVCSVFVTAAFSFAGSELVGLAAAETANPR 298

Query: 305 RSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKV 364
           +S P+AAKQ                G  VP+ SD+L+G       ASP+V+++   G+K 
Sbjct: 299 KSIPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKG 358

Query: 365 VPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIF 424
           +P +IN VILI+V SV N A++   R + +LA QG  PK F Y+DR GRPL  +++  +F
Sbjct: 359 LPSVINVVILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVF 418

Query: 425 GVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISI 484
           G+++F A S +E  +F WL A++GLS LFTW  ILL H+R R A+ AQ ++  EL + + 
Sbjct: 419 GLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAP 478

Query: 485 TGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYS 544
           T +WGS+Y     +L+ IAQFW+AL P G K   SA AFFE+YL+FP+++ FY+G+ ++ 
Sbjct: 479 TDVWGSVYSLILIILILIAQFWIALFPIGGKP--SAAAFFEAYLSFPIYIVFYIGHKIWK 536

Query: 545 RDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
           +++        ID+D+ RR  D E L+QE  E K  I +  +  ++  FWC
Sbjct: 537 KNWKLFIKASDIDIDSGRRETDIEALKQEIAEEKAFIASKPFYYRMYKFWC 587

>AEL030W [2476] [Homologous to ScYOL020W (TAT2) - SH]
           complement(577332..579551) [2220 bp, 739 aa]
          Length = 739

 Score =  387 bits (994), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 215/569 (37%), Positives = 325/569 (57%), Gaps = 32/569 (5%)

Query: 35  DTTAVKHRTHFNRFVDSFKRAEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTG 94
           + +    R    R +DSFK            DG+      DNLK+ +KSRH+IM+++G  
Sbjct: 195 EESRTNKRGLVRRCIDSFKPPV---------DGSFD---PDNLKRTLKSRHLIMIAIGGS 242

Query: 95  IGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIF 154
           IGTGL + + K L   GP +++IG+ +        I   GE+ V +P + G F NY++ F
Sbjct: 243 IGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTIHGLGEVTVRFPVV-GAFANYSTRF 301

Query: 155 VSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGV 214
           +     F    ++ +QW  VLPLE+I +++T+++W   ++                  GV
Sbjct: 302 LDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTTSVDPVVWVAVFYTLIISINLFGV 361

Query: 215 RAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFK 274
           R +G+ +F+F+  K++ I GF+IL +V+  GG     +IG +YW DPGA A+      FK
Sbjct: 362 RWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTHEFIGARYWHDPGALANG-----FK 416

Query: 275 GVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVP 334
           GVA V+VTA +S GG E+  L+  E +   +  P A KQ                GF VP
Sbjct: 417 GVAAVMVTASYSLGGSEMTCLASGETDP--KEIPHAIKQIFWRIIFFFLVSLTLVGFLVP 474

Query: 335 HNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRS 394
           + +DQL+G  GS  + SP+V+A+ +H ++V+PHIIN VIL+S+ SV NS ++AS R L S
Sbjct: 475 YTNDQLLG--GSNVNNSPFVIAIKMHNIRVLPHIINGVILVSILSVGNSCIFASSRTLCS 532

Query: 395 LAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFT 454
           +A QG  P+ F YVDR GRPL  ++  S+FG++AF   S     +FTWL A+AGL+    
Sbjct: 533 MAHQGLLPRIFGYVDRAGRPLTGILTNSLFGLLAFLVKSSSTGTVFTWLMAVAGLATAVV 592

Query: 455 WSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSP--- 511
           W SI +SH+RFRLAMKAQGKSL+EL ++S  G+WGS+Y    NV+V +AQF+V+L P   
Sbjct: 593 WLSINVSHIRFRLAMKAQGKSLDELEFVSAVGMWGSVYSGVMNVVVLVAQFYVSLWPIEG 652

Query: 512 -PGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFT----FLTDLKKIDLDNHRRLYD 566
               +G    EAFF++YL   + LF ++ + +Y R  T     +  L +IDL++ R+  D
Sbjct: 653 WKDPRG--RTEAFFQNYLCALILLFMFVAHKIYYRSTTGQWWKILPLAEIDLESGRKNID 710

Query: 567 PELLRQEDEETKERIRNGGWTQKLLNFWC 595
            E+++ E    K+ I    W  +  ++WC
Sbjct: 711 IEVVKHEVAARKKYISEQRWYIRYYHYWC 739

>KLLA0A10813g complement(936126..937880) similar to sp|P38967
           Saccharomyces cerevisiae YOL020w SCM2 high affinity
           tryptophan transport protein, hypothetical start
          Length = 584

 Score =  368 bits (945), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 218/568 (38%), Positives = 323/568 (56%), Gaps = 30/568 (5%)

Query: 35  DTTAVKHRTHFNRFVDSFKRAEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTG 94
           D    K++    R +DSFK            DG+      DNLK+ +KSRH+IM+++G  
Sbjct: 40  DKKEDKNKNIVRRMIDSFKPPL---------DGS---YHSDNLKRKLKSRHLIMIAIGGS 87

Query: 95  IGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIF 154
           IGTGL V + K L   GP +++IG+ +        I   GE+ + +P + G F NY++  
Sbjct: 88  IGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVGTIHGLGEITMRFPVV-GAFANYSTRL 146

Query: 155 VSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGV 214
           +     F    ++  QW  VLP+ELI ++MT+++W  K++                  GV
Sbjct: 147 LDPSISFMVSSIYICQWYFVLPIELIASAMTVQFWTTKVDPVVWVAIFYVIVVSVNLFGV 206

Query: 215 RAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFK 274
           + +GEAEF F+  K++ I GF+ILSI++ CGG     +IG +YW  PGA A+      FK
Sbjct: 207 KVFGEAEFAFSLVKVITIIGFIILSIILICGGGPDHRFIGTEYWHHPGALANG-----FK 261

Query: 275 GVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVP 334
           GVA V VTA +S GG E+  L     E   +  P A KQ                GF VP
Sbjct: 262 GVASVFVTASYSLGGSEMVCLC--SAETDPKELPHAIKQVFWRIVFFFLVSLTLVGFLVP 319

Query: 335 HNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRS 394
           + ++ L+G  GS+ + SP+V+A+ + G++V+P IINAVILIS+ SV NS ++AS R L S
Sbjct: 320 YTNENLLG--GSSVNNSPFVIAIKLSGIRVLPSIINAVILISILSVGNSCIFASSRTLCS 377

Query: 395 LAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFT 454
           +A QG  P+ F YVDR GRPL  +I+ S+FG++AF   S    V+F WL AIAGL+    
Sbjct: 378 MAHQGLIPRVFGYVDRAGRPLVGIIVNSLFGLLAFLVKSASMGVVFDWLMAIAGLATCVV 437

Query: 455 WSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPG- 513
           W SI +SH+RFRLAMKAQ +SL+EL + S  G++GS+Y    N+L+ IAQF+++L P G 
Sbjct: 438 WLSINISHIRFRLAMKAQNRSLDELEFKSSVGVYGSIYSATVNILILIAQFYISLWPVGG 497

Query: 514 -SKGVYSAEAFFESYLAFPVWLFFYLGYMLY-----SRDFTFLTDLKKIDLDNHRRLYDP 567
            +      E+FF++YL   V +F ++ + +Y      + F F   L +IDL+  R+  D 
Sbjct: 498 WTSSQQRTESFFKNYLCALVLVFVFVTHKIYFKCSTGKWFDF-KPLAEIDLETDRKNIDI 556

Query: 568 ELLRQEDEETKERIRNGGWTQKLLNFWC 595
           E+++QE  E +  + +  W  +  NFWC
Sbjct: 557 EIVKQEVREREMYLASKPWYIRFYNFWC 584

>Kwal_34.16254
          Length = 481

 Score =  347 bits (889), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 191/478 (39%), Positives = 275/478 (57%), Gaps = 24/478 (5%)

Query: 17  TSSTLKTPNVTEKFEPYPDTTAVK--HRTHFNRFVDSFKRAEVNHNGIDLEDGTNSIQSD 74
           +   +K+ + +EK  P  D    +  +R    R VDSFK  E         DG+      
Sbjct: 23  SGQEIKSSDFSEKTTPENDGVRRRSTNRNVLQRMVDSFKPPE---------DGSFH---S 70

Query: 75  DNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAG 134
           DNLKK++K+RH++M+++G  IGTGL + + K L L GP +L+IG+ +        I   G
Sbjct: 71  DNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGTIHGLG 130

Query: 135 EMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKIN 194
           E+ V +P + G F +Y + F+     F  V ++ +QW  VLPLE+I A+MT++YW+  ++
Sbjct: 131 EITVRFPVV-GAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDTSVS 189

Query: 195 ADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIG 254
                             GVR +GEAEF+F+  K++ I GF+IL IV+ CGG     ++G
Sbjct: 190 PVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKKEFVG 249

Query: 255 GKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQS 314
            KYW DPG  A+      FKGVA VLV A +S GG E+  L+  E +   +  P+A KQ 
Sbjct: 250 AKYWHDPGPLANG-----FKGVAGVLVIASYSLGGTEMACLASGETDP--KELPSAIKQV 302

Query: 315 XXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVIL 374
                          GF VP+ +  LMG  GS+   SP+V+A+ +HG+  +P I+NAVIL
Sbjct: 303 FWRIVFFFLVSLTLVGFLVPYTNQNLMG--GSSVDNSPFVIAIRLHGINALPSIVNAVIL 360

Query: 375 ISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSD 434
           +S+ SV NS ++AS R L S+A QG  P+ F Y+DR GRPL  ++   +FG++AF   S 
Sbjct: 361 VSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFLVKSG 420

Query: 435 QEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLY 492
               +FTWL AIAGL+    W SI +SH+RFRLAMKAQG  L EL ++S  GI+GS+Y
Sbjct: 421 SAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEFVSGVGIYGSVY 478

>Scas_536.1
          Length = 372

 Score =  319 bits (818), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 170/372 (45%), Positives = 235/372 (63%), Gaps = 2/372 (0%)

Query: 224 FNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTA 283
           F+  K+  + GF+IL IV+ CGG    G++G KYW DPGAF    + ++FKGV  V VTA
Sbjct: 3   FSIIKVTTVIGFIILGIVLVCGGGPKGGFVGAKYWHDPGAFVGHGSGAQFKGVCSVFVTA 62

Query: 284 YFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGA 343
            FS+ G EL  ++  E  NPR+S P AAKQ                G  VP+N  +L+GA
Sbjct: 63  AFSFAGSELIGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGA 122

Query: 344 GGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPK 403
                 ASP+V+A+  HG+K +P +IN VILI+V SV NSA++A  R + +L++QG+ PK
Sbjct: 123 SSVDAAASPFVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALSDQGFLPK 182

Query: 404 YFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHV 463
            F Y+DR GRPL  + + S FG++AF A S +E  +F WL A++GLS LFTW  I L H+
Sbjct: 183 VFGYIDRSGRPLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHI 242

Query: 464 RFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAF 523
           RFR+A+KAQG+  NEL ++S  G+ GS +G F  VL+FIAQF+VAL PPG K    AE F
Sbjct: 243 RFRMALKAQGRDTNELTFVSPAGVAGSYWGLFMIVLMFIAQFYVALFPPGGKP--DAEVF 300

Query: 524 FESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRN 583
           F+SYL+FP+ +  Y G+ +Y R++     L+ +D+D  RR  D ELL+QE  E K  + +
Sbjct: 301 FQSYLSFPIVVATYFGHKIYKRNWKLFIPLEDMDIDTGRRETDMELLKQEIMEEKAILAS 360

Query: 584 GGWTQKLLNFWC 595
             W  +   FWC
Sbjct: 361 KPWYIRAYAFWC 372

>Kwal_56.22951
          Length = 596

 Score =  325 bits (833), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 217/611 (35%), Positives = 326/611 (53%), Gaps = 31/611 (5%)

Query: 1   MESSKKNE-TSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAEV-N 58
           M+   KNE     V+S+ S T            +      K R   +    SF+R E  N
Sbjct: 1   MDKDYKNEGVEQAVSSVESRTWNGETSGSLINRFKQ----KSRRQIHDIAHSFQRQEAPN 56

Query: 59  HNGIDL-----EDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLA-GP 112
             G+DL     E   N   ++   +K++  RH++M+S+G  +GTGL +    G  LA GP
Sbjct: 57  SEGVDLSLLSEEQRRNYELANQPYEKSLSQRHLMMISIGGTLGTGLFIG--LGFSLASGP 114

Query: 113 ASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWL 172
            SL+IG+ +V  + + V+Q+A EMA  YP + G F+ + S F+    GF     + + WL
Sbjct: 115 GSLLIGFLIVGLMMFCVVQSAAEMACQYP-VSGSFSTHVSRFMEPSIGFTVSTNYALAWL 173

Query: 173 TVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMI 232
              P ELI  ++T++YW+  +N                  GVR YGEAEF  +  K++ I
Sbjct: 174 ISFPSELIGCAITLRYWSS-VNGAVWVAIFYVFIMQLNLFGVRGYGEAEFWMSLFKVVAI 232

Query: 233 GGFVILSIVVNCGGA-GVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVE 291
             F+I+ IV+ CGG     GYIG KYW +PG+FA       FKG+    ++A FS+GG E
Sbjct: 233 VIFIIIGIVLICGGGPHSSGYIGTKYWHNPGSFAKPV----FKGLCNTFISAAFSFGGAE 288

Query: 292 LFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAG-GSATHA 350
           L  L+ +E +    S   AAK +               G  VP+  D+L+G   G    A
Sbjct: 289 LVVLTASESKKVE-SVSRAAKGTFWRIAIFYITTVVVIGCLVPYTDDRLLGGDTGEDITA 347

Query: 351 SPYVLAVSIHGV--KVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYV 408
           SP+V+A+S  G     V H +NAVILI+V SV NS +YAS R++++L   G  P+   Y+
Sbjct: 348 SPFVIALSGQGSMGTKVSHFMNAVILIAVLSVCNSCVYASSRVIQALGACGQLPRACGYI 407

Query: 409 DREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLA 468
           D++GRPL  + +C +FG++ F    D+++ +FTWL A+  +S  FTW  I +S VRFRLA
Sbjct: 408 DKKGRPLVGIAICGVFGLLGFLVACDKQDDVFTWLFALCSISSFFTWFCICVSQVRFRLA 467

Query: 469 MKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYL 528
           ++AQG+S +E+ + S+ GI+G + G   N+L+   + +V++ P G  G  SAE FF+  +
Sbjct: 468 LRAQGRSTDEIAHKSMLGIYGGILGGVLNILLIAGEIYVSIFPLG--GSPSAEQFFQYCM 525

Query: 529 AFPVWLFFYLGYMLYS---RDFT-FLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNG 584
           + P+ +  Y  +  Y    RD    L  L +IDLD+ RR+ D EL + E EE K RI   
Sbjct: 526 SIPIMIVVYALHKTYKATRRDAKRILVPLSEIDLDSGRRIQDIELFKHELEEDKARIAAK 585

Query: 585 GWTQKLLNFWC 595
               ++  FWC
Sbjct: 586 PLYYRIYRFWC 596

>KLLA0B06776g 594172..595938 similar to sgd|S0006195 Saccharomyces
           cerevisiae YPL274w SAM3 high affinity
           S-adenosylmethionine permease, start by similarity
          Length = 588

 Score =  309 bits (792), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 201/588 (34%), Positives = 311/588 (52%), Gaps = 23/588 (3%)

Query: 22  KTP-NVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAE-VNHNGIDLE-------DGTNSIQ 72
           K P  V+E F     T     R+ F R  DSFKR E V   GIDL+         TN + 
Sbjct: 10  KDPTQVSENFTQSLYTDEDGSRSLFTRVKDSFKRQELVETEGIDLDTYSMTDYQRTNYLL 69

Query: 73  SDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQA 132
           +    +K +  RH+ M+++G  +GTGL +     L  +GP +L+IG+ +     + V+Q 
Sbjct: 70  AKQPYQKNLSQRHLTMIAIGGTLGTGLFIGIGWSL-ASGPGNLLIGFLLTGLAIFCVVQC 128

Query: 133 AGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDK 192
           A E++  YP + G F ++ S FV   +GF     +C+ W    P ELI  +MTI YW+  
Sbjct: 129 AAELSCQYP-VSGSFASHVSRFVDPSWGFTVTTNYCLAWSISFPSELIGCAMTIGYWDSS 187

Query: 193 INADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGA-GVDG 251
           +N                  GVR + E E++ +  KIL I  F+I+ +V+ CGG    +G
Sbjct: 188 VNPVVWVIIFWLFIMALNLFGVRGFAETEYVLSIFKILAIIIFLIIGVVLICGGGPNSNG 247

Query: 252 YIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAA 311
           YIG KYW DPG+F     A  FK +    V+A FS+GG EL  L+  E      S   AA
Sbjct: 248 YIGTKYWHDPGSFK----APVFKSLCNTFVSAAFSFGGTELVVLTAAESRKVE-SISRAA 302

Query: 312 KQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSA-THASPYVLAVSIHGV--KVVPHI 368
           K +               G  VP+  ++L+G   S    ASP+V+A++  G   + V + 
Sbjct: 303 KGTFWRVIVFYVSTVVVIGCLVPYTDERLLGGDTSEDIAASPFVIALANTGKFGERVSNF 362

Query: 369 INAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIA 428
           +NAVILI+V SV NS +YA+ R+++SL   G  P    YVDR+GRPL  +++  +FG + 
Sbjct: 363 MNAVILIAVLSVCNSCVYAASRVIQSLGASGQLPSICGYVDRKGRPLFGILVVGLFGFLP 422

Query: 429 FCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIW 488
           F   S++   +F WL A+  +S +F W SI  S++R+R A+K Q +S +E+ Y S+ GIW
Sbjct: 423 FIVASNKVSEVFDWLFALCSISSMFIWFSICYSYLRYRWALKKQNRSADEIAYKSMLGIW 482

Query: 489 GSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDF- 547
           G+  G   + L+ + + +V+L P G     SAEAFF+  L+ P+ +  Y+G+  Y+ ++ 
Sbjct: 483 GAYLGLLLSALLIVGEIYVSLFPLGESP--SAEAFFKYCLSIPIMIAVYIGHKSYTGNWK 540

Query: 548 TFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
           +F+  L  IDLD      D E+++ E E  + ++ +     ++  FWC
Sbjct: 541 SFVIPLSGIDLDTGLSHSDVEIMKHELEIQRVKLASKPLYYRIFRFWC 588

>YPL274W (SAM3) [5177] chr16 (22938..24701) High affinity
           S-adenosylmethionine permease, member of the amino acid
           permease family of membrane transporters [1764 bp, 587
           aa]
          Length = 587

 Score =  304 bits (779), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 201/607 (33%), Positives = 315/607 (51%), Gaps = 32/607 (5%)

Query: 1   MESSKKNETSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAEVNHN 60
           M+  K+   S +   I + +   PN +++             +   R  DSFK++ ++  
Sbjct: 1   MDILKRGNESDKFTKIETESTTIPNDSDR-----------SGSLIRRMKDSFKQSNLHVI 49

Query: 61  GIDLEDGTNSIQSDDNLK-------KAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPA 113
             DLE+   + Q     K       K +  RH+ M+++G  +GTGL +     L  +GPA
Sbjct: 50  PEDLENSEQTEQEKIQWKLASQPYQKVLSQRHLTMIAIGGTLGTGLFIGLGYSL-ASGPA 108

Query: 114 SLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLT 173
           +L+IG+ +V    + V+Q+A E++  +P + G +  + S F+ +  GF     + + WL 
Sbjct: 109 ALLIGFLLVGTSMFCVVQSAAELSCQFP-VSGSYATHVSRFIDESVGFTVATNYALAWLI 167

Query: 174 VLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIG 233
             P ELI  ++TI YWN  +N                  GVR + E EF  +  K++ I 
Sbjct: 168 SFPSELIGCALTISYWNQTVNPAVWVAIFYVFIMVLNLFGVRGFAETEFALSIIKVIAIF 227

Query: 234 GFVILSIVVNCGGA-GVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVEL 292
            F+I+ IV+  GG     GYIG KYW DPGAFA       FK +    V+A FS+GG EL
Sbjct: 228 IFIIIGIVLIAGGGPNSTGYIGAKYWHDPGAFAKP----VFKNLCNTFVSAAFSFGGSEL 283

Query: 293 FALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLM-GAGGSATHAS 351
             L+  E +N   +   AAK +               G  VP+N  +L+ G+      AS
Sbjct: 284 VLLTSTESKNIS-AISRAAKGTFWRIAIFYITTVVIIGCLVPYNDPRLLSGSNSEDVSAS 342

Query: 352 PYVLAVSIHGV--KVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVD 409
           P+V+A+S  G     V + +N VIL++V SV NS +YAS RL+++L   G  P   +Y+D
Sbjct: 343 PFVIALSNTGSMGAKVSNFMNVVILVAVVSVCNSCVYASSRLIQALGASGQLPSVCSYMD 402

Query: 410 REGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAM 469
           R+GRPL  + +   FG++ F   S +E+ +FTWL A+  +S  FTW  I +S +RFR+A+
Sbjct: 403 RKGRPLVGIGISGAFGLLGFLVASKKEDEVFTWLFALCSISSFFTWFCICMSQIRFRMAL 462

Query: 470 KAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLA 529
           KAQG+S +E+ Y SI G++G + GC  N L+   + +V+ +P GS    SAEAFFE  L+
Sbjct: 463 KAQGRSNDEIAYKSILGVYGGILGCVLNALLIAGEIYVSAAPVGSPS--SAEAFFEYCLS 520

Query: 530 FPVWLFFYLGYMLYSRDFT-FLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQ 588
            P+ +  Y  +  Y RD+  F     +IDLD    + + EL + + E  ++ I +  +  
Sbjct: 521 IPIMIVVYFAHRFYRRDWKHFYIKRSEIDLDTGCSVENLELFKAQKEAEEQLIASKPFYY 580

Query: 589 KLLNFWC 595
           K+  FWC
Sbjct: 581 KIYRFWC 587

>YLL061W (MMP1) [3363] chr12 (17956..19707) High affinity
           S-methylmethionine permease, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1752 bp, 583 aa]
          Length = 583

 Score =  301 bits (771), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 194/563 (34%), Positives = 298/563 (52%), Gaps = 23/563 (4%)

Query: 46  NRFVDSFKRAE-------VNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTG 98
           +RF +SFKR +       + ++ +  E+      ++   KK +  RH+ M+++G  +GTG
Sbjct: 31  HRFKNSFKRNDSPAIQEGLLYSELSEEEKIQWDLANQPYKKVLDQRHLTMIAIGGTLGTG 90

Query: 99  LLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKP 158
           L +   + L  +GPASL+IG+ +V      V+Q   E++  YP + G +  +AS F+   
Sbjct: 91  LFIGLGESL-ASGPASLLIGFLLVGASMLCVVQCGAELSCQYP-VSGSYALHASRFIDPS 148

Query: 159 FGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYG 218
            GF+    + + WL   P EL+  S+TI YW   +N                  G R + 
Sbjct: 149 VGFSIGINYLLMWLISYPSELVGCSLTISYWAPSVNPAAWVAIAFVLSMLLNLFGARGFA 208

Query: 219 EAEFIFNSCKILMIGGFVILSIVVNCGGAGVD--GYIGGKYWRDPGAFASDNAASRFKGV 276
           E+EF  +  KI+ +  F+I+ IV+  GG G D  GYIG KYW DPG+FA       FK +
Sbjct: 209 ESEFYMSIFKIVALFIFIIIGIVLIAGG-GPDSTGYIGTKYWHDPGSFA----VPVFKNL 263

Query: 277 AFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHN 336
               V+A +S+ G E+  L+  E  +   S   AAK +               G  VP+N
Sbjct: 264 CNTFVSAAYSFSGTEMVVLTSTEARSVS-SVSRAAKGTFWRIIIFYIVTVIIIGCLVPYN 322

Query: 337 SDQLM-GAGGSATHASPYVLAVSIHGV--KVVPHIINAVILISVTSVANSALYASPRLLR 393
             +L+ G+      ASP+V+A+S  G     V H +NAVILI+V SV NS +YAS RL++
Sbjct: 323 DPRLISGSSSEDITASPFVIALSNTGAMGTRVSHFMNAVILIAVFSVCNSCVYASSRLIQ 382

Query: 394 SLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELF 453
            LA  G  PK   Y+DR GRPL  + +C  FG++ F   S  +  +FTWL A+  +S   
Sbjct: 383 GLATAGQLPKICAYMDRNGRPLVGMAICGAFGLLGFLVVSKNQGTVFTWLFALCSISFFT 442

Query: 454 TWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPG 513
           TW  I    VRFR+AMKAQG+S +++ Y S  GI+G ++GC  NVL+ I + +V+ +P G
Sbjct: 443 TWFCICFCQVRFRMAMKAQGRSKDDIIYRSTLGIYGGIFGCILNVLLVIGEIYVSAAPVG 502

Query: 514 SKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFT-FLTDLKKIDLDNHRRLYDPELLRQ 572
           S    SA  FFE  ++ P+ +  Y+G+ +Y RD+  +      IDLD+   L D E  + 
Sbjct: 503 SPS--SAANFFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKRMDIDLDSGHSLEDFEATKL 560

Query: 573 EDEETKERIRNGGWTQKLLNFWC 595
           E +E K+ + +     ++  F+C
Sbjct: 561 ERDEDKKYVSSKPLYYRIYRFFC 583

>YNL268W (LYP1) [4340] chr14 (138549..140384) High affinity lysine
           permease, also transports methionine [1836 bp, 611 aa]
          Length = 611

 Score =  281 bits (719), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 185/592 (31%), Positives = 295/592 (49%), Gaps = 30/592 (5%)

Query: 1   MESSKKNETSPEVNSITSSTLKTP-NVTEKFEPYPDTTAVKHRT-------HFNRFVDSF 52
           M+   +++   E+ +I  S   TP ++ EK       T  KH +         N   +S 
Sbjct: 25  MQELPEDQIEHEMEAIDPSNKTTPYSIDEK----QYNTKKKHGSLQGGAIADVNSITNSL 80

Query: 53  KRAEVNHNGIDL-EDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAG 111
            R +V  +  D+ ED   +   D ++K+A+K RH+ M++LG  IGTGL V  +  L  AG
Sbjct: 81  TRLQVVSHETDINEDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAG 140

Query: 112 PASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQW 171
           P   +I Y  +  I YFV Q+ GEMA T+  +      ++  F+S  FG +  +++   W
Sbjct: 141 PVGSLIAYIFMGTIVYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNW 199

Query: 172 LTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILM 231
                +E+      I+YW DK+                    V+ YGE EF   S K+L 
Sbjct: 200 AITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLA 259

Query: 232 IGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFS 286
           I G++I ++++ CGG+   G IG +YWR+PGA+     +SD +  RF G    L+ A F+
Sbjct: 260 IMGYLIYALIIVCGGSH-QGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFT 318

Query: 287 YGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGS 346
           Y G EL  ++  E  NPR++ P A  +                G  VP+N D  + A  +
Sbjct: 319 YQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYN-DSRLSASSA 377

Query: 347 ATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFN 406
              +SP+V+++   G   +P I NAV+LI+V S ANS +Y   R+L SLA  G APK F 
Sbjct: 378 VIASSPFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFG 437

Query: 407 YVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFR 466
           YV R+G P   ++  +  G++AF   ++     F WL  I+ L+ L  W  I L+H+RF 
Sbjct: 438 YVTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFM 497

Query: 467 LAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFES 526
            A+K +G S ++L + +    +G+ Y  FF  ++   Q + A  P      +    FF S
Sbjct: 498 QALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCP------FKVSEFFTS 551

Query: 527 YLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETK 578
           Y++  +    ++G  +Y +   F+  L+ ID+D+ RR  + E +  ED+E K
Sbjct: 552 YISLILLAVVFIGCQIYYK-CRFIWKLEDIDIDSDRR--EIEAIIWEDDEPK 600

>CAGL0J08162g complement(801555..803348) Highly similar to sp|P32487
           Saccharomyces cerevisiae YNL268w LYP1 or sp|P04817
           Saccharomyces cerevisiae YEL063c CAN1 or sp|P38971
           Saccharomyces cerevisiae YNL270c ALP1, hypothetical
           start
          Length = 597

 Score =  273 bits (698), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 184/590 (31%), Positives = 291/590 (49%), Gaps = 24/590 (4%)

Query: 2   ESSKKNETSPEVNSITSSTLKTPNVTEKFEPYPDTTAV-KHRTHFNRFVDS------FKR 54
           E ++KNE S   +  +      P+  +  + Y  T A  K +T    F D+        R
Sbjct: 10  EKNEKNEASASTSHASEDIEIIPSRYDNEKFYSATEATHKKKTGSTGFDDTISLTHTLSR 69

Query: 55  AEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPAS 114
           + +  +  D +     +  D  +K+A+K RH+ M++LG  IGTGL V  +  L  +GP  
Sbjct: 70  SRIPTSMEDEDAEEAEVH-DTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVG 128

Query: 115 LVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTV 174
            +I Y  +  I YFV Q+ GEMA T+  +      ++  F+S  FG A  +++   W   
Sbjct: 129 ALIAYIFMGTIIYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAIT 187

Query: 175 LPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGG 234
             +E+      I+YW  K+                    V+ YGE EF   S K++ I G
Sbjct: 188 YAVEVSVIGQVIQYWTFKVPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVG 247

Query: 235 FVILSIVVNCGGAGVDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYGG 289
           ++I ++++ CGG+   G IG +YWR+PGA      +SD   +RF G    L+ A F+Y G
Sbjct: 248 YLIYALIIVCGGSH-QGPIGFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQG 306

Query: 290 VELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATH 349
            EL  ++  E  NPR+S P A  +                G  VP+N D  + A  +   
Sbjct: 307 TELVGITAGEAANPRKSVPRAINKVVFRIVLFYIMSLFFVGLLVPYN-DPRLSASSAVIA 365

Query: 350 ASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVD 409
           +SP+V+++   G KV+P I NAV+L++V S ANS +Y   R+L +LA+ G APK F YV 
Sbjct: 366 SSPFVISIQNAGTKVLPDIFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVT 425

Query: 410 REGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAM 469
           R G P   +I  ++ G++AF   +      F WL  I+ L+ L  W  I L+H+RF  A+
Sbjct: 426 RHGVPYLGVICTALLGLLAFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQAL 485

Query: 470 KAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLA 529
           K +G S ++L + +    WG+ Y  FF  ++   Q + A +P      +    FF +Y++
Sbjct: 486 KFRGISRDDLPFKAKFMPWGAYYASFFVTVIIFIQGFQAFAPK-----FDVSEFFTAYIS 540

Query: 530 FPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKE 579
             + +  + G  LY R   FL  L+ ID+D+ RR  D   +  ED+E + 
Sbjct: 541 LILLVVLFAGCQLYYRC-RFLWKLEDIDIDSDRREIDA--IVWEDDEPQN 587

>AER405C [2905] [Homologous to ScYPL274W (SAM3) - NSH]
           (1413790..1415283) [1494 bp, 497 aa]
          Length = 497

 Score =  270 bits (690), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 171/513 (33%), Positives = 272/513 (53%), Gaps = 21/513 (4%)

Query: 88  MMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGF 147
           M+S+G  +GTGL +   + L  +GP +L+IG+ +V    + VIQ+A E++  YP + G F
Sbjct: 1   MISIGGTLGTGLFIGIGQSLQ-SGPGTLLIGFLIVGVSIFCVIQSAAELSCQYP-VSGSF 58

Query: 148 NNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXX 207
           +++ S F+    GF     + + WL   P EL+  +MTI YWN+ I              
Sbjct: 59  SSHVSRFIEPSLGFTVSCAYALSWLISFPNELVGLAMTIGYWNEDIPPAVWVLIGYLLVI 118

Query: 208 XXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGA--GVDGYIGGKYWRDPGAFA 265
                 VR + E+EF  +  K+L I  F+I+ IV+ CGG     +GY+GGKYW DPGAF 
Sbjct: 119 GLNLFAVRGFAESEFWLSIIKVLAIIIFLIIGIVIICGGGPNNKEGYLGGKYWHDPGAFR 178

Query: 266 SDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXX 325
                  F  +    V+A F++GG EL  L+ NE      S   AAK +           
Sbjct: 179 PPF----FSSLCQTFVSAAFTFGGAELVLLTANESRK-IESISRAAKGTFWRIAIFYIST 233

Query: 326 XXXXGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGV--KVVPHIINAVILISVTSVANS 383
               G  VP+ S  L    G +  ASP+V+A+S  G     V H +NAVI+ +V SV NS
Sbjct: 234 VIVIGCLVPYTSPAL---DGESIRASPFVIALSNTGSFGTNVSHFMNAVIVAAVLSVCNS 290

Query: 384 ALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWL 443
            +YA+ R+++SL   G  P+ F Y+D++GRPL  + +C++FG++AF   + + + +F WL
Sbjct: 291 CVYAASRVIQSLGACGQLPEIFGYIDKKGRPLVGIGVCAVFGLLAFLVETTKVKDVFNWL 350

Query: 444 AAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIA 503
            A+  ++  F W  I +S +R+R A+K QG    E+ Y S+ G W  + G   N L+   
Sbjct: 351 FALCSIAAFFVWFCICVSQLRYRRALKVQGFPTEEIAYQSMLGKWSGVIGTLLNFLLICG 410

Query: 504 QFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDF-TFLTDLKKIDLDNHR 562
           + +V++           E FF++ ++ P+ + FY  + LY RD+ T+L   + +DL+  R
Sbjct: 411 EIYVSVKDG------DVETFFQNCMSIPLLIIFYFCHRLYRRDWKTWLIPARDLDLNTGR 464

Query: 563 RLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595
           +  D E+++ E   ++ RI +  W  +   FWC
Sbjct: 465 KPEDLEMMKHELIVSRARIASSPWYYRAYRFWC 497

>Scas_706.36d
          Length = 607

 Score =  271 bits (694), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 177/587 (30%), Positives = 287/587 (48%), Gaps = 30/587 (5%)

Query: 3   SSKKNETSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTHF----NRFVDSFKRAEVN 58
           S++  +TSP+ +SI    +    + EK     D   + H   F    +   DS  R+ + 
Sbjct: 29  STEDEQTSPDDHSIE---IIKNEILEK-----DKKKIAHTNQFSSDIHSITDSLARSRLP 80

Query: 59  HNGIDLEDGTNSIQS--DDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLV 116
           H G D ++         D  +K+A+K RH+ M++LG  IGTGL V  +  L  +GP   +
Sbjct: 81  HLGDDDDEEDAEEAQYHDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSL 140

Query: 117 IGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLP 176
           I Y  +  I Y + Q+ GEMA   P +      ++  F+S  FG A  +++   W     
Sbjct: 141 IAYLFMGSIIYSITQSLGEMATFIP-VTSSITVFSKRFLSPAFGVANGYMYWFNWAITYA 199

Query: 177 LELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFV 236
           +E+      I+YW  K+                    V+ YGE EF     K+L I G++
Sbjct: 200 VEISVVGQVIEYWTKKVPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYL 259

Query: 237 ILSIVVNCGGAGVDGYIGGKYWRDPGAFAS-----DNAASRFKGVAFVLVTAYFSYGGVE 291
           + ++++ CGG+   G IG +YWR+PG + +     D   SRF G    L+ A F+Y G E
Sbjct: 260 LYALIIVCGGSS-QGPIGFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTE 318

Query: 292 LFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHAS 351
           L  ++  E  NPR+S P A  +                G  VP++ D  + +  +   +S
Sbjct: 319 LVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYD-DPRLSSDSAVVASS 377

Query: 352 PYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDRE 411
           P+V+++   G K++P I NA+++I+V S ANS +Y   R+L +LA+ G APK F YV R 
Sbjct: 378 PFVISIQNAGTKILPDIFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRH 437

Query: 412 GRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKA 471
           G P   ++  +  G++AF   ++     F WL  I+ L+ L  W  I +SH+RF  A+K 
Sbjct: 438 GVPYLGVLCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKF 497

Query: 472 QGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFP 531
           +G S ++L + +    W + Y  FF  ++   Q + A SP      +   AFF +Y++  
Sbjct: 498 RGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGFQAFSPH-----FDVTAFFTAYISLI 552

Query: 532 VWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETK 578
           +    ++G  +Y R   F   L+ ID+D  RR  + E +  ED+E K
Sbjct: 553 ILAVLFIGCQIYYR-CRFFWKLEDIDIDTDRR--EIEEVIWEDDEPK 596

>Scas_706.37
          Length = 544

 Score =  265 bits (678), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 165/552 (29%), Positives = 278/552 (50%), Gaps = 26/552 (4%)

Query: 54  RAEVNHNGIDLEDGTNSIQSDDN-------LKKAMKSRHVIMMSLGTGIGTGLLVANAKG 106
           + +V+   +D  D   +I + D+       +K+ +K RH+ M++LG  IGTGL +  A+ 
Sbjct: 5   QPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARP 64

Query: 107 LYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWL 166
           L +AGP   +I Y  +  + + V Q+ GEM  T+  +   F  +A  F+S  FG A  ++
Sbjct: 65  LIIAGPIGALIAYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYM 123

Query: 167 FCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNS 226
           +   W     LEL      I++W   +                    VR YGE EF   S
Sbjct: 124 YWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIAS 183

Query: 227 CKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLV 281
            K+L I GF+I  I + CG AGV G +G +YW++PG +     +S+   +RF G    L+
Sbjct: 184 VKVLAILGFIIYGICIICG-AGVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLI 242

Query: 282 TAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLM 341
            A F++ G EL  ++  E +NPR++ P A K+                G  VP+N  +L 
Sbjct: 243 NAAFTFQGTELVGITAGEAKNPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ 302

Query: 342 GAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYA 401
            +  S   +SP+++ +   G K++PHI NAVILI++ S  NS +Y   R+L  LA+   A
Sbjct: 303 -SNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAA 361

Query: 402 PKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLS 461
           PK+F    + G P   ++  S+FG +A+   +   +  FTWL  I G++  F W  I  S
Sbjct: 362 PKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCS 421

Query: 462 HVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAE 521
           H+RF  A+K +G S N+L Y ++   W + Y  FF V++ + Q + + +P      +   
Sbjct: 422 HIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPK-----FKVA 476

Query: 522 AFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERI 581
            FF +Y++  +++ F++ + ++ +    +  L+ +DLD  RR  + E+   + E+     
Sbjct: 477 NFFAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVED----- 530

Query: 582 RNGGWTQKLLNF 593
           +N  W  +  N+
Sbjct: 531 KNKNWWDRFWNY 542

>Kwal_33.13411
          Length = 560

 Score =  263 bits (673), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 171/551 (31%), Positives = 266/551 (48%), Gaps = 19/551 (3%)

Query: 34  PDTTAVKHRTHFNRFV--DSFKRAEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSL 91
           P T        F  +V  +  +     HN    ED    +Q +  +K+A+K RHV M++L
Sbjct: 11  PLTQGKTRSDEFQMYVYSNETQNGGSGHNS-SFEDDEGDLQ-EGQVKRALKPRHVSMIAL 68

Query: 92  GTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYA 151
           G  IGTGL V  A  L  AGP   +I Y  +  I YFV Q+ GEMA T+  +      ++
Sbjct: 69  GGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYFVTQSMGEMA-TFIPVTSSITVFS 127

Query: 152 SIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXX 211
           + F+S  FG A  +++   W     +E+      I+YW   +                  
Sbjct: 128 NRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIGIFWVAITLANF 187

Query: 212 XGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAF-----AS 266
             VR YGE EF   S K++ I G+++ ++++ CGG+   G IG +YWR+PG +     + 
Sbjct: 188 FPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGSK-QGPIGFRYWRNPGPWGDGIISG 246

Query: 267 DNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXX 326
           D    RF G    L+ A F+Y G EL  ++  E  NPR++ P A  +             
Sbjct: 247 DKDKGRFLGWVASLINASFTYQGTELVGITAGEAANPRKTVPKAINKVFFRILFFYILSL 306

Query: 327 XXXGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALY 386
              G  VP+N   L     S   +SP+V+++   G +++P I NAV+L+++ S ANS +Y
Sbjct: 307 FFVGLLVPYNHPGL-DKHTSVIASSPFVISIQSAGTRILPDIFNAVVLVTIISAANSNVY 365

Query: 387 ASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAI 446
              R+L SLA  G APK F+YV  +G P   +I  ++ G++AF    D     F WL  I
Sbjct: 366 VGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTALLGLLAFLVVDDNANEGFNWLINI 425

Query: 447 AGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFW 506
           + L+ L  W  I +SH+RF   +K +G S ++L + S    +G+ Y  F+  ++   Q +
Sbjct: 426 STLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYYAAFWVAVIIFVQGF 485

Query: 507 VALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYD 566
            A  P      +    FF  Y++  +    +    LY R   F   L+ ID+D+ RR  D
Sbjct: 486 QAFCPK-----FKVAEFFTGYISLILLAVVFCLAQLYYRC-RFFNRLEDIDIDSDRREID 539

Query: 567 PELLRQEDEET 577
             L+ +E+E T
Sbjct: 540 -ALIWEEEEPT 549

>KLLA0C02365g 208462..210201 similar to sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 lysine-specific high-affinity
           permease, hypothetical start
          Length = 579

 Score =  262 bits (670), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 175/545 (32%), Positives = 275/545 (50%), Gaps = 30/545 (5%)

Query: 53  KRAEVNHNGIDLEDGTNSIQSDDN--------------LKKAMKSRHVIMMSLGTGIGTG 98
           KR++   + I+L D   S +  D+              +K+A+K RHV M++LG  IGTG
Sbjct: 35  KRSKAGEDSIELSDVQVSSELYDHAESEEGEGDFHETEVKRALKPRHVSMIALGGTIGTG 94

Query: 99  LLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKP 158
           L V  AK L L+GP   +I Y  +  + YFV Q+ GEMA   P +      ++  F+S  
Sbjct: 95  LFVGIAKPLSLSGPVGSLIAYIFMGSVVYFVTQSLGEMATFIP-VTSSITVFSKRFLSPA 153

Query: 159 FGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYG 218
           FG A  +++   W     +EL      I YW D +                    V+ YG
Sbjct: 154 FGVANGYMYWFNWAITYAVELSVLGQIINYWTDAVPLAAWIAIFWVLLTAANFFPVKWYG 213

Query: 219 EAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAA-----SRF 273
           E EF   S K++ I G+++ ++++ CGG+   G IG +YWR+PG + +   A     +RF
Sbjct: 214 EFEFCVASIKVIAIVGYLLYALIIVCGGSS-QGPIGFRYWRNPGPWGTGTIAKNVNKARF 272

Query: 274 KGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNV 333
            G    LV A F+Y G EL  ++  E  NPR++ P A  +                G  V
Sbjct: 273 LGWVGSLVNASFTYQGTELVGITAGEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLLV 332

Query: 334 PHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLR 393
           P+NS QL  +  +   +SP+V+++   G KV+P I NAV+L+++ S  NS +Y   R+L 
Sbjct: 333 PYNSPQLE-SNSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLY 391

Query: 394 SLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELF 453
           SLA  G APK F+YV ++G P   +I  ++ G++AF A ++     F WL  I+ L+ L 
Sbjct: 392 SLALSGNAPKQFSYVTKQGVPYLGVICTALLGLLAFLATNENANTAFNWLINISTLAGLC 451

Query: 454 TWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPG 513
            W  I ++H+RF   +K +G S + L + +    WG+ Y  FF  L+   Q + A +P  
Sbjct: 452 AWFFISVAHIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFIQGFTAFAPR- 510

Query: 514 SKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQE 573
               +    FF +Y++  + +  ++   LY R   FLT ++ ID+D+ RR  D   +  E
Sbjct: 511 ----FDVSEFFTAYISLILLVVLFILCQLYYRC-RFLTKIEDIDIDSDRREIDA--IIWE 563

Query: 574 DEETK 578
           D+E K
Sbjct: 564 DDEPK 568

>CAGL0J08184g 804507..806225 similar to sp|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or sp|P38971 Saccharomyces
           cerevisiae YNL270c ALP1 or sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1, hypothetical start
          Length = 572

 Score =  262 bits (669), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 161/521 (30%), Positives = 262/521 (50%), Gaps = 16/521 (3%)

Query: 63  DLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMV 122
           DL    + +    ++K+++K RH+ M++LG  IGTGL +  A  L  AGP   ++ Y  +
Sbjct: 52  DLATEKDELLEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFM 111

Query: 123 SFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITA 182
             + + V Q+ GEMA   P +   F+ +A  F+S   G A  +++ + W     LEL   
Sbjct: 112 GTVVFSVTQSLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVV 170

Query: 183 SMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVV 242
              I++W  K+                    V+ YGE EF   S K+L + GF+I S+ +
Sbjct: 171 GQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI 230

Query: 243 NCGGAGVDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYGGVELFALSV 297
            CG AG  G IG +YWR+PGA      +S+   +RF G    L+ A F+Y G EL  ++ 
Sbjct: 231 VCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITA 289

Query: 298 NEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAV 357
            E  NPR++ P A ++                G  VP+N  +L     S   +SP+++ +
Sbjct: 290 GEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTD-SYVSSSPFIITI 348

Query: 358 SIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRA 417
              G +V+PHI NAVIL ++ S  NS +Y   R+L S+A+ G APK+      +G P  +
Sbjct: 349 QNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLS 408

Query: 418 LILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLN 477
           ++  S FG +++   S      F WL  I G++  F W  I  SHVRF  A+K +G S +
Sbjct: 409 VLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRD 468

Query: 478 ELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFY 537
           +L Y ++   W + Y  FF V++ + Q + + +P      +S   F  +Y++  ++L F+
Sbjct: 469 DLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPH-----FSGRDFVAAYISVGLFLVFW 523

Query: 538 LGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETK 578
             + +Y R    +  L+ +D+D  RR  + E +  ED+  K
Sbjct: 524 GFFQIYFR-CRIIWKLEDVDIDTDRR--EIESVVWEDDAPK 561

>KLLA0E16335g 1455271..1457088 gi|28565044|gb|AAO32605.1
           Kluyveromyces lactis DIP5, start by similarity
          Length = 605

 Score =  262 bits (670), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 183/598 (30%), Positives = 294/598 (49%), Gaps = 34/598 (5%)

Query: 19  STLKTPNVTEKFEPYPDTTAVKHRTH---FNRFVDSFKRAEVNHNGIDLEDGTNSIQSDD 75
           S + T    EK + + D   V  R+    ++   DS      + +G D+++        D
Sbjct: 12  SRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFD 71

Query: 76  ------NLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFV 129
                  LKKA+++RHV M+++G  +GTGLL+     L LAGPA+++I Y  V  + +FV
Sbjct: 72  GKHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFFV 131

Query: 130 IQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYW 189
           +   GEMA   P    GF +Y++ +     GFA  + +  ++  ++P +L   ++ I+YW
Sbjct: 132 MSCLGEMAAYIPL--DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189

Query: 190 --NDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGA 247
              DK+N                  GVR +GE E+  ++ KI ++ G +IL +V+ CGG 
Sbjct: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGG 249

Query: 248 GVDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQEN 302
                +G KYW++PGAF     A   A  RF   A V V A F+Y G EL  + V+E +N
Sbjct: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKN 309

Query: 303 PRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHAS--PYVLAVSIH 360
           PR++ P A K +               G  VP N   L+ A  + T AS  P+V+A+   
Sbjct: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNA 369

Query: 361 GVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALIL 420
           G+ V+PHI+NA ILI V S ANS LY + R L  LA    AP+ F   +++G P  +L++
Sbjct: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429

Query: 421 CSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELG 480
             +F ++A+   S     +FT+      +  L +W SIL++++RF  A + QG   + L 
Sbjct: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489

Query: 481 YISITGIWGSLYGCFFNVLV-FIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLG 539
           Y S    +G+ +  FF +L+  I  F     P      +  ++F   Y+  P ++  Y+G
Sbjct: 490 YQSPLQPYGAWFSLFFCILIGLIKNF-----PAFLGDTFDYKSFITGYIGIPTYIISYIG 544

Query: 540 YMLYSRDFTFLTDLKKIDLDNHRRLYD--PELLRQEDEETKERIRNGGWTQKLLNFWC 595
           Y L+ +  T +   +++DL + +   D   E  +  DEE    +   G   K    WC
Sbjct: 545 YKLWYK--TKIIPSEEVDLVSFKEAVDLEEEEGKMLDEERAAHLAAHGKDLK----WC 596

>Scas_520.2*
          Length = 372

 Score =  254 bits (650), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 144/382 (37%), Positives = 217/382 (56%), Gaps = 13/382 (3%)

Query: 215 RAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFK 274
           +++GE EF+ +  +IL I GF IL IV+ CGG     +I G+YW  PG+F   N+ ++FK
Sbjct: 3   KSFGETEFVLSMVRILAIIGFTILGIVLACGGGPHGSFIDGQYWNYPGSFVGHNSGTKFK 62

Query: 275 GVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVP 334
           G+  V V A FSY G+E+ A+S  E ++PR + P AAK++               G  VP
Sbjct: 63  GLCSVFVIAAFSYSGIEMTAVSPVENKDPRITIPKAAKRTFVLI-----------GCFVP 111

Query: 335 HNSDQLMGAGGSATHAS-PYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLR 393
           +++ +L+        AS P V+A+   G K +  ++NA+ILIS+ SVANSA+Y   R + 
Sbjct: 112 YDNPRLLSRTSFVDAASSPLVIAIENGGNKGLLTLMNAIILISIISVANSAVYTCSRCMV 171

Query: 394 SLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELF 453
           ++   G  P+  N VD +GRP+ A+I    FG+++F A SD++  +FTWL+A++GL  +F
Sbjct: 172 AMVHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFTWLSALSGLFTIF 231

Query: 454 TWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPG 513
            W +I LSH+R R AM  Q +SL+EL ++S TG+WGS YG        +A FW +L P G
Sbjct: 232 RWMAINLSHIRVRQAMAKQNRSLDELPFLSQTGVWGSWYGTIVLFSDLVASFWTSLFPLG 291

Query: 514 SKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQE 573
                 AE FFE +      +   L   LY R   F+  L  +DLD  RR  D ++ R+E
Sbjct: 292 GTSA-DAELFFEVFFTVSHLISMLLCPNLYMRKREFMVGLTDMDLDTGRRQMDLDVRREE 350

Query: 574 DEETKERIRNGGWTQKLLNFWC 595
               +E +    + +  L+ WC
Sbjct: 351 LRCEREELAKQCFFKIFLHVWC 372

>YEL063C (CAN1) [1365] chr5 complement(31694..33466) Permease for
           basic amino acids, arginine, lysine, and histidine,
           member of the amino acid-polyamine-choline (APC) family
           of membrane transporters [1773 bp, 590 aa]
          Length = 590

 Score =  259 bits (662), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 169/525 (32%), Positives = 259/525 (49%), Gaps = 18/525 (3%)

Query: 59  HNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIG 118
            +GI  ED    +Q+ + +K+ +K RH+ M++LG  IGTGL +  +  L  AGP   +I 
Sbjct: 68  EDGIGDED-EGEVQNAE-VKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIS 125

Query: 119 YFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLE 178
           Y  +  + Y V Q+ GEMA   P +   F  ++  F+S  FG A  +++   W     LE
Sbjct: 126 YLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALE 184

Query: 179 LITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVIL 238
           L      I++W  K+                    V+ YGE EF   S K+L I GF+I 
Sbjct: 185 LSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIY 244

Query: 239 SIVVNCGGAGVDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYGGVELF 293
              + CG AGV G +G +YWR+PGA+     + D    RF G    L+ A F++ G EL 
Sbjct: 245 CFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELV 303

Query: 294 ALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPY 353
            ++  E  NPR+S P A K+                G  VP+N  +L  +  S    SP+
Sbjct: 304 GITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPF 362

Query: 354 VLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGR 413
           ++A+   G KV+PHI NAVIL ++ S ANS +Y   R+L  L++   APK+ +   + G 
Sbjct: 363 IIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGV 422

Query: 414 PLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQG 473
           P  A+ + + FG +A+   S   + +F WL  I G++  F W  I +SH+RF  A+K +G
Sbjct: 423 PYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRG 482

Query: 474 KSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVW 533
            S +EL + +      + Y   F  ++ I Q + A +P    GV  A A+   +L   VW
Sbjct: 483 ISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPK-FNGVSFAAAYISIFLFLAVW 541

Query: 534 LFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETK 578
           + F   +        F+  +  +D+D+ RR  D E +  ED E K
Sbjct: 542 ILFQCIFRC-----RFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579

>YPL265W (DIP5) [5186] chr16 (41043..42869) Dicarboxylic amino acid
           permease, also transports alanine, glycine, serine,
           asparagine and glutamine [1827 bp, 608 aa]
          Length = 608

 Score =  257 bits (657), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 169/526 (32%), Positives = 272/526 (51%), Gaps = 23/526 (4%)

Query: 74  DDN--LKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQ 131
           D+N  L+K +K+RH+ M+++G  +GTGLL+     L   GP +++I Y  V  + ++ + 
Sbjct: 77  DENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFYTMA 136

Query: 132 AAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYW-- 189
             GEMA   P    GF +YAS +V    GFA  + +  ++  + P +L  A++ I+YW  
Sbjct: 137 CLGEMASYIPL--DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194

Query: 190 NDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGV 249
            D++N                  GV+ +GE EF  +S K++++ G ++L  ++  GG   
Sbjct: 195 RDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPN 254

Query: 250 DGYIGGKYWRDPGAFASDNAA---SRFKGVAFVLVTAY--FSYGGVELFALSVNEQENPR 304
              +G +YWRDPGAF   + A    + K V+FV V  Y  FSY G+EL  +  +E ENPR
Sbjct: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314

Query: 305 RSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHA--SPYVLAVSIHGV 362
           +S P A K +               G  V +N  +L+   G +  A  SP+V+A+   G+
Sbjct: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374

Query: 363 KVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCS 422
           +V+PHI NA +L+ V S  NS LY S R L +LA  G APK F    R G P  ALIL  
Sbjct: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434

Query: 423 IFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYI 482
           +F  +A+   S     IF +   +  +  + +W +IL+ ++ F  A +AQG   ++  Y+
Sbjct: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494

Query: 483 SITGIWGSLYGCFFNVLV-FIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYM 541
           +    +G+ +  FF +L+  I  F V L   G K  +  + F   Y+  PV++  + GY 
Sbjct: 495 APGQRYGAYFALFFCILIALIKNFTVFL---GHK--FDYKTFITGYIGLPVYIISWAGYK 549

Query: 542 LYSRDFTFLTDLKKIDLDNHRRLYDPELL--RQEDEETKERIRNGG 585
           L  +  T +     +DL   + +YD E    R +D+E +ER+++ G
Sbjct: 550 LIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNG 593

>Kwal_33.13401
          Length = 559

 Score =  254 bits (649), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 160/534 (29%), Positives = 258/534 (48%), Gaps = 16/534 (2%)

Query: 51  SFKRAEVNHNGIDLEDGT--NSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLY 108
           SF    ++      +D    +S    + +++ +K RHV M++LG  IGTGL +     L 
Sbjct: 25  SFAEEALDQEAQSSQDSQLGSSGHGRNAVQRQLKPRHVSMIALGGTIGTGLFIGIESPLR 84

Query: 109 LAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFC 168
            AGP   +I Y  +  I Y V Q+ GEMA   P +   F  +   F+S P G A  +++C
Sbjct: 85  NAGPVGALISYLFMGSIAYCVTQSLGEMATFIP-VTSSFTVFTRRFLSLPLGAANGYMYC 143

Query: 169 IQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCK 228
             W     LEL      I+YW   +                    V+ YGE +F     K
Sbjct: 144 FSWSVTYALELSIVGQIIEYWTSAVPNAAWIAIFWVPITLSNLVPVKFYGEFQFWIALIK 203

Query: 229 ILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTA 283
           ++ I GF++  + + CG AG  G +G +YWR+PG +     + D    RF G    LV A
Sbjct: 204 VVAIIGFLVYCLCMVCG-AGKTGPVGFRYWRNPGPWGDGIISHDIHEGRFLGWVSSLVNA 262

Query: 284 YFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGA 343
            F+Y G EL  +S  E  NPR++ P A  +                G  VP N ++L  +
Sbjct: 263 AFTYQGTELVGISAGESANPRKTVPKAINKVFFRILLFYVGSLFFIGLLVPFNDEKLTSS 322

Query: 344 GGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPK 403
             S +  SP+++A+   G K++P I NAVIL ++ S ANS +Y   R+L  LA++  AP+
Sbjct: 323 D-SYSAGSPFIIAIQNSGTKILPDIFNAVILATIISAANSNVYVGSRVLYGLAKERLAPR 381

Query: 404 YFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHV 463
           +F   +R G P  A++  + FG + + + S+     F WL  I  ++  F+W  I L HV
Sbjct: 382 FFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFDWLLNITAIAGFFSWLFISLCHV 441

Query: 464 RFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAF 523
           RF  A+K QG S ++L + +    WG+ Y  FF  L+ I Q + +L+P      ++   F
Sbjct: 442 RFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLIIIIQGFTSLAP-----TFNVSNF 496

Query: 524 FESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEET 577
           F +Y++  ++L  +  +  + R    +  ++ +D+D+ RR  D +     +  T
Sbjct: 497 FAAYISVFMFLVIWAVFQCWYRT-RIIHRIEHVDIDSDRREVDAQQWDNTEPTT 549

>AFR667C [3860] [Homologous to ScYNL268W (LYP1) - SH]
           (1657064..1658755) [1692 bp, 563 aa]
          Length = 563

 Score =  253 bits (645), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 166/561 (29%), Positives = 272/561 (48%), Gaps = 32/561 (5%)

Query: 34  PDTTAVKHRTHFNRFVDSFKRAEVNHNGIDLEDGTNSI------------QSDDNLKKAM 81
           P  TAV   +  +R++   K+ +   N I+L+  T +               +  +K+A+
Sbjct: 3   PKDTAVSETSTRSRYI---KKGKTLENDIELQSVTPATGEFPEDHTEEGDYQETEVKRAL 59

Query: 82  KSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYP 141
           K+RH+ M++LG  IGTGL +  A  L  AGP   ++ Y  +  + Y + Q+ GEMA   P
Sbjct: 60  KARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYSITQSLGEMATFIP 119

Query: 142 TLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXX 201
            +      ++  F+S  FG A  +++   W     +EL      I+YW D++        
Sbjct: 120 -VTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYWTDRVPIAAWIVI 178

Query: 202 XXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGA--GVDGY--IGGKY 257
                       VR YGE EF   S K+L I G++I + ++ CGG+  G  G    GG  
Sbjct: 179 FWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGSKQGPIGLPATGGIP 238

Query: 258 WRDPGAFASDNAASR---FKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQS 314
            R  GA AS     +   F G    L+ A F+Y G EL  ++  E  NPR++ P A  + 
Sbjct: 239 AR--GARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGESTNPRKNVPKAINKV 296

Query: 315 XXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVIL 374
                          G  VP++  +L     +  +ASP+V+++   G K++P I NAV+L
Sbjct: 297 FFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDVNASPFVISIKNAGTKILPDIFNAVVL 356

Query: 375 ISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSD 434
           I+V S ANS +Y   R+  SLA  G APK   +V ++G P   +++ S+ G+++F   + 
Sbjct: 357 ITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLITSLMGLMSFLVLNH 416

Query: 435 QEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGC 494
                F WL  I+ L+ L  W  I L+H+RF   +K +G S ++L + +    W + Y  
Sbjct: 417 NASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKAKFMPWAAYYAT 476

Query: 495 FFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLK 554
           FF  ++   Q + A +P      +    FF SY++  + L  ++G  +Y +   FL  ++
Sbjct: 477 FFVTVIIFIQGYTAFTPK-----FDVTTFFTSYISLFLMLLVFIGCQIYYK-CRFLWAVE 530

Query: 555 KIDLDNHRRLYDPELLRQEDE 575
            ID+D+ RR  D  ++ +EDE
Sbjct: 531 DIDIDSDRREID-AIVWEEDE 550

>CAGL0A01199g 121067..122908 similar to sp|P53388 Saccharomyces
           cerevisiae YPL265w DIP5 dicarboxylic amino acid
           permease, hypothetical start
          Length = 613

 Score =  252 bits (643), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 171/556 (30%), Positives = 272/556 (48%), Gaps = 33/556 (5%)

Query: 46  NRFVDSFKRAEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAK 105
           +R  DS K+ +   +G D             L+K +K+RH+ M+++G  IGTGLL+    
Sbjct: 64  SRLEDSEKQDDYMDDGKD---------EHTRLRKDLKARHISMIAIGGSIGTGLLIGTGN 114

Query: 106 GLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVW 165
            LY AGP S+ I Y  V  + +F + A GEMA   P    GF +YAS +     GFA  +
Sbjct: 115 SLYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL--DGFTSYASRYCDPALGFAVGY 172

Query: 166 LFCIQWLTVLPLELITASMTIKYWNDK--INADXXXXXXXXXXXXXXXXGVRAYGEAEFI 223
            +  ++L + P +L  A++ I+YW D+  +N                  GV+ +GE EF 
Sbjct: 173 AYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFW 232

Query: 224 FNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAF-----ASDNAASRFKGVAF 278
            ++ K++++ G +IL  V+  GG      +G +++  PGAF     + D +  +F     
Sbjct: 233 LSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVA 292

Query: 279 VLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSD 338
           VLV A F+Y G+EL  +   E  NPR+S P A K +               G  V ++  
Sbjct: 293 VLVYALFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDP 352

Query: 339 QLMGA--GGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLA 396
            L  A   G+   ASPYV+A+   G+K +PHI NA +L+ V S  NS LY + R L  LA
Sbjct: 353 LLKKAKTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLA 412

Query: 397 EQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWS 456
               APK F   +R G P  +L++ S F ++A+ + S     IF +   +  +  L +W 
Sbjct: 413 IDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWI 472

Query: 457 SILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLV-FIAQFWVALSPPGSK 515
           SIL++++ F  A+KAQ    +   Y +    +GS +   F +L+ FI  F V L+     
Sbjct: 473 SILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHH--- 529

Query: 516 GVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQE-- 573
             +  + F   Y+  PV++  Y GY    +  T +   +++DL   +   D E  + +  
Sbjct: 530 --FDYKNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQGKIA 585

Query: 574 DEETKERIRNG---GW 586
           D E +ER++N    GW
Sbjct: 586 DAERRERLKNSKTKGW 601

>KLLA0C02343g complement(203552..205297) similar to sp|P04817
           Saccharomyces cerevisiae YEL063c CAN1 amino acid
           permease, start by similarity
          Length = 581

 Score =  248 bits (634), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 151/471 (32%), Positives = 243/471 (51%), Gaps = 9/471 (1%)

Query: 76  NLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGE 135
            +K+A+K RHV M++LG  IGTGL ++ +  L+ AGP   +I + ++  + Y V Q+ GE
Sbjct: 72  EVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGE 131

Query: 136 MAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINA 195
           MA T+  +   F  ++  F+S   G A  +++   W     LEL      I+YW D +  
Sbjct: 132 MA-TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPL 190

Query: 196 DXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGG 255
           +                 V+ YGE EF   S K++ I GF+I S+ + CG AG +G IG 
Sbjct: 191 EAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEGPIGF 249

Query: 256 KYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAA 310
           +YWR PG +     A +   +RF G    L++A F+Y G EL  ++  E +NPR++ P A
Sbjct: 250 RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRA 309

Query: 311 AKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGA-GGSATHASPYVLAVSIHGVKVVPHII 369
             +                G  VP+N  +L G+  GS    SP+++A+      V+PHI 
Sbjct: 310 INKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIF 369

Query: 370 NAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAF 429
           NAVIL ++ S  NS +Y   R+L  L++   APK+F+   + G P  A+++ ++FG +A+
Sbjct: 370 NAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAY 429

Query: 430 CACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWG 489
              S+  + +F WL  I  ++   TW  I +SH+RF   +K +G S ++L Y +    + 
Sbjct: 430 LNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPYA 489

Query: 490 SLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGY 540
           + Y  FF  ++ I Q + A +P  +   + A A+   +L F VW  F   Y
Sbjct: 490 AYYAAFFITVIIIIQGFTAFAPHFNVSDFFA-AYISVFLFFIVWAIFQTIY 539

>AFR668W [3861] [Homologous to ScYEL063C (CAN1) - SH; ScYNL270C
           (ALP1) - SH] complement(1659469..1661139) [1671 bp, 556
           aa]
          Length = 556

 Score =  246 bits (628), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 156/494 (31%), Positives = 247/494 (50%), Gaps = 20/494 (4%)

Query: 54  RAEV-NHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGP 112
           +AEV NHN  ++E         D +K+ +K RHV M+SLG  IGTGL +  A  +  AGP
Sbjct: 26  KAEVLNHNTSEVESLCEKPNQSD-VKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGP 84

Query: 113 ASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWL 172
              ++ Y  V+ + Y V Q+ GEMA   P +   F  +AS FVS   G A  +L+ + W 
Sbjct: 85  VGSLLAYIFVATMAYCVTQSLGEMATFIP-VTSSFTVFASRFVSPALGAANGYLYWLSWC 143

Query: 173 TVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMI 232
               LE+      I YW+D +                    V+ YGE EF   S K++ I
Sbjct: 144 ITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAI 203

Query: 233 GGFVILSIVVNCGGAGVDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSY 287
             F+   +VV CGG+ + G IG +YW+DPG +     + +   ++F G    L+ A F++
Sbjct: 204 LCFLFYGLVVVCGGSKL-GRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTF 262

Query: 288 GGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSA 347
            G EL  ++  E +NPRR+ P A                   G  V ++  QL+  G + 
Sbjct: 263 QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTT 322

Query: 348 -THASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFN 406
             +ASP+V+A++  G KV+P I+N VI++++ S  NS +Y   R+L  L   G AP + +
Sbjct: 323 NANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFIS 382

Query: 407 YVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFR 466
                G P  A++  S+FG + +   S +   +F WL +I  +S  FTW  I +SH+RF 
Sbjct: 383 RTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFM 442

Query: 467 LAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFES 526
             +K +G S ++L + +    +G+ Y  FF +++ + Q + A +P      +SA  F   
Sbjct: 443 QCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP------FSAVDFVAY 496

Query: 527 YLA----FPVWLFF 536
           Y++      +WL F
Sbjct: 497 YISAFIFVVIWLLF 510

>YNL270C (ALP1) [4339] chr14 complement(135939..137660) Arginine
           permease, has strong similarity to basic amino acid
           permeases Can1p and Lyp1p, member of the amino acid
           permease family of membrane transporters [1722 bp, 573
           aa]
          Length = 573

 Score =  241 bits (614), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 163/516 (31%), Positives = 257/516 (49%), Gaps = 14/516 (2%)

Query: 65  EDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSF 124
           ++  +S Q    +K+ +K RH+ M++LG  IGTGL++     L  AGP   +I Y  +  
Sbjct: 54  KETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGT 113

Query: 125 ITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASM 184
           + Y V Q+ GEM VT+  +   F+ +A  F+S   G    +++ + W     LEL     
Sbjct: 114 VIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGK 172

Query: 185 TIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNC 244
            I+YW + +                    V+ YGE EF   S K++ + GF+I S  V C
Sbjct: 173 VIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVC 232

Query: 245 GGAGVDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNE 299
           G    DG IG +YWR+PGA+     +SD    RF G    L+ A F+Y G EL  ++  E
Sbjct: 233 GAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGE 292

Query: 300 QENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAVSI 359
             NPR++ P A K+                G  VP+N D  + + G    +SP+++++  
Sbjct: 293 AANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN-DPKLDSDGIFVSSSPFMISIEN 351

Query: 360 HGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALI 419
            G KV+P I NAV+LI++ S  NS +Y   R+L SL++   AP++ + V R G P  +++
Sbjct: 352 SGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVL 411

Query: 420 LCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNEL 479
             S+FG +AF   S      F WL  I G++  F W  I  SH+RF  A++ +G S ++L
Sbjct: 412 STSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDL 471

Query: 480 GYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLG 539
            Y +    + + Y  FF  L+ + Q + A +P      + A A+   +L   +WL F + 
Sbjct: 472 PYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVA-AYISIFLFLAIWLSFQVW 530

Query: 540 YMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDE 575
           +         L  L+ ID+D+ RR  + EL+  E E
Sbjct: 531 FKC-----RLLWKLQDIDIDSDRRQIE-ELVWIEPE 560

>Scas_486.2
          Length = 597

 Score =  236 bits (603), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 176/582 (30%), Positives = 282/582 (48%), Gaps = 40/582 (6%)

Query: 35  DTTAVKHRTHFN--RFVDS----FKRAEVNH----NGIDL----EDGTNSIQSD-----D 75
           +TT+ ++  +F+  + VDS     +  E+ H    N I L    ED  +S   D      
Sbjct: 10  ETTSDRYEEYFDPQKKVDSKTFPTQERELLHDDLENNISLSTSAEDQNDSYNVDGKTEGT 69

Query: 76  NLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGE 135
            LKK ++ R V M+++G  +GTGLL+     L  AGP S++I Y  V  + +F + + GE
Sbjct: 70  RLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLVFFTMASLGE 129

Query: 136 MAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYW--NDKI 193
           MA   P    GF +YA+ +     GFA  + +  ++  + P +L  A++ I+YW   +K+
Sbjct: 130 MASYIPL--DGFTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQYWIPREKV 187

Query: 194 NADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYI 253
           N                  GV+ +GE EF  +S K+L++   +IL  ++  GG      +
Sbjct: 188 NPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILLFILMLGGGPNHDRL 247

Query: 254 GGKYWRDPGAFASDNAA-----SRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTP 308
           G ++W+ PGAF + + A      +F     V V A F+Y G EL  + V E  NPR+S P
Sbjct: 248 GFRHWKHPGAFNNYSPAITGDTGKFVAFVSVFVYATFAYLGTELVGIVVGEARNPRKSVP 307

Query: 309 AAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHA--SPYVLAVSIHGVKVVP 366
            A K +               G  V ++   L+ A   +T A  SP+V+A+   G+KV+P
Sbjct: 308 KAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAIVNSGIKVLP 367

Query: 367 HIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGV 426
           HI NA +L+ V S  NS LY + R L SLA    APK F   +R G P  +L L  +F +
Sbjct: 368 HIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYSLGLSVLFCL 427

Query: 427 IAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITG 486
           +A+ + S     IF +   +  +  L +W  IL++++ F  A++AQG   +   Y++   
Sbjct: 428 LAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKSTFSYVAPGQ 487

Query: 487 IWGSLYGCFF-NVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSR 545
            +G+ +  FF +++  I  F V L        +  + F   Y+  PV+   Y GY L  +
Sbjct: 488 RYGAYFALFFCSLIALIKNFTVFLGHQ-----FDYKTFITGYIGIPVFFISYFGYKLIYK 542

Query: 546 DFTFLTDLKKIDLDNHRRLYDPELL--RQEDEETKERIRNGG 585
             T + D  ++DL   +   D E    + ED   KERI+  G
Sbjct: 543 --TKIIDPLEVDLYTFKAAIDQEEEDGKLEDIARKERIKANG 582

>Kwal_26.9612
          Length = 543

 Score =  231 bits (590), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 159/559 (28%), Positives = 274/559 (49%), Gaps = 22/559 (3%)

Query: 36  TTAVKHRTHFNRFVDSFKRAEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGI 95
           T +++ R   ++     K AEV    ++  D  N       +K+A+K+RH+ +++LG  I
Sbjct: 4   TNSIQQREDLDKLEP--KIAEVELQRLE-TDSLNEFDPHSGVKRALKNRHISLLALGGII 60

Query: 96  GTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFV 155
           G G L+     L   GP +L++G+ ++  + + ++++ GE+   YP+  GGF   A  F 
Sbjct: 61  GPGCLIGAGNALNKGGPLALLLGFGIIGLVCFSIMESIGELVTLYPS-GGGFITLARRFH 119

Query: 156 SKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVR 215
           S+     + + + + +  VL  E  T S  +++W  ++                   GV 
Sbjct: 120 SEGLSAVSGYAYIVVFFAVLANEYNTISSILQFWGPQVPIYGYTLIFWFFFLVFQLIGVG 179

Query: 216 AYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKG 275
           A+GE E+     KIL +  F I SIV   GG      IG +YW++PGA +       F+G
Sbjct: 180 AFGECEYWLAWFKILGLVAFYIFSIVYMSGGIPGKPPIGFQYWKNPGALSHG-----FRG 234

Query: 276 VAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPH 335
           +A V V     Y G E  AL+  E  NPR++ P A +Q+               G  VP+
Sbjct: 235 IAVVFVFCSTFYSGTESVALAATESRNPRKAVPLAVRQTFWRILIVYLGISFFYGVTVPY 294

Query: 336 NSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSL 395
           N D  +GA  + +  SP  +A+S  G     H++NA IL++  S  NS+LY   R L  L
Sbjct: 295 N-DPTLGAQ-TKSLKSPISIALSRAGWAGGVHLVNAFILMTCISAINSSLYIGSRTLSHL 352

Query: 396 AEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTW 455
           A +G AP+   + D+ G P+ ALI+ +  G+I+    S      + ++  ++G+     W
Sbjct: 353 AHEGLAPRILAWTDKRGVPVPALIVFNALGLISLMNVSVGASNAYNYIVNLSGVGVFIVW 412

Query: 456 SSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSK 515
           S+I ++H+RFR A  AQG+SL+EL Y ++   W +++    N+ + + Q W +L P    
Sbjct: 413 SAISITHLRFRKAWVAQGRSLSELPYRALFYPWTTIFSLAANIFLALIQGWTSLVP---- 468

Query: 516 GVYSAEAFFESYLAFPVWLFFYLGYMLY-SRDFTFLTDLKKIDLDNHRRLYDPELLRQED 574
             + A+ F ++Y+  P     Y+G   + +R+F    ++  I+L+  +R    +L    D
Sbjct: 469 --FVAKDFVDAYILLPAAGLLYVGINFWKNRNFK-TVNIHGINLEEGQR---RDLDEDSD 522

Query: 575 EETKERIRNGGWTQKLLNF 593
           +ET    ++     KL +F
Sbjct: 523 DETGTAPKSTRMKAKLSSF 541

>Scas_84.1
          Length = 213

 Score =  221 bits (562), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 107/206 (51%), Positives = 139/206 (67%)

Query: 231 MIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGV 290
           M+ GF IL IVV CGGAG DGYIG K W +PG+F  D    RFKGVA  L  A F++G  
Sbjct: 1   MLTGFFILGIVVICGGAGNDGYIGTKLWHNPGSFRGDKPVDRFKGVASTLANAAFAFGMT 60

Query: 291 ELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHA 350
           E   ++ +EQ NPR++ P+AAK                 G+ VP++SDQL+G  G+AT A
Sbjct: 61  EFLGVTASEQSNPRKAIPSAAKNMLYRIICIYLGSVTIVGYLVPYDSDQLLGTSGAATKA 120

Query: 351 SPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDR 410
           SPYVLA+S+HGV+VVPH I+AVIL+SV SV NSA Y++ R L  L++ GYAP + NYVDR
Sbjct: 121 SPYVLAISVHGVRVVPHFIHAVILMSVVSVGNSAFYSTSRQLLPLSQLGYAPSFLNYVDR 180

Query: 411 EGRPLRALILCSIFGVIAFCACSDQE 436
            GRP++A  +  + GVIA+CA S +E
Sbjct: 181 NGRPMKAYCVSPLAGVIAYCATSPEE 206

>Kwal_33.15545
          Length = 576

 Score =  231 bits (590), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 165/540 (30%), Positives = 259/540 (47%), Gaps = 35/540 (6%)

Query: 53  KRAEVNHNGIDLEDGTNSIQSDDN----------------LKKAMKSRHVIMMSLGTGIG 96
           K A V ++   LE+G  +++S+                  LKK +++RHV M+++G  +G
Sbjct: 10  KNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMIAIGGSLG 69

Query: 97  TGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVS 156
           TGLL+     L  AGP S++I Y  V  + Y V+   GEMA   P    GF +YAS +V 
Sbjct: 70  TGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMAAFIPL--DGFTSYASRYVD 127

Query: 157 KPFGFATVWLFCIQWLTVLPLELITASMTIKYW--NDKINADXXXXXXXXXXXXXXXXGV 214
              GFA  + +  ++  V P +L   +M +++W   D++N                  GV
Sbjct: 128 PAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGV 187

Query: 215 RAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAF-----ASDNA 269
           R +GE EF  +S K+L++ G ++L  ++  GG       G ++WRDPGAF     A   +
Sbjct: 188 RFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKPYSEAISGS 247

Query: 270 ASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXX 329
             +F   A V   A F+Y G EL  +   E +NPRRS P A K +               
Sbjct: 248 KGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLL 307

Query: 330 GFNVPHNSDQLMGAGGSATHA--SPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYA 387
           G  V +N  +L+ A   AT A  SP+V+A+    + V+PHI N  +L+ V S  NS LY 
Sbjct: 308 GMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYV 367

Query: 388 SPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIA 447
           + R L  LA  G AP+ F   ++ G P  +L L  +F ++A+   S     +F +   + 
Sbjct: 368 ASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVV 427

Query: 448 GLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLV-FIAQFW 506
            +  L +W +IL++++RF  A++ Q    + L Y +    W +    FF  L+  I  + 
Sbjct: 428 SIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYT 487

Query: 507 VALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYD 566
           V L   G K  +  + F   Y+  PV+L  Y+GY +  R  T L   + +DL   +   D
Sbjct: 488 VFL---GHK--FDYKTFISGYIGIPVYLICYVGYKVVYR--TKLIKPEDVDLYTFKDAID 540

>Scas_377.2
          Length = 490

 Score =  218 bits (554), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 144/496 (29%), Positives = 240/496 (48%), Gaps = 20/496 (4%)

Query: 96  GTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFV 155
           G GL +  +  L  AGP   +I Y  ++ + Y V Q+ GEMA T+  +   F  ++  FV
Sbjct: 4   GXGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFV 62

Query: 156 SKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVR 215
           S  FG A  +++   W     LEL      I++W   +                    V+
Sbjct: 63  SPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVK 122

Query: 216 AYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAF-----ASDNAA 270
            YGE EF     K++ I GF+I    + CG AGV G +G +YWR PGAF     A D   
Sbjct: 123 YYGEFEFWVALVKVVAIMGFLIYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQ 181

Query: 271 SRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXG 330
           +RF G    L+ A F++ G EL  ++  E  NPR++ P A K+                G
Sbjct: 182 ARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIG 241

Query: 331 FNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPR 390
             VP++ D  + +  S   ASP+++A+   G  V+PHI NAVI+ ++ S  NS +Y   R
Sbjct: 242 LLVPYD-DWKLTSTDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSR 300

Query: 391 LLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLS 450
           ++  L+    AP   +   + G P  A+++ S+FG +A+   S   +  F WL  I G++
Sbjct: 301 IMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVA 360

Query: 451 ELFTWSSILLSHVRFRLAMKAQGKSLNELGYIS--ITGIWGSLYGCFFNVLVFIAQFWVA 508
             FTW  I LSH+RF  A++ +G S ++L + +  + G+  + YG FF  L+ I Q + +
Sbjct: 361 GFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGL--AYYGVFFMTLIIIIQGFTS 418

Query: 509 LSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPE 568
             P      ++   F  +Y++  +++  ++ +  + R    +  ++ +D+D  RR  +  
Sbjct: 419 FCP------WNGIDFLTAYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEA 471

Query: 569 L-LRQEDEETKERIRN 583
           + + QE     ++  N
Sbjct: 472 VWIEQEPRGFWDKFWN 487

>KLLA0B14685g complement(1289025..1290740) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease P23. 1.f18.1, start by
           similarity
          Length = 571

 Score =  219 bits (559), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 160/540 (29%), Positives = 260/540 (48%), Gaps = 49/540 (9%)

Query: 63  DLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMV 122
           D+E+     +    + + +K+RH+ +++LG+ IGTGL + +   L + GPA L+I Y ++
Sbjct: 45  DIEN----FKPPQKIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAYIII 100

Query: 123 SFITYFVIQAAGEMAVTYPTLPGGFNNY--ASIFVSKPFGFATVWLFCIQWLTVLPLELI 180
           SF  + ++    EM    P LPG  + Y  A  +++ P  F   W        ++P E+ 
Sbjct: 101 SFFVWSIMNQMTEMVCLIP-LPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPAEIT 159

Query: 181 TASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSI 240
             ++ ++YW D  N+                  V+ +GE+EF  +S KIL I G +I+ I
Sbjct: 160 ACALLVQYWTDA-NSAIFISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLIIVGI 218

Query: 241 VVNCGGA-GVDGYIGGKYWRDPGAF---ASDNAASRFKGVAFVLVTAYFSYGGVELFALS 296
           V+  GG    D  +G  YW++PGAF    ++    RF  V   ++ + FS+  V     S
Sbjct: 219 VIFFGGGPAQDHVLGFHYWKNPGAFNPHLAEGNTGRFLAVWTAIIKSGFSFVLVPETVTS 278

Query: 297 VN-EQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGA---GGSATHASP 352
            + E   PRR+ P A ++                G  V  N+D+L+ A   G S   ASP
Sbjct: 279 CSAECIAPRRNMPKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSDAAASP 338

Query: 353 YVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREG 412
           +V+ +   G+K++PHIINA IL S  S     LY S R L S+A +G APK F  V+R G
Sbjct: 339 FVIGIQEAGIKILPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKVNRFG 398

Query: 413 RPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQ 472
            P  +  L S+F  +A+  CS    V+F WL+ IA +S   +W  + ++++RFR  + A 
Sbjct: 399 TPYYSTGLASLFSFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKVINAL 458

Query: 473 GKSLNE-----------LGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAE 521
              LN+           L Y++           FF +L     + V +     KG ++  
Sbjct: 459 --DLNDRVPFRRPFQVPLAYLTCG---------FFFILSLTNGYAVFV-----KGNWNVS 502

Query: 522 AFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERI 581
            FF SY+     +F YL    Y + +TF  D K+I+++       P++   ++EE  + I
Sbjct: 503 DFFASYVTIGFVIFLYLVGSFYYKQWTF-RDFKEIEVE-----ILPKIDIADEEERNDVI 556

>KLLA0F23419g complement(2187386..2189107) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease, start by similarity
          Length = 573

 Score =  218 bits (555), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 161/544 (29%), Positives = 248/544 (45%), Gaps = 66/544 (12%)

Query: 69  NSIQS-DDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITY 127
           N  QS D NLKK +KS H+ ++++G  IGTGL V  +  LY  GPA L I Y ++S I Y
Sbjct: 43  NKPQSGDHNLKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIY 102

Query: 128 FVIQAAGEMAVTYPTLP------GGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELIT 181
            V+ A  EM    P LP      G  +   + +V    GFA  W +   ++ ++  E   
Sbjct: 103 PVMNALAEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTA 162

Query: 182 ASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIV 241
           AS  + YW   +                    V  YG +E IF S KI  I G +I+SIV
Sbjct: 163 ASGVVTYWTTAVPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIV 222

Query: 242 VNCGGAGVDGYIGGKYWRDPGAFA---SDNAASRFKGVAFVLVTAYFSY-GGVELFALSV 297
           +  GG      +G ++W+DPGA+A   +D  A R   +   ++ A F++  G EL  L+ 
Sbjct: 223 LFFGGGPNHDRLGFRFWKDPGAWAYHLADGGAGRLSDIITGVIRAGFAFILGPELVVLTS 282

Query: 298 NEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGA---GGSATHASPYV 354
            E ++ RR+   AA++                G  V  N   L+ A   G     +SP+V
Sbjct: 283 TEAQDSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFV 342

Query: 355 LAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRP 414
           + +   G+KV+PHIIN  IL S  S  NS +YA+ R L SL+++GYAPK FN V+R G P
Sbjct: 343 IGIQNAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVP 402

Query: 415 LRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGK 474
              +   + F  +A+   S     +F W + I+ +S    W    ++++RFR A+     
Sbjct: 403 YTGVAFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAV----- 457

Query: 475 SLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSP----------------PGSKGV- 517
                               FFN L     F     P                 G +   
Sbjct: 458 --------------------FFNNLYDRLPFKTPFQPYFTWFYIILIAIICLINGYESFV 497

Query: 518 -YSAEAFFESYLAFPVWLFFYLGYMLYSRDFT-FLTDLKKIDLDNHRRLYDPELLRQEDE 575
            ++ + F  +Y+  P++L  +LG+  Y+R ++ ++  + +ID+           LR+ +E
Sbjct: 498 HWNYKDFIAAYITLPLFLILWLGHKAYTRTWSQWMISVSEIDVTTG--------LREIEE 549

Query: 576 ETKE 579
           ETKE
Sbjct: 550 ETKE 553

>Scas_552.3
          Length = 558

 Score =  215 bits (547), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 159/534 (29%), Positives = 247/534 (46%), Gaps = 27/534 (5%)

Query: 65  EDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSF 124
           ED        ++L++A+K RH+ M+S+   IGTGL ++ AK LY  GPASL + Y ++  
Sbjct: 42  EDYDPEANIREDLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPASLFMNYTIMGG 101

Query: 125 ITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASM 184
           + Y  +   GEM+ TY  + G F +YA  F S+ F  A +W +       +  ++    +
Sbjct: 102 VVYLTLLCLGEMS-TYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDMTALQL 160

Query: 185 TIKYWNDKINAD---XXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIV 241
            + YW+ + +                      VR YGEAE+     K++ I  F ILSIV
Sbjct: 161 VMDYWDTEASGFPYWAASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKVIAIIIFFILSIV 220

Query: 242 VNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQE 301
           VN G      YIG K W    A   D     FKG A + V+A F+YGG E   L+  E  
Sbjct: 221 VNVGHNPQHEYIGFKNWNHGEAPFVDG----FKGFASLFVSASFAYGGTESITLTNGEAA 276

Query: 302 NPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAVSIHG 361
           NP R+TP   K                   N+P++     G    +   SP+ L   + G
Sbjct: 277 NPLRNTPKIVKTVFWRILVFYVGSTFFIAMNIPYDYP---GLDTKSVVTSPFTLVFQMAG 333

Query: 362 VKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGR---PLRAL 418
            K     +NAVI+ SV S  N AL+A  R++ ++  +G+ PK    V R  R   P  ++
Sbjct: 334 TKAAGSFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPK--KIVSRTNRYKVPYVSV 391

Query: 419 ILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNE 478
           ++ S  G++ F A       ++TWL  I G+S    W  I ++ +RFR  ++ QGK+ +E
Sbjct: 392 LITSSIGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQGKT-HE 450

Query: 479 LGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYL 538
           L Y + T  +G  +   F   + + Q W A  P      +    FF  YL   V+ F ++
Sbjct: 451 LRYKNWTYPYGPYFLVIFVTFIILVQGWSAFDP------WDVTNFFSYYLDLFVFPFCFI 504

Query: 539 GYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLN 592
            + LY RD      L+ +D    R +   E++  E  E  + ++    T++ LN
Sbjct: 505 IWWLYKRD--RFVKLEDMDFVTDRYIPTKEII--ELNENLDHLKGWKRTRQWLN 554

>KLLA0F27093g 2501049..2502740 similar to sp|P43548 Saccharomyces
           cerevisiae YFL055w AGP3 amino acid permease, start by
           similarity
          Length = 563

 Score =  214 bits (546), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 146/517 (28%), Positives = 238/517 (46%), Gaps = 18/517 (3%)

Query: 49  VDSFKRAEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLY 108
           VD           ++ ED   +   D  +K+ +K RH+ +++LG  IG G L+     L 
Sbjct: 31  VDPKNNEYAEEQSLNRED---TFDPDSGVKRQLKDRHISLLALGGIIGPGCLIGAGNALA 87

Query: 109 LAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFC 168
           + GP +L++G+ ++  + + ++++ GEM   YP+  GGF      F S        + + 
Sbjct: 88  IGGPLALLLGFGIIGILAFIMMESIGEMITLYPS-GGGFTTLTRRFHSDALSAVCGYAYA 146

Query: 169 IQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCK 228
           + +  VL  E  T S  +++W  ++                   GV A+GE E+     K
Sbjct: 147 VVFFAVLANEYNTLSSIMQFWGPQVPLYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFK 206

Query: 229 ILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYG 288
           IL +  + I SIV   GG       G +YW DPGA ++      FKG+A V V     Y 
Sbjct: 207 ILGLLTYYIFSIVYISGGVKNRPAFGFQYWNDPGALSNG-----FKGIANVFVFCSTFYS 261

Query: 289 GVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSAT 348
           G E  AL+  E +NPRR+ P A +Q+               G  VP+N + L  A  +  
Sbjct: 262 GTESVALAATESKNPRRAVPIAIRQTFWRILIVYLGISIFYGVTVPYNDENLNFA--TKV 319

Query: 349 HASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYV 408
             SP  +A+S  G     H++NA ILI+  S  N +LY   R L  LA +G APK   + 
Sbjct: 320 LKSPIAIAISRAGWPAGVHLVNAFILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWT 379

Query: 409 DREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLA 468
           DR G P+ A+ + +  G+I+    S      + ++  ++G+     W  I L+H+RFR A
Sbjct: 380 DRRGVPIPAITVFNALGLISLMNVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKA 439

Query: 469 MKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYL 528
            K QG + +EL Y +       +     N+ + + Q W    P      + A+ F ++Y+
Sbjct: 440 WKLQGHTRDELPYKAKLFPVFPIVSIIANIFLGLVQGWSYFKP------FDAKNFVDAYI 493

Query: 529 AFPVWLFFYLGYMLY-SRDFTFLTDLKKIDLDNHRRL 564
             P  +  YLG   + ++ F    DL +++L   +RL
Sbjct: 494 LIPAGIILYLGVSYWKTKGFLTAVDLSEVNLLFGQRL 530

>ACL135W [914] [Homologous to ScYPL265W (DIP5) - NSH]
           complement(115359..117125) [1767 bp, 588 aa]
          Length = 588

 Score =  214 bits (546), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 164/556 (29%), Positives = 261/556 (46%), Gaps = 37/556 (6%)

Query: 58  NHNGIDLEDGTNSIQSDDN-----LKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGP 112
            H+  D E  +     D       LKK +++RHV M+++G  +GTGLL+     L  AGP
Sbjct: 35  THSSTDQEAQSVDWNYDGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGP 94

Query: 113 ASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWL 172
            S++I Y ++ ++ + V+   GEMA   P    GF +YA+ +     GFA  W +  ++L
Sbjct: 95  GSILIAYSIMGWVVFTVMSCLGEMAAYIPL--DGFTSYATRYADPALGFAVGWAYLFKYL 152

Query: 173 TVLPLELITASMTIKYW--NDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKIL 230
            + P +L   ++ I++W    +++                  GVR +GE EF  +S K+L
Sbjct: 153 VLTPNQLTAGALVIQFWIPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVL 212

Query: 231 MIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFAS-DNAASRFKG-----VAF--VLVT 282
           ++   +IL +V+  GG      +G +YW DPGAF       +  KG     VAF  V V 
Sbjct: 213 VMLCVMILLLVLALGGGPTHDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVY 272

Query: 283 AYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLM- 341
           A F+Y G EL  +   E ++PRR+ P A K +               G  V +N   LM 
Sbjct: 273 ALFAYLGTELCGIVAAECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQ 332

Query: 342 -GAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGY 400
             +   +  ASPYV+A+    + V+P++ NA +L  V S  NS LY   R L  LA  G 
Sbjct: 333 ASSAEVSAAASPYVVAIENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGK 392

Query: 401 APKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILL 460
           APK F   ++ G P  AL  C++F  +A+ + S      F +   +  +  L +W SIL+
Sbjct: 393 APKLFARTNKWGVPYNALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILI 452

Query: 461 SHVRFRLAMKAQGKSLNELGYISIT---GIWGSLYGCFFNVLV--FIAQFWVALSPPGSK 515
           +++ F  A +AQG   + L Y++       W +L  C F  L+  F A     +  P   
Sbjct: 453 TYICFDRAFRAQGIPKSTLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVP--- 509

Query: 516 GVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYD--PELLRQE 573
                  F   Y+  P+++F ++GY +  +  T     K++DL   +   D   E   +E
Sbjct: 510 ------TFITGYIGLPIYIFCFIGYKIVHK--TKWIPSKEVDLFTFKEAIDLEEEECIRE 561

Query: 574 DEETKERIRNGGWTQK 589
               KE++  GG + K
Sbjct: 562 RALMKEQLAKGGLSWK 577

>CAGL0E05632g complement(556619..558415) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease, hypothetical start
          Length = 598

 Score =  213 bits (543), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 156/552 (28%), Positives = 249/552 (45%), Gaps = 57/552 (10%)

Query: 72  QSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQ 131
            +   LK+ +KSRHV +++LG  IGTGL V  +  L+  GPA L I Y ++S + Y ++Q
Sbjct: 70  MTGHELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQ 129

Query: 132 AAGEMAVTYP---TLPGGFNNY-ASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIK 187
             GEM    P   + P GF  Y    +V +  GFA  W +   ++ ++  E   AS  ++
Sbjct: 130 GIGEMVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVE 189

Query: 188 YWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGA 247
           YW   +                    V+ YGE+EF F S KIL I G +ILS ++  GG 
Sbjct: 190 YWTTSVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGG 249

Query: 248 GVDGYIGGKYWRDPGAFASDNAASRFK------------GVAFVLVTAYFSYGGVELFAL 295
                +G +YW++PG FA       F             G AF+L        G E+ A+
Sbjct: 250 PNHDRLGFRYWQNPGGFAHHIRGGSFGSFLDIYTGIIKGGFAFIL--------GPEMIAM 301

Query: 296 SVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQL---MGAGGSATHASP 352
           + +E E+ RR+   AA++                   V +N   L   +        +SP
Sbjct: 302 TSSEVEDQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSP 361

Query: 353 YVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREG 412
           +V+ +   G+KV+PHIINA IL S  S  N+ ++ S R L ++A+ G AP+ F  V+R G
Sbjct: 362 FVIGIQNAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWG 421

Query: 413 RPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQ 472
            P  A+ L S    +A+  CS     +F W + I+ +S    W  + ++++RF  A+   
Sbjct: 422 VPYYAVGLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFH 481

Query: 473 GKSLNELGYISITGIWGSLYGCFFNVL------------VFIAQFWVALSPPGSKGVYSA 520
           G   + L Y +     G  Y  ++ +L            VFI +FW             A
Sbjct: 482 GMQ-SRLPYTAR----GMPYLIYWPLLVISIITLTNGYEVFIPRFW------------DA 524

Query: 521 EAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKER 580
           + F  +Y+  PV+   ++G+ +Y R    L   K I+  +     + E+  +  E    R
Sbjct: 525 KNFVAAYITLPVFWVLWIGHRVYRRKIFTLKWWKSIEEIDVVTGVE-EIEEKTRECDASR 583

Query: 581 IRNGGWTQKLLN 592
           +    W +K L+
Sbjct: 584 VLPTKWWEKALD 595

>YFL055W (AGP3) [1629] chr6 (17004..18680) Amino acid permease for
           serine, aspartate and glutamate, member of the amino
           acid permease family of membrane transporters [1677 bp,
           558 aa]
          Length = 558

 Score =  211 bits (538), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 147/530 (27%), Positives = 240/530 (45%), Gaps = 22/530 (4%)

Query: 58  NHNGIDLEDGTNSIQSDDN--LKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASL 115
           N   +D+++  +  + D    +K+A+K+RH+ +++LG  IG G LV     L   GP +L
Sbjct: 28  NVEAVDIDEDPDVSRYDPQTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLAL 87

Query: 116 VIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVL 175
           ++G+ ++  I + V+++ GEM   YP+  GGF   A  F S        + + + +  VL
Sbjct: 88  LLGFSIIGIIAFSVMESIGEMITLYPS-GGGFTTLARRFHSDALPAVCGYAYVVVFFAVL 146

Query: 176 PLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGF 235
             E  T S  +++W  ++                   GV  +GE E+     KI+ +  +
Sbjct: 147 ANEYNTLSSILQFWGPQVPLYGYILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVAY 206

Query: 236 VILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFAL 295
            I SIV   G        G  YW  PGA +       FKG+A V V     Y G E  AL
Sbjct: 207 YIFSIVYISGDIRNRPAFGFHYWNSPGALSHG-----FKGIAIVFVFCSTFYSGTESVAL 261

Query: 296 SVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVL 355
           +  E +NP ++ P A +Q+               G  VP +   L  +  +    SP  +
Sbjct: 262 AATESKNPGKAVPLAVRQTLWRILVVYIGIAVFYGATVPFDDPNL--SASTKVLKSPIAI 319

Query: 356 AVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPL 415
           A+S  G     H++NA ILI+  S  N +LY   R L  LA +G APK   + DR G P+
Sbjct: 320 AISRAGWAGGAHLVNAFILITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGVPI 379

Query: 416 RALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKS 475
            A+ + +  G+I+    S      ++++  ++G+     W  I  +H+R R A  AQG+S
Sbjct: 380 PAITVFNALGLISLMNVSVGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQGRS 439

Query: 476 LNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLF 535
           + EL Y ++   W  +     N+ + + Q W    P      + A  F ++Y+  PV + 
Sbjct: 440 IEELPYEALFYPWTPVLSLAANIFLALIQGWSYFVP------FDAGNFVDAYILLPVGIL 493

Query: 536 FYLGYMLYSRDFTFLTDLKKIDLDNHRR------LYDPELLRQEDEETKE 579
            Y+G  ++  +     DL+ I+LD  RR      L D E      E  K+
Sbjct: 494 LYIGICVFKSNHFRTVDLRSINLDEGRRKDMEADLSDQESSLASSETMKD 543

>YOR348C (PUT4) [5125] chr15 complement(986894..988777) High
           affinity proline permease, also transports alanine and
           glycine [1884 bp, 627 aa]
          Length = 627

 Score =  212 bits (539), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 166/615 (26%), Positives = 280/615 (45%), Gaps = 65/615 (10%)

Query: 20  TLKTPNVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAEVNHN---------------GIDL 64
           T K  +V +  E     +   HR+  N   D+ +  +++ N                +DL
Sbjct: 33  TKKEEDVVQVTESPSSGSRNNHRSD-NEKDDAIRMEKISKNQSASSNGTIREDLIMDVDL 91

Query: 65  EDGTNSIQSDD---NLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFM 121
           E  + S+  D     LK+ ++SRHV +++LG  IGTGLLV  +  L+  GPA L I Y +
Sbjct: 92  EK-SPSVDGDSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYII 150

Query: 122 VSFITYFVIQAAGEMAVTYP----TLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPL 177
           +S + Y ++ A GEM    P       G   N  + +V    GFAT W +   ++ ++  
Sbjct: 151 ISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAA 210

Query: 178 ELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVI 237
           E   AS  ++YW   +                    V+ YGE+EF F S KIL I G +I
Sbjct: 211 ECTAASGVVEYWTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLII 270

Query: 238 LSIVVNCGGAGVDGYIGGKYWRDPGAFA---SDNAASRFKGVAFVLVTAYFSY-GGVELF 293
           LS ++  GG      +G +YW+ PGAFA   +  +   F  +   ++   F++  G EL 
Sbjct: 271 LSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGIIKGAFAFILGPELV 330

Query: 294 ALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGA---GGSATHA 350
            ++  E  + RR+   A+++                   VP+N   L+ A   G     +
Sbjct: 331 CMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGS 390

Query: 351 SPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDR 410
           SP+V+ +   G+KV+PHIIN  IL S  S AN+ ++AS R L ++A+ G APK    +++
Sbjct: 391 SPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINK 450

Query: 411 EGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMK 470
            G P  A+ +  +   +A+   S     +F W + I+ +S    W    ++++RFR A+ 
Sbjct: 451 WGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIF 510

Query: 471 AQGKSLNELGYISITGIWGSLYGCFFNVLV------------FIAQFWVALSPPGSKGVY 518
             G   + L + +    WG  Y  +F+++V            FI ++W            
Sbjct: 511 YNGL-YDRLPFKT----WGQPYTVWFSLIVIGIITITNGYAIFIPKYW------------ 553

Query: 519 SAEAFFESYLAFPVWLFFYLGYMLYSRDF-TFLTDLKKIDLDNHRRLYDPELLRQEDEET 577
               F  +Y+  P++L  + G+ LY+R +  +   + +ID+     L + E   +E EE 
Sbjct: 554 RVADFIAAYITLPIFLVLWFGHKLYTRTWRQWWLPVSEIDVTTG--LVEIEEKSREIEEM 611

Query: 578 KERIRNGGWTQKLLN 592
             R+   G+  K L+
Sbjct: 612 --RLPPTGFKDKFLD 624

>Sklu_2438.14 YOR348C, Contig c2438 29357-31033
          Length = 558

 Score =  210 bits (535), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 155/541 (28%), Positives = 257/541 (47%), Gaps = 34/541 (6%)

Query: 63  DLEDGTNSIQSDDN-LKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFM 121
            LE      + D+N L+K + SRH+ +++LG  IGTGL V  +  L+  GP  L + + +
Sbjct: 31  QLESQLEGTKCDENNLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSFVI 90

Query: 122 VSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELIT 181
           +SFI Y V+    EM + Y    G      S +V    GFA  W +   +  ++  EL  
Sbjct: 91  ISFIVYPVMNTLAEM-ICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYSILVATELSA 149

Query: 182 ASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIV 241
           A+  ++YW DK++                   V+ YGE+EF F S KI+ I G +I+SIV
Sbjct: 150 AAGVVQYWTDKVHVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIVSIV 209

Query: 242 VNCGGAGVDGYIGGKYWRDPGAFA---SDNAASRFKGVAFVLVTAYFSY-GGVELFALSV 297
           +  GGA     +G +YW +PG FA   +     RF  +   ++ + F++    EL  L+ 
Sbjct: 210 IFFGGAPSHDRLGFRYWNNPGPFAYHITGGNTGRFLDIWTAIIKSGFAFILSPELIGLAC 269

Query: 298 NEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGS---ATHASPYV 354
            E ++ RR+   A+++                GF +  +  +L+ A  S      +SP+V
Sbjct: 270 VEAKDTRRNIEKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGAASSPFV 329

Query: 355 LAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRP 414
             +S  G+ V+ HIINAVIL S  S ANS +YAS R + +LA+QG APK F  ++R G P
Sbjct: 330 QGISNAGIPVLNHIINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRINRLGVP 389

Query: 415 LRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAM----- 469
             A+ L +    + +   S     +FTWL+ I  +S    W+ I ++++RFR A+     
Sbjct: 390 YNAVALSTAVSCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKAIFYNNL 449

Query: 470 --KAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESY 527
             +   KS  +  +     ++  L         FI ++W            +A  F  +Y
Sbjct: 450 YERVPFKSALQPYFTYFFVVFVVLLCLTNGYATFIPKYW------------NASDFVAAY 497

Query: 528 LAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWT 587
           +  P++   YLG+ ++ +   ++   ++ID+     L D E   +E + T+ R     W 
Sbjct: 498 ITLPIFFLLYLGHKIWFKTRWYI-PFREIDVITG--LADAE---EEAKMTQPRTPKNMWE 551

Query: 588 Q 588
           +
Sbjct: 552 K 552

>AFR156W [3348] [Homologous to ScYOR348C (PUT4) - NSH]
           complement(717645..719321) [1677 bp, 558 aa]
          Length = 558

 Score =  207 bits (526), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 154/551 (27%), Positives = 267/551 (48%), Gaps = 31/551 (5%)

Query: 54  RAEVNHNGIDLED-GTNSIQSDDN-LKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAG 111
           + +  H+   LE+  T S  S+ N L K ++SRH+ +++LG  IGTGL V  +  L+  G
Sbjct: 21  KVKTPHSRTSLEELETQSAGSEYNTLHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCG 80

Query: 112 PASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQW 171
            A L++ + ++S I Y ++ +  EM + Y    G      S +V    GFAT W +   +
Sbjct: 81  AAPLLLSFILISTIVYPIMCSLAEM-ICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAY 139

Query: 172 LTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILM 231
             ++  EL  A+  + YW++ +                    V+ YGEAEF F S K++ 
Sbjct: 140 AILVAAELSAAASVVSYWDNPVPMAAWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLIC 199

Query: 232 IGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFA---SDNAASRFKGVAFVLVTAYFSY- 287
           I G +++S+V+  GGA      G +YW++PG FA   +  +  RF  V   ++ + F++ 
Sbjct: 200 ILGLLVVSVVIFFGGAPNHDRTGFRYWKNPGPFAMSLAPGSTGRFLDVWRAVIKSAFAFI 259

Query: 288 GGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGA---G 344
              EL  ++  E ++ RR+T  A+++                G  +     +L+ A   G
Sbjct: 260 LSPELIGIACVEAQDTRRNTEKASRRFIYRIIFFYVSCALMIGVILSRTDPKLIEALETG 319

Query: 345 GSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKY 404
                +SP+V  ++  G+ V+ H+IN  IL S  S  NS +YAS R++ +LA +G APK+
Sbjct: 320 APGAASSPFVQGIANAGIPVLDHVINVAILSSAWSAGNSFMYASTRMVLALAREGNAPKF 379

Query: 405 FNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVR 464
              ++R G P  A+I+C++   +A+         +F WL+ I  +S    W ++ ++ +R
Sbjct: 380 LTKINRYGVPYNAVIVCTLVACLAYLNVKTTSANVFQWLSNICTISGFIGWFAMGIAFIR 439

Query: 465 FRLAMKAQGKSLNELG----YISITGIWGSLYGCFFNVLVFIAQ-FWVALSPPGSKGVYS 519
           FR     +G   N L     Y      + + Y  F  V+V +   F V L     KG ++
Sbjct: 440 FR-----RGIVFNNLQSRIPYQGPLQPYIAYYFTFMTVVVCLTNGFHVFL-----KGRWN 489

Query: 520 AEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKE 579
              F  +Y+  P++L  YLG+ L+ R   ++  +++ID+     L + E   +E + T  
Sbjct: 490 VVDFVAAYVTLPIYLVLYLGHKLWFRTRWYI-PVEQIDVITG--LVEAE---EESKMTPP 543

Query: 580 RIRNGGWTQKL 590
           RI    W + L
Sbjct: 544 RIPKNLWEKFL 554

>Kwal_23.2817
          Length = 580

 Score =  206 bits (525), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 153/543 (28%), Positives = 259/543 (47%), Gaps = 50/543 (9%)

Query: 63  DLEDGT----NSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIG 118
           D+E G+    ++I+    + + +KSRHV  ++LG  IGTGL + +   L   GPA L+I 
Sbjct: 46  DIERGSLSDIDTIKPSTEVSRGLKSRHVQFIALGGAIGTGLFIGSGTALSSCGPAPLLIS 105

Query: 119 YFMVSFITYFVIQAAGEMAVTYPTLPG--GFNNYASIFVSKPFGFATVWLFCIQWLTVLP 176
           Y ++SF  + ++    EM V  P L G     + A  ++++P  F   W        V+P
Sbjct: 106 YSVMSFFVWAIMNQMTEMVVLIP-LSGESSMASLAGTYLNRPSSFMCGWNCFYAMSMVVP 164

Query: 177 LELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFV 236
            E+   ++ I+YW D  NA                  V+ +GE+EF  +  KIL I G +
Sbjct: 165 TEITACALLIEYWTDA-NAAIFVTIFMILATLLSLLPVKIFGESEFCVSIIKILTILGLI 223

Query: 237 ILSIVVNCGGAGVD-GYIGGKYWRDPGAFAS---DNAASRFKGVAFVLVTAYFSYGGV-E 291
           ++ +V+  GG       +G  YW  PGAF S     +   F  V   ++ + F++  + E
Sbjct: 224 LVGVVIFFGGGPAQHKVLGFHYWNTPGAFNSYLVKGSTGAFLAVWKAIIKSGFAFVMIPE 283

Query: 292 LFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQL---MGAGGSAT 348
           + +    E   PR++ P A ++                G  V +++  L   + +G +  
Sbjct: 284 ITSSCSAEAAFPRKNMPRACQRFVYRLAVFYVLGCLVIGVIVGYDNKTLNEAISSGKANA 343

Query: 349 HASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYV 408
            ASP+V+ +   G++++PHIINA IL S  S + S LY + R+L SLA +G APK+F+ V
Sbjct: 344 AASPFVIGIQEAGIRILPHIINACILTSAYSCSTSELYGASRVLHSLALRGDAPKFFSKV 403

Query: 409 DREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRF--- 465
           ++ G P  ++   S+FGV+A+  CS    V+F WL+ IA +S    W  + ++++RF   
Sbjct: 404 NKYGVPYYSVAATSLFGVLAYLNCSKSSLVVFNWLSNIATISGFVNWVFVSITYLRFRKI 463

Query: 466 --------RLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGV 517
                   R+  + +G+    L Y S           FF +L     F+V ++     G 
Sbjct: 464 TDYLKINDRVPYRRRGQ--RALAYAS---------AIFFALLAITNGFYVFIA-----GN 507

Query: 518 YSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEET 577
           ++   FF  Y+        ++G  +Y +++TF       D+D   R   P+ + Q D+E 
Sbjct: 508 WNVSDFFTCYVTIGFVGVLFIGSSIYYKEWTFR------DMDVVGREIMPK-IDQADQEE 560

Query: 578 KER 580
           KE 
Sbjct: 561 KEE 563

>CAGL0M00154g 22039..23691 similar to sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or sp|P04817 Saccharomyces
           cerevisiae YEL063c CAN1, hypothetical start
          Length = 550

 Score =  205 bits (521), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 166/556 (29%), Positives = 256/556 (46%), Gaps = 44/556 (7%)

Query: 49  VDSFKRA--EVNHNGIDLEDGTNSIQSDDNLK----KAMKSRHVIMMSLGTGIGTGLLVA 102
           VDS K+   EV+ + +D+++  +    + N++    +A+  RH+ M+S+   IGTGL ++
Sbjct: 13  VDSGKQEIYEVS-SSLDIDELRSDFDPEQNIREDLTRALSPRHINMISIAGIIGTGLYLS 71

Query: 103 NAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFA 162
            AK L+  GPASL + Y ++  + Y  +   GEM+   P + G F +YA  F S+ F  A
Sbjct: 72  TAKSLHNGGPASLFMNYTIIGGVVYLTMLCLGEMSTFMP-ISGSFCSYARKFGSESFACA 130

Query: 163 TVWLFCIQWLTVLPLELITASMTIKYWNDKINADX------XXXXXXXXXXXXXXXGVRA 216
            +W +       +  +L    + + YW+    AD                       VR 
Sbjct: 131 LMWNYWFNDAVSVASDLTALQLVLDYWH---TADHHFPYWGASLIFWFFVLFLNVIHVRI 187

Query: 217 YGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGV 276
           YGEAE+     K++ I  F I+SI+VN G      YIG K W    A       + FKG 
Sbjct: 188 YGEAEYWLAMLKVIAIVIFFIMSIIVNVGKNPQHEYIGFKNWTHGEA----PFVNGFKGF 243

Query: 277 AFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHN 336
           A + V+A F+YGG E   L+  E  NP R+TP   K                 G N+P++
Sbjct: 244 ASLFVSACFAYGGTESITLTGGEASNPVRNTPKIVKTVFWRILIFYVLSTFFIGMNIPYD 303

Query: 337 SDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLA 396
                G    +   SP+ L   + G +     +NAVIL SV S  N AL+A  R++ ++A
Sbjct: 304 YP---GLSTKSVMTSPFTLVFQMAGTRGAGSFMNAVILTSVISACNHALFAGSRIMYNMA 360

Query: 397 EQGYAPKYFNYVDREGR---PLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELF 453
             GY PK    V R  R   P  A+++    G +   A       ++TWL  I G+S   
Sbjct: 361 LDGYLPK--KIVGRTNRYKAPYVAVLITWAVGGLCLGASFIGAGTLWTWLQNIVGVSNQI 418

Query: 454 TWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPG 513
            W  I ++ +RFR  ++ QGK+ + L + + T  +G  +   F V + + Q W A  P  
Sbjct: 419 AWLCIGITSIRFRKGLEVQGKT-DLLQFKNWTYPFGPYFLVIFTVFIILIQGWQAFDP-- 475

Query: 514 SKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQE 573
               +S   FF  YL   V+ F Y+ + L+ RD+     +K  D+D     Y P    +E
Sbjct: 476 ----WSVTDFFSVYLELFVFPFVYIIWWLWKRDWF----VKYEDMDFVTDRYIPT---KE 524

Query: 574 DEETKERIRN-GGWTQ 588
             E  ER+ N  GW +
Sbjct: 525 IVELNERLDNLKGWKK 540

>Kwal_26.6940
          Length = 570

 Score =  202 bits (515), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 153/532 (28%), Positives = 252/532 (47%), Gaps = 49/532 (9%)

Query: 72  QSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQ 131
           +    LK+ ++SRH+ +++LG  IGTGL V  +  L   GPA L+  Y ++S + Y V+ 
Sbjct: 44  REPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMN 103

Query: 132 AAGEMAVTYP---TLPGG-FNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIK 187
           A GEM    P   T  GG  +   S +     GFAT W +   ++ ++  E   AS  + 
Sbjct: 104 ALGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVVT 163

Query: 188 YWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGA 247
           YW   +                    V+ YGE+EF F   KIL I G + +S ++  GG 
Sbjct: 164 YWTTVVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFWGGG 223

Query: 248 GVDGYIGGKYWRDPGAFA---SDNAASRFKGVAFVLVTAYFSY-GGVELFALSVNEQENP 303
                +G +YW+ PGAFA   +     RF  V   ++   F++  G EL A++ +E  + 
Sbjct: 224 PSHDRLGFRYWQKPGAFAYHITTGNTGRFLDVWTGVIKGGFAFILGPELVAVTSSEAMDQ 283

Query: 304 RRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQL---MGAGGSATHASPYVLAVSIH 360
           RR+   A+++                G  V  N   L   + +G +   +SP+V+A+   
Sbjct: 284 RRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVIAIQNA 343

Query: 361 GVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALIL 420
            +K++PHIINA IL S  S  NS ++A+ R L S+AE G APK F  ++R G P  A+ +
Sbjct: 344 HIKILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPYNAVAV 403

Query: 421 CSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELG 480
            + F  +A+   S      FTW + I+ +S    W  I ++++RFR A+  +G   + + 
Sbjct: 404 SAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGL-YDRVP 462

Query: 481 YISITGIWGSLYGCFFNVLV------------FIAQFWVALSPPGSKGVYSAEAFFESYL 528
           + S        YG +F ++V            FI +FW        KG      F  +Y+
Sbjct: 463 FKSPF----QPYGTYFFIIVVSIICLTNGYATFIPRFW--------KG----ADFVAAYI 506

Query: 529 AFPVWLFFYLGYMLYSRDF-TFLTDLKKIDLDNHRRLYDPELLRQEDEETKE 579
             PV++  ++G+ +Y+R   T++  + ++D+           L + +E TKE
Sbjct: 507 TLPVFVVLWVGHKIYTRTLSTWVIPVAEVDVTTG--------LAEIEELTKE 550

>Kwal_8.590
          Length = 629

 Score =  201 bits (511), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 151/591 (25%), Positives = 258/591 (43%), Gaps = 36/591 (6%)

Query: 27  TEKFEPYPDTTAVKHRTHFNRFVDSFKRAEVNHNGIDLEDGTNS------IQSDDNLK-- 78
           T++  P    T     T  ++   S K+     N   LE+G  +      +Q+ D+ K  
Sbjct: 49  TQRDHPGLHKTRTTCFTIVSQMSVSGKKEAFELNVTSLEEGETATIDDFVLQNRDSPKSQ 108

Query: 79  ----------KAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYF 128
                     + +  R V M+ +G  IGT L V+    +   GP SL+I + + S + + 
Sbjct: 109 SLSLEERIARRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLIAFCLWS-VVFI 167

Query: 129 VIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKY 188
            +     + VTY  + G F ++   FV +  GFA  W + +     +  E+    + ++Y
Sbjct: 168 GLSKCMCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEITAVCLVVEY 227

Query: 189 WNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAG 248
           W DKI                    V  +GE EF  +  K+++  G +I ++VV  GG  
Sbjct: 228 WTDKIPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNP 287

Query: 249 VDGYIGGKYWRDPGAFA---SDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRR 305
               +G K W +PGAFA   SD +  RF G    LV A + + GV+    + +E  NPR+
Sbjct: 288 QHTVLGFKNWSNPGAFAEYISDGSVGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRK 347

Query: 306 STPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGA---GGSATHASPYVLAVSIHGV 362
             P++ ++                G  +P+N   ++ A   G     ASPYV A+   G+
Sbjct: 348 VIPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGI 407

Query: 363 KVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCS 422
           +V+PHI+N +IL S+ S  NS+LY++ R+L  LA    AP+ F    ++G P+   I   
Sbjct: 408 RVLPHIVNILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVL 467

Query: 423 IFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYI 482
           +   +A+ + S+    + TW   +   +    +  I +S+++FR    AQ   L  L Y 
Sbjct: 468 VICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYY 527

Query: 483 SITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYML 542
           S +  + + +  F+ VL+ +   +        KG +  ++F  SY   P +L F  G+ L
Sbjct: 528 SSSLPYLAWHSLFWLVLMLLVNGYTVF----LKGSWDTQSFVFSYFMIPFFLVFLFGHKL 583

Query: 543 YSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNF 593
           Y         ++ +++D    +   E L  ED    E      W  +   F
Sbjct: 584 YKGT----KSVRPLEMDLFTGI---EELADEDRYWAENPPTLNWFDRAFGF 627

>Kwal_23.4026
          Length = 534

 Score =  181 bits (458), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 116/439 (26%), Positives = 202/439 (46%), Gaps = 11/439 (2%)

Query: 38  AVKHRTHFNRFVDSFK--RAEVNHNG----IDLEDGTNSIQSDDNLKKAMKSRHVIMMSL 91
           +VK  T F + VD+     ++   NG    +D ++     +S   L++  K RHV M+++
Sbjct: 3   SVKGATGFVKRVDTLDTGNSDTQQNGEVYELDFQEAIG--ESSQTLQRGFKQRHVDMLAI 60

Query: 92  GTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYA 151
              IGTGL++     L   GP SL+I +     +   V+ +  EMA ++  +   F+ YA
Sbjct: 61  AGAIGTGLVIGTGTALKRGGPGSLLIAFIFTGSLLIGVLMSLAEMA-SFAPMDKSFSGYA 119

Query: 152 SIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXX 211
           + +V    GFAT W + +++   L  EL    + ++YW + ++                 
Sbjct: 120 TRYVDPALGFATGWNYFLKYAIALASELSAIGLLVQYWREDLSIAIFIVVFLVVLLSLNF 179

Query: 212 XGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPG--AFASDNA 269
             ++ YGE EF     K L++    +  +V+ CGG      IG +YWR+     +     
Sbjct: 180 MNIKFYGEVEFWSALLKFLVLIICFVTGLVLTCGGGPSKETIGFRYWREYAFVPYLVKGT 239

Query: 270 ASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXX 329
             RF G    ++ + ++Y G E   +   E  NP+++ PAA +                 
Sbjct: 240 TGRFLGWWACVIQSCYAYIGSETIGVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVLIL 299

Query: 330 GFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASP 389
           G  +  +   L  A  S    SP+V+A +  G+K +P  INA++++ + S AN+ALY   
Sbjct: 300 GLIISPHDKTLANAKTSDASGSPFVIAFTNAGIKGLPSFINAMLIMFIASAANTALYVCS 359

Query: 390 RLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGL 449
           R    LA+ G APK F   +R G P    +L  +  +++F   S+   VIF +L +   +
Sbjct: 360 RTAYGLAKDGMAPKIFLAQNRYGVPFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSVTV 419

Query: 450 SELFTWSSILLSHVRFRLA 468
                W S+L+S++ +  A
Sbjct: 420 FGTLNWLSVLISYIGYERA 438

>Scas_377.1
          Length = 148

 Score =  164 bits (414), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 72/149 (48%), Positives = 106/149 (71%), Gaps = 1/149 (0%)

Query: 447 AGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFW 506
           +GLS+LFTW SI LSH+RFR AM+ QG+S+ E+G+ S  GI+GSLY C   VL+ IAQFW
Sbjct: 1   SGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFW 60

Query: 507 VALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYD 566
            AL P G +G    +AFFE+YLA P+++  Y G+ ++ +D+      + IDL +HR ++D
Sbjct: 61  TALVPVG-EGKPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLFIRAEDIDLVSHREIFD 119

Query: 567 PELLRQEDEETKERIRNGGWTQKLLNFWC 595
            ELL+QEDEE + ++R+G   +++ +FWC
Sbjct: 120 EELLKQEDEEYRRKLRDGPMWRRVYDFWC 148

>Kwal_26.8097
          Length = 544

 Score =  172 bits (437), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 153/534 (28%), Positives = 237/534 (44%), Gaps = 41/534 (7%)

Query: 65  EDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSF 124
            +G  +    ++L +++  RH+ M+S+   IGTGL +   K L   GPASLVI Y ++  
Sbjct: 28  SEGQEADHVREHLNRSLTPRHINMISIAGVIGTGLYLGTGKALAKGGPASLVINYSIIGL 87

Query: 125 ITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQW----------LTV 174
           + Y  +   GEM+   P + G F +YA  F S    F    L C  W          LT 
Sbjct: 88  VVYLTMLCLGEMSTFMP-ISGSFCSYAKKFGSGSLAFT---LMCNYWFNDAVSVASDLTA 143

Query: 175 LPLEL---ITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILM 231
           L L L    T+     YW   +                    VR YGEAE+     K++ 
Sbjct: 144 LQLILDFWKTSDAHFPYWAASL-------IFWFVLLLLNVVHVRVYGEAEYWLAMLKVIA 196

Query: 232 IGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVE 291
           I  F I+SIVVN G      YIG K W    +       + FKG A + V++ F+YGG E
Sbjct: 197 IIIFFIISIVVNAGHNQDHSYIGFKNW----SVGEAPFVNGFKGFASLFVSSSFAYGGTE 252

Query: 292 LFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATHAS 351
              L+  E +NP R+TP   K                 G NVP+N  +L      +   S
Sbjct: 253 SITLTAGEAKNPIRNTPKIIKTVFWRILIFYVFTTFFIGMNVPYNYPKL---SEKSVMTS 309

Query: 352 PYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGY-APKYFNYVDR 410
           P+ +   + G K     +NAVIL SV S  N AL+A  R+L +L  +GY  P      +R
Sbjct: 310 PFTIVFQMVGTKAAASFMNAVILTSVISAGNHALFAGSRVLFNLGLEGYFFPSIITKTNR 369

Query: 411 EGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMK 470
              P  A+++    G + F +       ++TWL  I G+S    W  I +  +RFR  + 
Sbjct: 370 YQIPYVAVLITWAAGGLCFGSSFVGAGTLWTWLQNIVGVSNQIAWLCISIVSIRFRRGLA 429

Query: 471 AQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAF 530
            QGK+ +EL + + T  +G  +   F   + + Q W + +P      ++   FF  Y+  
Sbjct: 430 KQGKT-HELQFSNWTYPYGPYFLVLFVSFIILVQGWSSFAP------WNVTDFFSYYIEL 482

Query: 531 PVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETK--ERIR 582
            V++  Y+ + L+ RD    ++      D +   ++  LL +E +  K  +++R
Sbjct: 483 IVFVALYVFWWLWKRDAFVRSEDMDFVTDKYISPHEEVLLNEELDNLKGWKKVR 536

>Scas_460.3
          Length = 584

 Score =  168 bits (425), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 139/587 (23%), Positives = 244/587 (41%), Gaps = 41/587 (6%)

Query: 2   ESSKKNETSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTHFNR---FVDSFKRAEVN 58
           +++ K +T  +  S+TS          +  P+ D    K  T  +    F+ +  R   +
Sbjct: 5   DTTIKQQTIIDEESLTS---------HRRTPFADNKGGKVDTDLDSDDFFIPTTSRGTTS 55

Query: 59  HNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIG 118
            +  D  D    + +    K+ + +RHV ++++   IGT + VA  K LY  GPA L++ 
Sbjct: 56  VSSQD-NDSKTFLVASHTTKRNLVNRHVQLIAISGVIGTAIFVAIGKPLYRGGPAFLLLA 114

Query: 119 YFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLE 178
           + +       +  +  EM    P +   F   A+  V         W F       +P E
Sbjct: 115 FAIWCIPILCITVSTAEMVCFMP-VSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPYE 173

Query: 179 LITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVIL 238
           ++T +  I YW D  +A                  V+ YGE EF   S KI++  G    
Sbjct: 174 IVTVNTIIHYWRDDYSAAIPLVIQSLLYLLISLAAVKWYGEMEFWLASFKIVLAMGLFCF 233

Query: 239 SIVVNCGGAGVDGYIGGKYWRD-------PGAFASDNAASRFKGVAFVLVTAYFSYGGVE 291
           + +   GG       G +Y+ D       P      ++A  F+G    L+ A F+  G E
Sbjct: 234 TFITMLGGNPKKDRFGFRYFHDTPFKKYFPDGIDRGSSAGYFQGFFICLIQASFTIAGGE 293

Query: 292 LFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSA---T 348
             ++   E E PRR  P A KQ                G     N   L  A   A    
Sbjct: 294 YISMLAGEIEIPRRVLPRAFKQVFMRLTILFLGSCLCVGILCSPNDSSLTAAINEARPGA 353

Query: 349 HASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYV 408
            +SPYV+A++  G++++P I+N  ++ +  S  N+  Y S R L  +A  GYAPK F   
Sbjct: 354 GSSPYVIAMNNLGIRILPDIVNITLITAAFSSGNAYTYCSSRTLYGMALDGYAPKIFTRC 413

Query: 409 DREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLA 468
           +++G P+ A+ +  ++  I+    +    ++  WL  I   S+L  ++ + ++++ FR A
Sbjct: 414 NKQGVPIYAVGVSLLWAFISLLQLNSNSAIVLNWLINIITASQLINFAILCITYLFFRRA 473

Query: 469 MKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYL 528
              Q   L EL + S    + +++G    +++ I Q +    P      ++ + F   YL
Sbjct: 474 YLLQKDKLPELPFKSWWQPYTAIFGLVCAMVMMIVQGYTVFFPKN----WNVQDFLFCYL 529

Query: 529 AFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDE 575
                +F  +G  ++   + F+  L K       ++ DP  +  EDE
Sbjct: 530 M----IFINIGIYIF---YKFIWRLGK------DKIKDPATISFEDE 563

>Sklu_2365.9 YDR160W, Contig c2365 13522-15939
          Length = 805

 Score =  160 bits (405), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 141/576 (24%), Positives = 238/576 (41%), Gaps = 84/576 (14%)

Query: 71  IQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVI 130
           +Q    +++ +K RH+ M+SLG  IG GL + + K   +AGP    +GY   +      +
Sbjct: 223 LQGQVTIQRKLKVRHLQMISLGATIGVGLFLNSGKAFSIAGPLGTFLGYLFGALTILATL 282

Query: 131 QAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWN 190
            +  E+    P L  G +   S F+   FGF+  W     +    P ELI  ++ + Y+ 
Sbjct: 283 LSFAEIVALIP-LITGISGLCSRFIGDAFGFSVGWCHWASYAFGFPSELIATAIMLSYYT 341

Query: 191 D-------KINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVN 243
           +       + +                   VR YGE E+  ++ K++++   +IL IVVN
Sbjct: 342 NLQSISTNQGSMASAIVIMIAALTVLNLMDVRVYGELEYFASTIKLIVVALLIILMIVVN 401

Query: 244 CGGAGVDGYIGGKYWRDP---------GAF--------ASDNAASRFKGVAFVLVT---- 282
           CGG   +GYIG +YW            GAF          D A +   G   VL++    
Sbjct: 402 CGGLN-NGYIGFRYWDKNKSKSEHITFGAFRPTFDLKDTGDGARNGIGGFGGVLLSCIAS 460

Query: 283 ---AYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNV------ 333
              A FSY G E+  ++  E +NPR++ P+  K+                G N       
Sbjct: 461 TLVAVFSYVGSEIGFIAAGEAQNPRKAVPSVTKRIFTRVVVFYLLSIFVVGLNFYSGDPR 520

Query: 334 ------PHNSDQLM-----------GAGG--------------SATHASPYVLAVSIHGV 362
                 P ++  L+             GG               +++ SP+V+A+     
Sbjct: 521 LLRYYSPEDNQMLIEKFEGYKDLIDSLGGLNCNTVLTEQNFVNESSNQSPWVIALKSFKQ 580

Query: 363 KVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCS 422
             +  I+N V +    S A+S LYAS R L S+A Q  AP  F + +R G P  ++I C+
Sbjct: 581 CTLSSIVNGVFVAIGFSAASSQLYASSRTLYSMATQQKAPSVFTWCNRHGVPYMSVIFCA 640

Query: 423 IFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQ----GKSLNE 478
             G ++    + +   +F     I  +  +  W S+ LS +RF  A+K +     +   E
Sbjct: 641 FLGFLSLLCLNMKSTDVFIMFINIGAMGSVIMWFSMNLSFLRFYYALKRRPDIISRDSKE 700

Query: 479 LGYISITGIWGSLYGCFFN-VLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFY 537
             Y S    + S++G     +LV    F            ++ + F  SY    +++  Y
Sbjct: 701 YPYKSPLQPYLSIFGMVSTAILVLFNGFQNFF-------YWNTKNFISSYCTVVLFVVLY 753

Query: 538 LGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQE 573
            GY  +    + +  L+ IDLD+ RR  D  + +++
Sbjct: 754 FGYNWFKH--SQINKLENIDLDSGRREMDSIIWKED 787

>YBR132C (AGP2) [319] chr2 complement(499608..501398) Plasma
           membrane carnitine transporter, required for the
           carnitine-dependent pathway for transport of acetyl-CoA
           from peroxisomes to mitochondria, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1791 bp, 596 aa]
          Length = 596

 Score =  154 bits (390), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 128/537 (23%), Positives = 219/537 (40%), Gaps = 28/537 (5%)

Query: 65  EDGTNSIQSDD--------NLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLV 116
           ED  +SI  D           ++ +++RHV ++++   IGT L VA  K LY  GPASL+
Sbjct: 64  EDRGSSIDDDSRTYLLYFTETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLL 123

Query: 117 IGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLP 176
           + + +       +  +  EM   +P +   F   A+  V         W F       +P
Sbjct: 124 LAFALWCVPILCITVSTAEMVCFFP-VSSPFLRLATKCVDDSLAVMASWNFWFLECVQIP 182

Query: 177 LELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFV 236
            E+++ +  I YW D  +A                  V+ YGE EF   S KI++  G  
Sbjct: 183 FEIVSVNTIIHYWRDDYSAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLF 242

Query: 237 ILSIVVNCGG-AGVDGYIGGKYWRDP--GAFASDNAASR----FKGVAFVLVTAYFSYGG 289
             + +   GG    D Y    Y   P    F   N   +    F+G    L+ A F+  G
Sbjct: 243 TFTFITMLGGNPEHDRYGFRNYGESPFKKYFPDGNDVGKSSGYFQGFLACLIQASFTIAG 302

Query: 290 VELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSA-- 347
            E  ++   E + PR+  P A KQ                G     N   L  A   A  
Sbjct: 303 GEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARP 362

Query: 348 -THASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFN 406
              +SPYV+A++   ++++P I+N  ++ +  S  N+  Y S R    +A  GYAPK F 
Sbjct: 363 GAGSSPYVIAMNNLKIRILPDIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKIFT 422

Query: 407 YVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFR 466
             +R G P+ ++ +  ++ +++    +    V+  WL  +   S+L  +  + + ++ FR
Sbjct: 423 RCNRHGVPIYSVAISLVWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIVYLFFR 482

Query: 467 LAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFES 526
            A   Q  SL +L + S    WG  Y     ++   A   +         +++ + F  S
Sbjct: 483 RAYHVQQDSLPKLPFRS----WGQPYTAIIGLVSCSAMILIQGYTVFFPKLWNTQDFLFS 538

Query: 527 YLAFPVWLFFYLGY-MLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIR 582
           YL   + +  Y+GY  ++ R      +  +ID          E+   E E + E+ +
Sbjct: 539 YLMVFINIGIYVGYKFIWKRGKDHFKNPHEIDFSKELT----EIENHEIESSFEKFQ 591

>AAR038W [224] [Homologous to ScYBR132C (AGP2) - SH]
           complement(409071..410771) [1701 bp, 566 aa]
          Length = 566

 Score =  152 bits (385), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 123/476 (25%), Positives = 204/476 (42%), Gaps = 23/476 (4%)

Query: 79  KAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAV 138
           + +++RHV ++ +   IGT L V+  K LY  G  SL++G+ +       +  +  EM V
Sbjct: 55  RKLENRHVQLIGISGVIGTALFVSIGKALYRGGSVSLLLGFALWCVPILCITVSTAEM-V 113

Query: 139 TYPTLPGGFNNYASIFVSKPFGFATVWLF----CIQWLTVLPLELITASMTIKYWNDKIN 194
            Y  L   F   AS  V+        W F    C+Q    +P E++  +  I YW D  +
Sbjct: 114 CYLPLNSPFLRLASRCVNDSLTVMAGWNFWFLECVQ----IPFEIVAVNSIIHYWRDDYS 169

Query: 195 ADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIG 254
           A                  VR YGE EF   S K+L+  G    + V   GG       G
Sbjct: 170 AAITLVVQVMLYLLISLFAVRYYGEIEFWLASFKVLLAVGLFCFTFVTMVGGNPKRDRYG 229

Query: 255 GKYWRD-------PGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRST 307
            +Y  +       P      ++A  F+G    L+ A F+  G +  ++   E + PR+  
Sbjct: 230 FRYIGEAPFKQYSPTMEPISSSAGYFQGFLACLIQASFTIAGPDYVSMIAGETKLPRKVL 289

Query: 308 PAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQL---MGAGGSATHASPYVLAVSIHGVKV 364
           P A KQ                G     N   L   + A      +SPYV+A++  G+K+
Sbjct: 290 PVAFKQVFIRLTVLFLGGCLCVGIVCSANDPDLTAAINASRPGAGSSPYVIAMNHLGIKI 349

Query: 365 VPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIF 424
           +P I+NA ++ +  S  N+  Y S R L  LA  GYAP  F   +R G P+ A+ +  ++
Sbjct: 350 LPDIVNAALVTAAFSAGNAYTYCSSRSLYGLALDGYAPAIFKRCNRFGVPIYAVSVSVMW 409

Query: 425 GVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISI 484
            V++    +    V+  WL ++   S+L  +  + + ++ FR A  AQ  +L EL + S 
Sbjct: 410 SVLSLLQLNSNSAVVLNWLISLITASQLINFGVLCVVYLYFRRAYLAQQDNLPELSFKSW 469

Query: 485 TGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGY 540
              + +  G    +L+ + Q +          +++ + F   YL   + +  YLGY
Sbjct: 470 WQPYTAYVGLTCVLLIVVVQGYTVF----YSALWNVKDFLFCYLMVFIDIAIYLGY 521

>KLLA0C15873g 1381699..1383405 similar to sp|P38090 Saccharomyces
           cerevisiae YBR132c AGP2 amino-acid permease, start by
           similarity
          Length = 568

 Score =  151 bits (382), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 132/533 (24%), Positives = 212/533 (39%), Gaps = 35/533 (6%)

Query: 71  IQSDDN-------LKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVS 123
           I SDDN         + +++RHV ++ +   IGT L V+  K LY  GP SL++G+ +  
Sbjct: 40  ISSDDNSSYFNNSTSRKLQNRHVQLIGISGVIGTALFVSIGKALYRGGPVSLILGFSLWC 99

Query: 124 FITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITAS 183
                +  +  EM V Y  +   F   A    +        W F       +P E++  +
Sbjct: 100 IPILCITVSTAEM-VCYLPISSPFLRMAKRCCNDSLAVTAGWNFWFLECVQIPFEIVAVN 158

Query: 184 MTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVN 243
             + YW D  +                   VR YGE E    S KIL+  G  + + +  
Sbjct: 159 TILHYWRDDFSPAIPLCVQVLLYIGISLFAVRCYGETEAFLASFKILLAIGLFLFTFITM 218

Query: 244 CGGAGVDGYIGGKYWRD---PGAFASDNAASR---FKGVAFVLVTAYFSYGGVELFALSV 297
            GG       G +Y  D      F ++  +S    F+G    ++ A F+  G +  A+  
Sbjct: 219 LGGNPKHDRYGFRYITDTKFKQYFPNNEGSSSMGYFQGFLACVIQASFTIAGPDYVAMIA 278

Query: 298 NEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGS---ATHASPYV 354
            E + PR+  P A KQ                G     N   L     +      +SPYV
Sbjct: 279 GECKLPRKVLPVAFKQVFIRLTVLFLGGCLCVGIVCSSNDPNLTAVINNPRPGAGSSPYV 338

Query: 355 LAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRP 414
           +A++  G+KV+P ++NA ++ +  S  N+  Y S R L  L+  GYAPK F Y  + G P
Sbjct: 339 IAMNNLGIKVLPDVVNAALVTAAFSAGNAYTYCSSRTLYGLSLDGYAPKLFQYCTKSGVP 398

Query: 415 LRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGK 474
           + A+++   +  I+         V+  WL  +   S+L  +S + + ++ FR A   Q  
Sbjct: 399 INAVLVSLAWAFISLLQLGSNSAVVLNWLINLITASQLINFSILCVIYLSFRRAYIKQHP 458

Query: 475 S--LNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPV 532
           S  L EL + S    WG  Y  +  +        V        G +  ++F   YL   +
Sbjct: 459 SGELPELPFKS----WGQPYTAYCGLFAVTLMIGVQGYTVFLHGSWEVQSFLFCYLMVFI 514

Query: 533 WL-FFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNG 584
            L  F L + +Y R             D   +  D +LL   DE  +  +  G
Sbjct: 515 DLGIFLLCFFVYKR-----------TRDPWVKPEDADLLTGMDEVEEHELSLG 556

>Kwal_23.3847
          Length = 579

 Score =  149 bits (376), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 117/468 (25%), Positives = 195/468 (41%), Gaps = 15/468 (3%)

Query: 50  DSFKRAEVNHNGIDLE---DGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKG 106
           D+   +E     +DL    +G  S+ +D   +K +  RHV+++ +   IGT L V+  K 
Sbjct: 34  DTGIPSEFAFESLDLSPPLEGKQSLDTDATHRK-LHERHVMLIGISGVIGTALFVSIGKA 92

Query: 107 LYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWL 166
           LY  G A L++G   V  I    I  +    V Y  L   F    +  V      A  W 
Sbjct: 93  LYHGGSAFLLLG-MAVWCIPMLCITVSTAEMVCYLPLDSPFLRLTARCVDDSVAVAAGWN 151

Query: 167 FCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNS 226
           F       +P E++  +  I YW D  +A                  VR YGE EF   S
Sbjct: 152 FWFLECVQIPFEIVAVNTIIHYWRDDYSAAIPLVVQVVLYFGISVFAVRYYGEMEFWLAS 211

Query: 227 CKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRD-------PGAFASDNAASRFKGVAFV 279
            KI++  G    ++V   GG       G + + D       P       +A  F+G    
Sbjct: 212 FKIILALGLFTFTLVAMLGGNPHKDRFGFRNFGDAPFKQYFPSGVVGTPSAGYFQGFLAC 271

Query: 280 LVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQ 339
           L+ A F+  G +  ++   E   PR+  P A K                 G     N   
Sbjct: 272 LIQASFTIAGPDYVSMIAGETHLPRKVLPVAFKHVFNRLTVLFLGSSLCVGILCSANDPD 331

Query: 340 LMGAGGSA---THASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLA 396
           L  A   A     +SPYV+A+   G++ +P ++NA ++ +  S  N+  + S R L  +A
Sbjct: 332 LTAAINEARPGAGSSPYVIAMKNLGIRALPDVVNAALITAAFSAGNAYTFCSSRTLHGMA 391

Query: 397 EQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWS 456
             G AP+ F   +R G P+ A+ +   + +++    +    V+  WL  +   S+L  ++
Sbjct: 392 LDGNAPRIFRRCNRHGVPIYAVAVSLTWALLSLLQLNKNSAVVLNWLINLITASQLINFA 451

Query: 457 SILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQ 504
            + L+++ FR A  +Q  +L  L + S    + +L G F ++L+ + Q
Sbjct: 452 CLCLTYLYFRRAYLSQQHNLPSLPFKSWGQPYTALLGLFASLLMALVQ 499

>CAGL0E01089g complement(96582..99143) similar to sp|Q03770
           Saccharomyces cerevisiae YDR160w SSY1 transcriptional
           regulator of several transporter genes, start by
           similarity
          Length = 853

 Score =  145 bits (366), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 140/604 (23%), Positives = 250/604 (41%), Gaps = 99/604 (16%)

Query: 69  NSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYF 128
           +S +  + L++ +K RH+ M+++   +  G+ + + K   +AGP   ++G+ +   +   
Sbjct: 267 DSTRRRNQLQRNLKVRHIQMLAISACLSAGIFMTSGKAFSIAGPFGCLLGFIITGTVVIA 326

Query: 129 VIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKY 188
            + +  E+A   P +  GF+  AS FV   FGFA  W +    +  LP ++++++    +
Sbjct: 327 TMMSFAELATLIP-VSSGFSGLASRFVEDAFGFALGWTYWFSSMVALPAQVVSSTFYFSH 385

Query: 189 WND----KINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNC 244
           ++     +                     VR  GE  +I    K+L+    VI+ +V+N 
Sbjct: 386 YDHLKLTRGGTAGFVTLFSLFPLVLNLFDVRFLGEFVYIVGLSKVLITIMIVIVMLVLNA 445

Query: 245 G-GAGVDGYIGGKYW--------RD-------PGAFASDNA----------ASRFKGVAF 278
           G G  V G +  +YW        +D       P    SD              RF  V  
Sbjct: 446 GHGFDVHGRVSFRYWDAEKSRNLKDITYGLFRPTFDLSDAGLGSINGIGGNRGRFIAVVS 505

Query: 279 VLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSD 338
           V++ + F++ GVE+  ++  E +NPR++ P+A K++                 N+     
Sbjct: 506 VMLVSTFAFSGVEMTFVASGEAKNPRKTIPSAMKRTFIFIFTIYFFLIFSVSINIYTGDP 565

Query: 339 QLM----GAGGSATH--------------------------------ASPYVLAVSIHGV 362
           +L+    GA  S  H                                +SP+VLA+   G 
Sbjct: 566 RLLSYYTGALESRYHNIENKVSNEWQVSYRCEEVLHGVNPGDVQAGFSSPWVLALENFGF 625

Query: 363 KVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCS 422
                  NAV++   +S   S+LYAS R L +++ Q  AP  F   DR G P  A+   S
Sbjct: 626 CSFAAGFNAVLIFFTSSATASSLYASSRTLYAMSIQRKAPAVFRLCDRRGVPYVAIGFSS 685

Query: 423 IFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELG-- 480
           +F ++A+ A  D     F  L  I+  +    W  + ++ +RF  A+K +   ++     
Sbjct: 686 LFAIVAYLAVDDAAISNFDVLMNISSAATSIIWLGLNVAFLRFYYALKKRRDIISRDDVF 745

Query: 481 ---------YISITGIWG-SLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAF 530
                    Y+S+ G+ G S++  F   + FI  +W            + ++FF SY   
Sbjct: 746 YPYRSPFQPYLSMFGLLGCSIFVLFMGFINFIHGYW------------NTKSFFSSYGGL 793

Query: 531 PVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKL 590
            ++   YLGY L S   + +  L ++DLD  RR  D  L       T+ R   G ++++L
Sbjct: 794 ILFGVCYLGYKLIST--SKIQRLDQLDLDTGRREIDRILW------TEHRQYRGPYSERL 845

Query: 591 LNFW 594
              +
Sbjct: 846 KKLY 849

>Kwal_53.19461
          Length = 565

 Score =  140 bits (352), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 137/566 (24%), Positives = 230/566 (40%), Gaps = 77/566 (13%)

Query: 88  MMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGF 147
           M++ G  +G GL + + K L + GP   ++G+ +   I    + +  E+A   P L  G 
Sbjct: 1   MIATGAAMGVGLFLNSGKALSIGGPFGFLLGFSICGSIVLATMLSFTEIATLIP-LSSGI 59

Query: 148 NNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXX 207
           +  AS FV   FGFA  W + + +   L  +++ ++  + Y+                  
Sbjct: 60  SGLASRFVEDAFGFALGWSYWLTYAITLANQIVASNFMLSYYGTMPARTGSTVGFVTFFL 119

Query: 208 XXXXXG----VRAYGEAEFIFNSCKILMIGGFVILSIVVNCG-GAGVDGYIGGKYW---- 258
                G    V    E  + F   KI++    +   +++N G G      +G ++W    
Sbjct: 120 VFAIAGNLLDVNILAELAYGFTFFKIVITATMIFAMVILNAGAGRHKHPRVGFRFWDASK 179

Query: 259 ----------------RDPGAFASDN---AASRFKGVAFVLVTAYFSYGGVELFALSVNE 299
                           +D G  A +    A  RF  V  V++ + FS+ GVE+  ++  E
Sbjct: 180 SPENLTYGLFRPTFDLQDVGDGAKNGIPGAKGRFLSVLVVIIVSSFSFSGVEVGFVACGE 239

Query: 300 QENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSATH---------- 349
             NPRRS P+A K++                 NV     +L+    +AT           
Sbjct: 240 AANPRRSLPSATKRTIMTVIILYVVSIFVISLNVYSGDSRLLRYYTAATQEPTQSSVRAF 299

Query: 350 -------------------------ASPYVLAVSIHGVKVVPHIINAVILISVTSVANSA 384
                                     SP+VLA+   G+     + NA+++I   +   S+
Sbjct: 300 NNNWQTDQVCTAHEIVSTTDFTNGSQSPWVLALESFGLCTFSSVFNAMLVIFGVTSELSS 359

Query: 385 LYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLA 444
           LYAS R L S++ QG AP  F    R+G P  A+I   +FG +A+   + +   IF  LA
Sbjct: 360 LYASSRTLYSMSIQGKAPPIFKICSRKGVPYVAVIFSGLFGALAYLTVNAKALEIFQALA 419

Query: 445 AIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNE----LGYISITGIWGSLYGCFFNVLV 500
            I+G +    W    LS +RF  A+K +   ++       Y S    + + YG F + L+
Sbjct: 420 NISGATISIIWFGFNLSFLRFYYALKRRPDIISREDPSFPYRSPLQPFLACYGLFGSFLI 479

Query: 501 FIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDN 560
            +   +         G ++ + FF SY    V++  Y GY L     + +  L ++DLD+
Sbjct: 480 VVLMGFSNF----LDGFWNTKMFFSSYGGLIVFILCYAGYRLLGT--SKIQRLDQLDLDS 533

Query: 561 HRRLYDPELLRQEDEET---KERIRN 583
            RR  D  +  +  E T   +ERIR 
Sbjct: 534 GRREMDRMIWTEHREYTNSVRERIRK 559

>CAGL0C00539g 57784..59502 highly similar to sp|P38090 Saccharomyces
           cerevisiae YBR132c AGP2 amino-acid permease,
           hypothetical start
          Length = 572

 Score =  139 bits (351), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 112/444 (25%), Positives = 188/444 (42%), Gaps = 17/444 (3%)

Query: 51  SFKRAEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLA 110
           SF   E + N    +  T  I+S    +K + +RHV  +++   IGT L VA  K LY  
Sbjct: 36  SFDEDERSSN----DSRTQLIESTSTHRKLL-NRHVQFIAISGVIGTALFVAIGKPLYRG 90

Query: 111 GPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQ 170
           GPA+L++ + +       +  +  EM V++  +   F   A   V +  G    W F   
Sbjct: 91  GPANLLLAFALWCIPILCITVSTAEM-VSFMPVSSPFLRLAKKCVDESLGVTASWNFWFL 149

Query: 171 WLTVLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKIL 230
               +P E+++ +  I YW D  +                   V+ YGE EF   S KI+
Sbjct: 150 ECVQIPYEIVSVNTIIHYWRDDYSPAIPLVIQVVLYVLISVCAVKYYGEMEFWLASFKII 209

Query: 231 MIGGFVILSIVVNCGGAGVDGYIGGKYWRDP--------GAFASDNAASRFKGVAFVLVT 282
           +  G    + +   GG       G +Y+ +         G   +  +A  F+G    L+ 
Sbjct: 210 LAVGLFCFTFITMLGGNPKHDRYGFRYYGESPFKKYFPDGNEGAGKSAGYFQGFLTCLIQ 269

Query: 283 AYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMG 342
           A F+  G E  ++   E + PR+  P A KQ                G     N   L  
Sbjct: 270 AAFTIAGGEYISMLAGEVKLPRKVLPKAFKQVFVRLTVIFLGSCLCVGIVCSPNDSALTA 329

Query: 343 AGGSA---THASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQG 399
           A   A     +SPYV+A++   ++V+P I+N  ++ +  S  N+  Y S R L  +A  G
Sbjct: 330 AINEARPGAGSSPYVIAMNNLQIRVLPDIVNIALITAAFSAGNAYTYCSSRTLYGMALDG 389

Query: 400 YAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSIL 459
           YAPK F   ++ G P+ A+ +   + +++    +    V+  WL  +   S+L  +  + 
Sbjct: 390 YAPKIFTKCNKYGVPIYAVGVSLCWALLSLLQLNSNSAVVLNWLINLITASQLINFVFLC 449

Query: 460 LSHVRFRLAMKAQGKSLNELGYIS 483
           + ++ FR A   Q + L EL + S
Sbjct: 450 VIYLFFRRAYMTQKERLPELPFKS 473

>KLLA0D16830g 1426856..1429354 similar to sp|Q03770 Saccharomyces
           cerevisiae YDR160w SSY1 transcriptional regulator of
           several transporter genes, start by similarity
          Length = 832

 Score =  139 bits (350), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 133/593 (22%), Positives = 242/593 (40%), Gaps = 96/593 (16%)

Query: 73  SDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQA 132
           S  ++++ +++RH+ M++ G+ +G GL + + K   +AGP   ++GY +   I      +
Sbjct: 253 SHHSVQRKLEARHIQMIASGSSLGVGLFLTSGKAFTIAGPFGALLGYVLCGSIVMASTLS 312

Query: 133 AGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDK 192
             E+    P L  GF+  AS FV   FGFA  WL+   ++  +P +++ ++M + Y+   
Sbjct: 313 FTELCALIP-LTSGFSGLASRFVEDAFGFALGWLYWFSFIIAVPSQVVASTMLLNYY-QS 370

Query: 193 INADXXXXXXXXXXXXXXXX-----GVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGA 247
           +N                        VR +G   +     KI+     + + IV+N GGA
Sbjct: 371 LNLSSGKIAGFVTLFLVFAIFINLCDVRIFGNFVYFVTIIKIIFTIVMIFVMIVLNSGGA 430

Query: 248 GV-DGYIGGKYW----RDPGAF-------------------ASDNAASRFKGVAFVLVTA 283
            +    +G ++W      PG F                       A  R   +   ++ A
Sbjct: 431 ALGHDRVGFRFWDAGKSAPGLFYGLFRPTFNLKDEGSEIISGISGAKGRLLAIFLSMLIA 490

Query: 284 YFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNV---------- 333
            F+Y G+E+  ++  E  NP+++ P+A K++               G N+          
Sbjct: 491 AFTYSGIEMTFVASCEVRNPKKALPSAMKKTLYIMLLIYTISIFVVGLNIYSGDPRLPRF 550

Query: 334 ------PHNSDQLMGAGGS---ATHA----------------SPYVLAVSIHGVKVVPHI 368
                   N + +   G +   +TH                 S +V+A+   G      +
Sbjct: 551 YTYSQDSSNYNIMHNIGMNWQVSTHCQSTLLSSGSLLSDGNRSAWVIALRSFGRCTFASV 610

Query: 369 INAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIA 428
           +N +++    +   S+LY +   L S+A QG AP+        G P  A+++  IFGVI+
Sbjct: 611 LNGILIFYGATSGCSSLYGASHTLYSMAIQGKAPRICKACTSYGVPWIAVLVSGIFGVIS 670

Query: 429 FCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELG-------- 480
           + A        F  LA I+  +    W+ + +S +RF  A+K +   ++           
Sbjct: 671 YMAVDQSSLNNFQILANISSATICIIWAGMNVSFLRFFYALKIRPDIMSRDDPMFPYRSP 730

Query: 481 ---YISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFY 537
              Y+S  G++GSL      V++F A F          G ++ + FF  Y     ++  Y
Sbjct: 731 FQPYLSYYGLFGSL------VMIFFAGFTSFF-----HGFWNIKIFFSCYGGLVFFIVLY 779

Query: 538 LGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKL 590
           +GY L+    + L  L +ID+D  R   D  +  Q+ E        G W ++L
Sbjct: 780 IGYKLFGT--SKLQRLDQIDMDIGRIELDRTIWNQQTE------YQGNWKERL 824

>YDR160W (SSY1) [1002] chr4 (776157..778715) Component of an
           extracellular amino acid sensor comprised of Ptr3p,
           Ssy1p, and Ssy5p, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [2559 bp, 852 aa]
          Length = 852

 Score =  137 bits (344), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 131/567 (23%), Positives = 232/567 (40%), Gaps = 92/567 (16%)

Query: 76  NLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGE 135
           ++++ +K RH+ M+S+G     GL + + K   +AGP   ++G+ +   I    + +  E
Sbjct: 276 HIQRKLKVRHIQMLSIGACFSVGLFLTSGKAFSIAGPFGTLLGFGLTGSIILATMLSFTE 335

Query: 136 MAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWND---- 191
           ++   P +  GF+  AS FV   FGFA  W + I  +  LP ++ +++  + Y+N+    
Sbjct: 336 LSTLIP-VSSGFSGLASRFVEDAFGFALGWTYWISCMLALPAQVSSSTFYLSYYNNVNIS 394

Query: 192 KINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCG-GAGVD 250
           K                     V   GE  ++    K+++    V   I++N G G  + 
Sbjct: 395 KGVTAGFITLFSAFSIVVNLLDVSIMGEIVYVAGISKVIIAILMVFTMIILNAGHGNDIH 454

Query: 251 GYIGGKYWR--------------------DPGAFASDNAA---SRFKGVAFVLVTAYFSY 287
             +G +YW                     D G  +    +    RF   A V++ + F++
Sbjct: 455 EGVGFRYWDSSKSVRNLTYGLYRPTFDLADAGEGSKKGISGPKGRFLATASVMLISTFAF 514

Query: 288 GGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMG----- 342
            GVE+  L+  E  NPR++ P+A K++               G N+     +L+      
Sbjct: 515 SGVEMTFLASGEAINPRKTIPSATKRTFSIVLISYVFLIFSVGINIYSGDPRLLSYFPGI 574

Query: 343 ----------------------AGG--------SATHASPYVLAVSIHGVKVVPHIINAV 372
                                  GG           ++SP+V+A+   G+       NA+
Sbjct: 575 SEKRYEAIIKGTGMDWRLRTNCRGGIDYRQISVGTGYSSPWVVALQNFGLCTFASAFNAI 634

Query: 373 ILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCAC 432
           ++    +   S+L++  R L +++ Q  AP  F    + G P  ++I  S+F VIA+ A 
Sbjct: 635 LIFFTATAGISSLFSCSRTLYAMSVQRKAPPVFEICSKRGVPYVSVIFSSLFSVIAYIAV 694

Query: 433 SDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGK--SLNELG---------Y 481
                  F  LA ++  S    W  + LS +RF  A+K +    S N+           Y
Sbjct: 695 DQTAIENFDVLANVSSASTSIIWMGLNLSFLRFYYALKQRKDIISRNDSSYPYKSPFQPY 754

Query: 482 ISITGIWG-SLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGY 540
           ++I G+ G SL+  F     FI  FW            S +AFF +Y      +FF++ Y
Sbjct: 755 LAIYGLVGCSLFVIFMGYPNFIHHFW------------STKAFFSAYGGL---MFFFISY 799

Query: 541 MLYS-RDFTFLTDLKKIDLDNHRRLYD 566
             Y     + +  L ++D+D+ RR  D
Sbjct: 800 TAYKVLGTSKIQRLDQLDMDSGRREMD 826

>KLLA0B09922g complement(867748..870141) weakly similar to sp|Q03770
           Saccharomyces cerevisiae YDR160w SSY1 transcriptional
           regulator of several transporter genes P23.1.f18.1,
           hypothetical start
          Length = 797

 Score =  135 bits (341), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 142/577 (24%), Positives = 237/577 (41%), Gaps = 81/577 (14%)

Query: 72  QSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQ 131
           + + +L++ +K RH+ M+SLG  IG GL + + +   +AGP    IG+   + +    + 
Sbjct: 217 RHNTSLQRKLKIRHLQMISLGATIGVGLFLNSGRAFSIAGPMGAFIGFLYGALVILATLF 276

Query: 132 AAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWN- 190
           +  EM    P L  G +   S FV   FGF   W   + +    P ELI +++ I Y+  
Sbjct: 277 SFAEMVAFIP-LITGISGLCSRFVGDSFGFTVGWCHWLSYAVAFPSELIASAIMISYYTP 335

Query: 191 -DKINADXXXXXXXXXXXXXXXXG-----VRAYGEAEFIFNSCKILMIGGFVILSIVVNC 244
            +K+  D                G     VR Y E E+I +  K+ ++   ++L +++NC
Sbjct: 336 FEKVATDNLYLGLTVTILIIVLTGINLLDVRIYAELEYIMSVFKLAVVLFLLVLVLILNC 395

Query: 245 GGAGVDGYIGGKYW---RDP------GAF-----------ASDNAASRFKGVAFVLVT-- 282
           GG   +GY+G K+W   R P      G F            S      F GV    +T  
Sbjct: 396 GGFR-NGYLGFKFWTKDRSPSPDVTFGPFRPTFDLNDYGSGSKQGIGGFGGVLLSCITCS 454

Query: 283 --AYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFN-------- 332
             + FSY G E+  ++  E ENPR++ P+  K+                G          
Sbjct: 455 VSSIFSYIGSEIGFIAAPEAENPRKAVPSVTKRIFVRVVLFYLLSIFMVGTVIYAGDPRL 514

Query: 333 ---VPHNS--------------DQLMGAGGS-----------ATHASPYVLAVSIHGVKV 364
              +  NS              DQL G   +           +++ SP+V+A        
Sbjct: 515 LRIISDNSKVTDQNLEKFMLIIDQLGGMNCNTRLQNDNIFQESSNQSPWVIAFKAVKQCD 574

Query: 365 VPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIF 424
           + ++IN V +    S A+S LYAS R L S+A Q  AP  F +    G P  +++ C   
Sbjct: 575 LANVINGVFVCIGISAASSQLYASSRTLYSMATQNKAPSVFTWCTNGGVPYVSILFCGSL 634

Query: 425 GVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQ----GKSLNELG 480
           G ++      +         +I     +  W  + LS +RF +A+K +     ++  E  
Sbjct: 635 GFLSLLCFDLRSTEALLLFISIGITGSVVMWFGMNLSFLRFYMALKRRPDIIDRNSKEYP 694

Query: 481 YISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGY 540
           Y S        Y C F +      F + ++   +  V+    F  SYL   +++  Y GY
Sbjct: 695 YKSPF----QPYLCIFGMAS--TTFLLLMNGIQNFFVWKTANFISSYLIIVIFIVLYSGY 748

Query: 541 MLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEET 577
            +     + +  L++IDLD+ RR  D  L ++  + T
Sbjct: 749 NVVRT--STINRLEQIDLDSGRREMDRVLWKENADYT 783

>Scas_682.30
          Length = 845

 Score =  134 bits (336), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 127/568 (22%), Positives = 235/568 (41%), Gaps = 77/568 (13%)

Query: 77  LKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEM 136
           +++ ++ RH+ M+S+GT    G  + + +   +AGP   ++G+ +   I    + +  E+
Sbjct: 269 VQRKLRVRHIQMLSIGTCFSVGFFLTSGRAFSIAGPFGTLLGFALAGSIVLATLLSFTEL 328

Query: 137 AVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINAD 196
           +   P +  GF+  AS FV   FGF   W +    +   P E+ +++  + Y+   +N  
Sbjct: 329 STLIP-VSSGFSGLASRFVEDAFGFGLGWTYWFSCMIAFPSEVASSTFYLSYYQ-HLNLT 386

Query: 197 XXX-----XXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCG-GAGVD 250
                                 VR  GEA +I    KIL+    + + +++N G G  + 
Sbjct: 387 RGAIAGFVTLFSSYSIIINLLDVRILGEATYIIGLSKILITIVIIFVMVIINAGHGYKIH 446

Query: 251 GYIGGKYWR--------------------DPGAFASDN---AASRFKGVAFVLVTAYFSY 287
             +G ++W                     D G  +++    A  RF  V  V++ + F++
Sbjct: 447 NQVGFRFWDSSKSVGDLTYGLFRPTFDLGDVGRGSTNGIPGATGRFLAVILVMLISTFAF 506

Query: 288 GGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLM------ 341
            GVE+  ++  E  NPR++ P++ K++               G N+     +L+      
Sbjct: 507 SGVEMTFMASGEAINPRKTIPSSIKRTFSIVLTVYMLAIFAVGINIYSGDPRLLSYFAKY 566

Query: 342 ----------GAGG-----------------SATHA---SPYVLAVSIHGVKVVPHIINA 371
                     G G                  S +HA   SP+VLA+   G+      +N 
Sbjct: 567 SSERYTSTINGIGTDWQLSDRCKGVYTEREHSTSHAIYTSPWVLALQSFGLCTFASALNG 626

Query: 372 VILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCA 431
           +++   ++   S+LY S R + +++ Q  AP  F   ++ G P  A+I   +F +IA+ A
Sbjct: 627 ILIFFTSTAGVSSLYNSSRTIYAMSVQRKAPLIFQRCNKRGVPYVAVIFSGVFYIIAYLA 686

Query: 432 CSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQ----GKSLNELGYISITGI 487
            +      F  L  I+  S    WS + +S +RF  A+K +     ++     Y S    
Sbjct: 687 VNVGSSRNFDVLVNISSASTSIIWSGLNISFIRFYFALKQRKDLISRNDKTYPYKSPFQP 746

Query: 488 WGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDF 547
           + S YG  F  L+F+        P   KG +S  +FF +Y    ++   Y G+ +     
Sbjct: 747 YLSFYG-LFGCLIFVIFMGF---PNFIKGQWSTRSFFSAYGGLFLFAILYAGFKIIGT-- 800

Query: 548 TFLTDLKKIDLDNHRRLYDPELLRQEDE 575
           + +  L +ID+D  RR  D  +  +  E
Sbjct: 801 SKIQRLDQIDMDTGRREMDRIVWTEHSE 828

>AGL171W [4141] [Homologous to ScYDR160W (SSY1) - SH]
           complement(377256..379811) [2556 bp, 851 aa]
          Length = 851

 Score =  127 bits (318), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 127/555 (22%), Positives = 231/555 (41%), Gaps = 71/555 (12%)

Query: 76  NLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGE 135
           ++++ +K RH+ M+++G  IG GL + +     +AGP   ++G+ +   +    + +  E
Sbjct: 278 HIQRKLKVRHLQMIAIGASIGVGLFLTSGNAFAVAGPFGTLLGFSICGTVCLATMLSFTE 337

Query: 136 MAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWND---- 191
           ++   P +  GF+  AS FV   FGFA  W + + +    P ++I +   + Y+      
Sbjct: 338 LSTLIP-ISSGFSGLASRFVEDAFGFALGWSYWLSFTVTFPSQIIASVFMLSYYEKVVAT 396

Query: 192 KINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGA-GVD 250
           +I+                   VR + E  +I    K+L+    +IL + +N  G  G  
Sbjct: 397 RISTAGLVTVFWLYATAANLLDVRLFAEVNYISAFVKVLITILAMILMLFLNVRGVDGKS 456

Query: 251 GYIGGKYW--------------------RDPGAFASD---NAASRFKGVAFVLVTAYFSY 287
           G IG ++W                     D G  + +    A  RF  +  V++ + +S+
Sbjct: 457 GAIGFRFWNSSSSETELTYGLFRPTFDLHDTGQGSLNGIGGARGRFLAIILVVLISTYSF 516

Query: 288 GGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSA 347
            GVE+  ++  E  NPR++ P+A K++               G N+     +L+  G   
Sbjct: 517 NGVEMAFVASGEAINPRKTLPSATKRAFTKIVTLYILSITFVGLNMYSGDPRLLRYGVDV 576

Query: 348 T--------------------------------HASPYVLAVSIHGVKVVPHIINAVILI 375
                                            + SP++LA+   G+  +    N V++ 
Sbjct: 577 PTVVYRNTPGLQWQRDYSCMEQDIMQLHNMENGNRSPWILALQSFGLCSLASAFNGVLVF 636

Query: 376 SVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQ 435
              S A+S+L+AS R L S+A Q  APK F      G P  A++    FG+IA+ + ++ 
Sbjct: 637 FGISAASSSLFASSRTLYSMATQQKAPKLFQTCTSYGVPWIAILFSGSFGIIAYISVAES 696

Query: 436 EEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNE----LGYISITGIWGSL 491
               F  L++IA  +    W  + +S +RF  A+K +   ++       Y S    + S 
Sbjct: 697 SMANFQTLSSIASGTNAIIWLGLNVSFLRFYYALKRRPDIISRDDPTYPYRSPMQPFLSF 756

Query: 492 YGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLT 551
           YG   + LV I   +         G +S  +F  SY     ++  Y  Y L+    + + 
Sbjct: 757 YGLIGSGLVVIFMGFTNF----LHGFWSTRSFLSSYGGLIFFITSYFAYKLFGA--SKIQ 810

Query: 552 DLKKIDLDNHRRLYD 566
            L+++D+D  RR  D
Sbjct: 811 SLEQLDMDTGRREMD 825

>Kwal_27.11900
          Length = 726

 Score =  123 bits (308), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 119/508 (23%), Positives = 200/508 (39%), Gaps = 84/508 (16%)

Query: 70  SIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFV 129
           S+     +++ ++ RH+ M+SLG  IG GL + + K   +AGP   +IG+ +   +    
Sbjct: 225 SVPQQSTIQRKLRVRHLQMISLGATIGVGLFLNSGKAFSIAGPMGALIGFTIGGTLILAT 284

Query: 130 IQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYW 189
           + +  EM    P L  G +   S FV   FGF+  W   + +    P E+I +++ + Y+
Sbjct: 285 LFSFAEMVALIP-LITGISGLCSRFVGDAFGFSVGWCHWLSYAVGFPSEVIASTIMLSYY 343

Query: 190 N-------DKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVV 242
                   ++                     VR YGE E+  +  K+ ++   +IL IV+
Sbjct: 344 KNLEQIATNRYYTALTITGIVVGLTLINLMDVRIYGELEYCSSVFKLAIVVFLIILMIVM 403

Query: 243 NCGGAGVDGYIGGKYWR--------------------DPGAFASDNAASRFKGVAFVLV- 281
           N GG   D YIG +YW                     + G   S      F GV    + 
Sbjct: 404 NVGGLHND-YIGFRYWNRHKSPLEETTFGLFRPTFDMEDGGHGSRGGVPGFGGVLLSCIA 462

Query: 282 ---TAYFSYGGVELFALSVNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSD 338
               + F+Y G E+  ++  E +NPR++ P+  K+                G N+     
Sbjct: 463 STLVSVFAYVGSEIGFIAAGEAKNPRKAVPSVTKRIFTRVIMFYLLSIFVVGLNIYSGDP 522

Query: 339 QLM-----------------------GAGGSATH--------------ASPYVLAVSIHG 361
           +L+                         GGS                  SP+V+A+    
Sbjct: 523 RLLRYDAGSNIAVTDNDETGVQAIINALGGSNCQQSRTENIFLVDNPNQSPWVIAMQSLN 582

Query: 362 VKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILC 421
              +  +IN V +    S A+S LYAS R L S+A Q  AP  F +  + G P     +C
Sbjct: 583 QCTLSSVINGVFVSIGISAASSQLYASSRTLYSMATQQKAPALFTWCTKGGVPY----MC 638

Query: 422 SIFGVIAFCACS-----DQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQ---- 472
            +F  +           D  EV F ++ +I  +  +  W  + LS++RF  A+K +    
Sbjct: 639 VLFCGLLGFLSLLCLNMDSAEVFFIFV-SIGAMGSVIVWFGMNLSYLRFYYALKVRPDIL 697

Query: 473 GKSLNELGYISITGIWGSLYGCFFNVLV 500
            ++  E  Y S    + ++YG    VL+
Sbjct: 698 SRNAKEFPYRSPCQPYLAIYGMVLAVLL 725

>Scas_619.2*
          Length = 471

 Score =  113 bits (282), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 127/485 (26%), Positives = 214/485 (44%), Gaps = 42/485 (8%)

Query: 130 IQAAGEMAVTYPTLPGGFNNYA-------SIFVSKPFGFATVWLFCIQWLTVLPLELITA 182
           + A GEM V Y  LPG  ++ A         +V +  GFA+ W +   ++ ++  E   A
Sbjct: 1   MNAFGEM-VCY--LPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECTAA 57

Query: 183 SMTIKYWN--DKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSI 240
           +  ++YW    K+                    V  YGE+EF F S KIL I G +ILS 
Sbjct: 58  AGVVEYWAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIILSF 117

Query: 241 VVNCGGAGVDGYIGGKYWRDPGAFA---SDNAASRFKGVAFVLVTAYFSYG-GVELFALS 296
           ++  GG      +G +YW+ PGAFA   +D     F  V   ++   F++  G EL +L+
Sbjct: 118 ILFWGGGPSHDRLGFRYWQRPGAFADHITDGTGGNFLDVYTGVIKGGFAFVLGPELVSLT 177

Query: 297 VNEQENPRRSTPAAAKQSXXXXXXXXXXXXXXXGFNVPHNSDQLMGAGGSA---THASPY 353
            +E  + RR+   A+++                   V +N   L  A   +     +SP+
Sbjct: 178 SSECHDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSPF 237

Query: 354 VLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGR 413
           V+ +   G+KV+PHIIN  I+ S  S  N+ ++AS R L ++A  G+APK+F+ ++R   
Sbjct: 238 VIGIQNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRLRC 297

Query: 414 PLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQG 473
            +R   L  +  + +       +   F  +   + +S    W    ++++RFR A+    
Sbjct: 298 SIRGSWLFLLILLFSLLKRLLIDSKRFQLVFKHSTISGFIGWICACVAYIRFRKAIIFND 357

Query: 474 --KSLNELGYISITGIWGSLYGCFFNVL-----VFIAQFWVALSPPGSKGVYSAEAFFES 526
               L   G+     IW SL+      L     +FI +FW              + F  +
Sbjct: 358 LYDRLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFW------------DYKDFIAA 405

Query: 527 YLAFPVWLFFYLGYMLYSRDF-TFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGG 585
           Y+  PV++  ++G+ L +R +  +   + KID+     L + E L  E +E K    N  
Sbjct: 406 YITLPVFIVLWIGHKLVTRSWRQWYIPVDKIDV--FTGLEEIEELTNELDE-KRVPPNNA 462

Query: 586 WTQKL 590
           W + L
Sbjct: 463 WDKFL 467

>Scas_485.4*
          Length = 237

 Score =  105 bits (263), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 95/190 (50%), Gaps = 2/190 (1%)

Query: 75  DNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAG 134
           + +++ +K RH+ M++LG  IGTGL +  +  L  AGP   +I Y  ++ + Y V Q+ G
Sbjct: 15  ETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLG 74

Query: 135 EMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKIN 194
           EMA T+  +   F  ++  FVS  FG A  +++   W     LEL      I++W   + 
Sbjct: 75  EMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVP 133

Query: 195 ADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIG 254
                              V+ YGE EF     K++ I GF+I    + C GAGV G +G
Sbjct: 134 LAAWISIFWMLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVC-GAGVTGPVG 192

Query: 255 GKYWRDPGAF 264
            +YWR PGAF
Sbjct: 193 FRYWRHPGAF 202

>Scas_476.4
          Length = 237

 Score =  105 bits (263), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 95/190 (50%), Gaps = 2/190 (1%)

Query: 75  DNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAG 134
           + +++ +K RH+ M++LG  IGTGL +  +  L  AGP   +I Y  ++ + Y V Q+ G
Sbjct: 15  ETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLG 74

Query: 135 EMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKIN 194
           EMA T+  +   F  ++  FVS  FG A  +++   W     LEL      I++W   + 
Sbjct: 75  EMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVP 133

Query: 195 ADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIG 254
                              V+ YGE EF     K++ I GF+I    + C GAGV G +G
Sbjct: 134 LAAWISIFWMLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVC-GAGVTGPVG 192

Query: 255 GKYWRDPGAF 264
            +YWR PGAF
Sbjct: 193 FRYWRHPGAF 202

>Scas_642.22
          Length = 237

 Score =  103 bits (256), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 101/211 (47%), Gaps = 10/211 (4%)

Query: 54  RAEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPA 113
           + E+    +++E         + +++ +K RH+ M++LG  IGTGL +  +  L  AGP 
Sbjct: 2   KEEIREISVEVEA--------ETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPV 53

Query: 114 SLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLT 173
             +I Y  ++ + Y V Q+ GEMA T+  +   F  ++  FVS  FG A  +++   W  
Sbjct: 54  GALIAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCI 112

Query: 174 VLPLELITASMTIKYWNDKINADXXXXXXXXXXXXXXXXGVRAYGEAEFIFNSCKILMIG 233
              LEL      I++W   +                    V+ YGE EF     K++ I 
Sbjct: 113 TFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIM 172

Query: 234 GFVILSIVVNCGGAGVDGYIGGKYWRDPGAF 264
           GF+I    + C GAGV G +  +YWR PGAF
Sbjct: 173 GFLIYCFCMVC-GAGVTGPMSFRYWRHPGAF 202

>Scas_233.1
          Length = 141

 Score = 39.3 bits (90), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 10/95 (10%)

Query: 9   TSPEVNSITSSTLKTPNVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAEVNHNGIDLEDGT 68
           T   + S  + T+  P+ T   +P          T + +F DSFK+AE      +L +  
Sbjct: 55  TQENIQSSITHTISNPSFTSTTQP--------STTRWQKFKDSFKKAEDVELDPNLTEAE 106

Query: 69  NSIQSDDN--LKKAMKSRHVIMMSLGTGIGTGLLV 101
              Q+     L+  +K R   M+++G  IG+GL V
Sbjct: 107 RIAQATAKAPLQHTLKGRQQTMIAIGGAIGSGLFV 141

>CAGL0I08415g 820503..824429 some similarities with tr|Q06211
           Saccharomyces cerevisiae YPR164w KIM3 drug resistance,
           hypothetical start
          Length = 1308

 Score = 36.2 bits (82), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 62/142 (43%), Gaps = 14/142 (9%)

Query: 349 HASPYVLAVSIHGV------KVVPHIINAVILISVTSVANSAL---YASPRLLRSLAEQG 399
           H  PY+    I  +      K + + IN+  LI+   + +  L     S RLL+   +  
Sbjct: 266 HELPYLSGDVIQDIIPLSRSKCLMYTINSFFLINADQIMSGDLNFPRISKRLLKGTIDWF 325

Query: 400 YAPKYFNYV---DRE--GRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFT 454
            AP+   Y+   D+E  G    A+I+ +  G I     SD   + +  L    G+  L +
Sbjct: 326 NAPQLLEYLIAHDQEYYGEFSDAIIIGTAIGNIIALLVSDNGNIEYHTLTRFKGIKALCS 385

Query: 455 WSSILLSHVRFRLAMKAQGKSL 476
               L+S  +F+L + + GKS+
Sbjct: 386 ADQSLISDHKFKLLVLSFGKSI 407

>Sklu_2147.4 YKL174C, Contig c2147 6541-8247 reverse complement
          Length = 568

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 54/114 (47%), Gaps = 8/114 (7%)

Query: 63  DLEDGTNSI---QSDDNLKKAMKSRHVIMMSLGTGIGT---GLLVANAKGLYLAGPASLV 116
           D +DG   +   Q +  L K++ SR  ++  LG G+ +   G+    + GL   GP ++V
Sbjct: 35  DEDDGPEVVEQFQYEQKLDKSLLSRGSVI-GLGFGLMSPVLGMSTTMSIGLLNGGPLTIV 93

Query: 117 IGYFMVSFITYFVIQAAGEMAVTYPT-LPGGFNNYASIFVSKPFGFATVWLFCI 169
            G+ +V F T+    + GE+   +P  L GG    A+      F + T WL  +
Sbjct: 94  AGFMVVGFATWLCSLSLGEIVSKFPIELHGGSAMLAAKKHRLVFSWYTGWLMLL 147

>Scas_689.19
          Length = 612

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 50/118 (42%), Gaps = 11/118 (9%)

Query: 34  PDTTAVKHRT-------HFNRFVDSFKRAEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHV 86
           PD   + H         H + F D+        +  D  +     + +  L K++ SR  
Sbjct: 2   PDYRLLSHSIRENMPTFHPDEFFDNIHTIIHEESDTDEVESVEHFKYNQELDKSLLSRSS 61

Query: 87  IMMSLGTGIGT---GLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYP 141
           ++  LG G+ +   G+  + A GL   GPA+++ G+ +     +F   + GE+   +P
Sbjct: 62  VV-GLGFGLMSPVLGMSTSMAIGLINGGPATILWGFIISGICIWFCSLSLGEVVSKFP 118

>CAGL0H03399g complement(316110..317780) highly similar to sp|P19807
           Saccharomyces cerevisiae YGL077c HNM1 choline permease,
           hypothetical start
          Length = 556

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 42/93 (45%), Gaps = 9/93 (9%)

Query: 60  NGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGT-----GLLVANAKGLYLAGPAS 114
           NG  + +   SI  + +L+K+     +    LG G G      G+  +   G+   GP  
Sbjct: 27  NGKKIIEQEQSIDGEVHLRKSFSLWSI----LGVGFGLTNSWFGISASMVTGINSGGPMM 82

Query: 115 LVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGF 147
           +V G  +++ I+  +  + GE++  YP   G F
Sbjct: 83  IVYGIIIIALISVCIGVSLGELSSAYPHAGGQF 115

>YGL077C (HNM1) [1905] chr7 complement(362226..363917) Choline
           permease, member of the amino acid permease family of
           membrane transporters [1692 bp, 563 aa]
          Length = 563

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 42/99 (42%), Gaps = 7/99 (7%)

Query: 54  RAEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGT-----GLLVANAKGLY 108
           R E     +D  D   ++ +D  +   ++    +   LG G G      G+  +   G+ 
Sbjct: 29  RVEEEIKPLDDMDSKGAVAADGEVH--LRKSFSLWSILGVGFGLTNSWFGISTSMVAGIS 86

Query: 109 LAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGF 147
             GP  +V G  +V+ I+  +  + GE++  YP   G F
Sbjct: 87  SGGPMMIVYGIIIVALISICIGTSLGELSSAYPHAGGQF 125

>Scas_720.18
          Length = 569

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/103 (20%), Positives = 47/103 (45%), Gaps = 9/103 (8%)

Query: 50  DSFKRAEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGT-----GLLVANA 104
           D+F + +++    +L+   N+   + +L+K+     +    LG G G      G+  +  
Sbjct: 28  DTFDKNKLSTKTQELDGDANNNNGEVHLRKSFSVWSI----LGVGFGLTNSWFGISASMV 83

Query: 105 KGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGF 147
            G+   GP  +V G  +++ ++  +  +  E++  YP   G F
Sbjct: 84  TGISSGGPMMVVYGIIIIALVSICIGTSLSELSSAYPHAGGQF 126

>Scas_622.10
          Length = 562

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 39/191 (20%), Positives = 71/191 (37%), Gaps = 24/191 (12%)

Query: 246 GAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRR 305
           G G DG I    W  P     D        +A  L++++F + G +      +E +NP R
Sbjct: 248 GNGPDGVIEPVAWNAPLTHFQDQTVLSLSSIASALISSFFCFSGWDSVHAVASEIKNPTR 307

Query: 306 STPAAAKQSXXXX----XXXXXXXXXXXGFNVPHNSDQLMGAGGSATHASPYVLAVSIHG 361
           +   A   S                    +     +  L+G+          VL   I G
Sbjct: 308 TLKIAGPFSLIICLVCYVMMNMAYLKILTYEEIKQAGPLIGS----------VLFSKIFG 357

Query: 362 VKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGR------PL 415
            K+   +++  I +S  S     +Y + R+ + +  +GY P    + D+  R      PL
Sbjct: 358 AKIGSKLVSMSIALSAVSNIMVVVYGTSRMNQEIFREGYFP----FSDKLVRNWPHDAPL 413

Query: 416 RALILCSIFGV 426
            A+++C +  +
Sbjct: 414 PAILVCGLLTI 424

>CAGL0M08272g complement(823019..824884) highly similar to sp|P36029
           Saccharomyces cerevisiae YKL174c, start by similarity
          Length = 621

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 38/70 (54%), Gaps = 4/70 (5%)

Query: 75  DNLKKAMKSRHVIMMSLGTGIGT---GLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQ 131
             L K++ SR+ ++  LG G+ +   G+  +   G+   GP S+++G+F+   + +F   
Sbjct: 55  QELDKSLLSRNSVI-GLGFGLMSPVLGMCTSMGIGMLNGGPLSIMLGFFISGILIWFSSL 113

Query: 132 AAGEMAVTYP 141
           + GE+   +P
Sbjct: 114 SLGEIVSKFP 123

>Scas_710.30
          Length = 584

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 525 ESYLAFPVWLFFYLGYMLYSRDFTFLTDLK 554
           E+YL+ PVWL F L Y+  S  + ++ D K
Sbjct: 203 ETYLSIPVWLMFILLYISSSDKYHYIDDFK 232

>YKL174C (YKL174C) [3097] chr11 complement(120385..122241) Member of
           the amino acid permease family of membrane transporters
           [1857 bp, 618 aa]
          Length = 618

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 4/71 (5%)

Query: 74  DDNLKKAMKSRHVIMMSLGTGIGT---GLLVANAKGLYLAGPASLVIGYFMVSFITYFVI 130
           D  L K++ SR  I+  LG G+ +   G+  + A GL   GP ++++G+ +     +F  
Sbjct: 48  DQVLDKSLLSRGSIV-GLGLGLMSPVLGMCTSMAIGLINGGPLTIMLGFLISGVCIWFSS 106

Query: 131 QAAGEMAVTYP 141
            + GE+   +P
Sbjct: 107 LSLGEIVSKFP 117

>AFL081W [3112] [Homologous to ScYGL077C (HNM1) - SH]
           complement(286339..287967) [1629 bp, 542 aa]
          Length = 542

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 46/109 (42%), Gaps = 13/109 (11%)

Query: 50  DSFKRAEVNHNGIDLEDGTNS------IQSDDNLKKAMKSRHVIMMSLGTGIGT-----G 98
           DS    + + +G   EDG  S       Q D+   + ++    +   LG G G      G
Sbjct: 7   DSMDLVKRHPSGQCCEDGEKSNVGMTTCQVDEG--QLLRKSFSLWSVLGVGFGLTNSWFG 64

Query: 99  LLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGF 147
           + V+   G+   GP  +V G  +++ ++  V  +  E++  YP   G F
Sbjct: 65  ISVSMITGIGSGGPMMIVYGIVIIALVSVCVGVSLAELSSAYPHAGGQF 113

>ABL003C [589] [Homologous to ScYGR055W (MUP1) - SH]
           (390867..392552) [1686 bp, 561 aa]
          Length = 561

 Score = 30.0 bits (66), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 49/127 (38%), Gaps = 7/127 (5%)

Query: 43  THFNRFVDSFKRAEV-----NHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGT 97
           T F++     KR EV     N +  D+E G + I   D   K +     I +     +GT
Sbjct: 5   TIFSQLKIRKKRQEVAFFESNADANDVEAGEHFITELDKGDKRLGLFSSIGLICNRMLGT 64

Query: 98  GLLVANAKGLYLAGPASLVIGYFMV-SFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVS 156
           G+ V  AK   L G     +G +++ + I    +    E     P   GG  NY      
Sbjct: 65  GIFVVPAKIFQLTGSVYFALGLWVLGALIALAGLYVYMEFGTAIPR-NGGEKNYLEFIFK 123

Query: 157 KPFGFAT 163
           KP  F T
Sbjct: 124 KPKFFIT 130

>YMR081C (ISF1) [4040] chr13 complement(430078..431094) Protein that
           participates with Nam7p/Upf1p in suppression of
           mitochondrial splicing defect [1017 bp, 338 aa]
          Length = 338

 Score = 29.6 bits (65), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 12/53 (22%), Positives = 25/53 (47%)

Query: 341 MGAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLR 393
             AG ++ H   + +   +  +K  PH +   +  + T+ +N  +  SPR +R
Sbjct: 64  TNAGNTSRHIGNHTIGHHLRKIKTAPHHLYGFVPANSTNNSNEPIRPSPRRIR 116

>Scas_429.2
          Length = 183

 Score = 28.9 bits (63), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 54/139 (38%), Gaps = 7/139 (5%)

Query: 43  THFNRFVDSFKRAEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIG-TGLL- 100
           +H           EVN+         N + ++   K+ +K +       G      GLL 
Sbjct: 39  SHIRSIRSKTGAGEVNYINSATSVTDNQLLAEIGYKQELKRQFSTFQVFGIAFSIMGLLP 98

Query: 101 -VANAKGLYLAG-PASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKP 158
            +A+  G  ++G P + V G+F+ S  T F+  +  E A   PT  GG   Y   +   P
Sbjct: 99  SIASVMGTGISGGPTTFVWGWFIASIFTIFIGISMAENASAIPT-AGGL--YYWTYYYAP 155

Query: 159 FGFATVWLFCIQWLTVLPL 177
            GF  V  F I     L L
Sbjct: 156 EGFKKVISFVIGCSNSLAL 174

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.137    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,039,099
Number of extensions: 727955
Number of successful extensions: 2654
Number of sequences better than 10.0: 134
Number of HSP's gapped: 2223
Number of HSP's successfully gapped: 144
Length of query: 595
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 488
Effective length of database: 12,891,983
Effective search space: 6291287704
Effective search space used: 6291287704
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)