Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_718.4161461427080.0
YBR069C (TAT1)61956016990.0
AGR040C57354614790.0
YDR508C (GNP1)66355512601e-166
CAGL0B01012g62358312481e-165
Kwal_33.1320460753012401e-164
CAGL0K05753g66049912421e-163
YBR068C (BAP2)60954612191e-161
AGR039C58652911871e-156
Kwal_33.1321559856411871e-156
YCL025C (AGP1)59549311821e-155
AGR038C58054411761e-154
YDR046C (BAP3)60457411751e-154
AFR698C60952711671e-153
Scas_569.559355811561e-151
Scas_718.4259556711421e-149
KLLA0C01606g62055411251e-146
Scas_517.267957211261e-146
CAGL0H08393g61252111201e-146
CAGL0L07546g63456610881e-141
Kwal_27.1053860256810831e-140
Sklu_2029.259849310281e-132
ADL272W56450710171e-131
Sklu_2390.16055039451e-120
KLLA0F01012g5565199401e-119
CAGL0B03773g6054989231e-116
Kwal_27.126815935599181e-116
Scas_507.15925409111e-115
YKR039W (GAP1)6025479121e-115
KLLA0A06886g5875539051e-114
YGR191W (HIP1)6035589051e-114
Kwal_33.154075874948811e-110
Kwal_33.142765965668801e-110
Scas_479.15955478681e-108
AGR319W6264968681e-108
Scas_607.45995178631e-108
KLLA0A11770g5815098541e-106
AFR230C6045768391e-104
AEL030W7395698441e-103
KLLA0A06930g5875468291e-103
CAGL0D02178g5775368281e-103
CAGL0L03267g5975688271e-102
YOL020W (TAT2)5925168231e-102
KLLA0A10813g5845717522e-91
Kwal_34.162544814697362e-90
Kwal_56.229515965457183e-86
YLL061W (MMP1)5835597051e-84
KLLA0B06776g5885536902e-82
YPL274W (SAM3)5875426641e-78
AER405C4974776241e-73
Scas_520.2*3723505485e-64
Scas_536.13723365372e-62
AFR667C5635565484e-62
Scas_706.375445235395e-61
Scas_706.36d6075725383e-60
CAGL0J08162g5974965347e-60
YNL268W (LYP1)6115515358e-60
Kwal_33.134115605025274e-59
Kwal_33.134015595075222e-58
YEL063C (CAN1)5905665207e-58
KLLA0C02343g5815415153e-57
CAGL0J08184g5725145135e-57
KLLA0E16335g6055055121e-56
YNL270C (ALP1)5735545022e-55
CAGL0A01199g6135124962e-54
YOR348C (PUT4)6275264893e-53
KLLA0C02365g5795024863e-53
AFR668W5564944853e-53
YPL265W (DIP5)6085154733e-51
Scas_486.25974994682e-50
YFL055W (AGP3)5585224521e-48
Scas_377.24904714411e-47
ACL135W5885174433e-47
Kwal_33.155455765044328e-46
KLLA0F27093g5635114222e-44
Kwal_26.69405705144124e-43
Sklu_2438.145585364081e-42
Kwal_26.96125434864053e-42
Kwal_23.28175805044021e-41
CAGL0E05632g5984993975e-41
KLLA0F23419g5735193889e-40
AFR156W5585143816e-39
Scas_552.35584933763e-38
KLLA0B14685g5715403721e-37
Scas_84.12132063384e-36
Scas_377.11481193316e-36
Kwal_8.5906295373553e-35
CAGL0M00154g5505033401e-33
Kwal_26.80975444963242e-31
KLLA0C15873g5685042852e-26
Scas_485.4*2372062683e-26
Scas_476.42372062683e-26
Scas_642.222372062603e-25
Kwal_23.40265345502701e-24
Scas_460.35845682639e-24
AAR038W5665162611e-23
Kwal_23.38475795212593e-23
YBR132C (AGP2)5964812381e-20
Sklu_2365.98052682311e-19
CAGL0C00539g5724592202e-18
Kwal_27.119007262722168e-18
KLLA0B09922g7972722151e-17
Scas_619.2*4714221952e-15
AGL171W8513281882e-14
KLLA0D16830g8323081845e-14
CAGL0E01089g8532761774e-13
YDR160W (SSY1)8522681676e-12
Scas_682.308453681462e-09
Kwal_53.194615652581381e-08
Scas_233.1141103750.19
Sklu_2346.430476750.39
Kwal_47.1783745431750.57
CAGL0M08272g62187693.3
Scas_689.1961296674.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_718.41
         (614 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_718.41                                                          1047   0.0  
YBR069C (TAT1) [259] chr2 complement(376534..378393) Amino acid ...   659   0.0  
AGR040C [4350] [Homologous to ScYBR069C (TAT1) - SH] (782289..78...   574   0.0  
YDR508C (GNP1) [1322] chr4 complement(1466441..1468432) High aff...   489   e-166
CAGL0B01012g 91330..93201 similar to sp|P25376 Saccharomyces cer...   485   e-165
Kwal_33.13204                                                         482   e-164
CAGL0K05753g 564282..566264 highly similar to sp|P48813 Saccharo...   483   e-163
YBR068C (BAP2) [258] chr2 complement(373821..375650) Branched-ch...   474   e-161
AGR039C [4349] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C (...   461   e-156
Kwal_33.13215                                                         461   e-156
YCL025C (AGP1) [519] chr3 complement(76131..77918) Broad substra...   459   e-155
AGR038C [4348] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C (...   457   e-154
YDR046C (BAP3) [899] chr4 complement(548758..550572) Branched ch...   457   e-154
AFR698C [3891] [Homologous to ScYDR508C (GNP1) - SH; ScYCL025C (...   454   e-153
Scas_569.5                                                            449   e-151
Scas_718.42                                                           444   e-149
KLLA0C01606g complement(123485..125347) similar to sp|P48813 Sac...   437   e-146
Scas_517.2                                                            438   e-146
CAGL0H08393g 821998..823836 highly similar to sp|P41815 Saccharo...   436   e-146
CAGL0L07546g complement(831824..833728) highly similar to sp|P38...   423   e-141
Kwal_27.10538                                                         421   e-140
Sklu_2029.2 , Contig c2029 2095-3891                                  400   e-132
ADL272W [1469] [Homologous to ScYDR508C (GNP1) - NSH] complement...   396   e-131
Sklu_2390.1 YGR191W, Contig c2390 5453-7270 reverse complement        368   e-120
KLLA0F01012g complement(90772..92442) similar to sp|P48813 Sacch...   366   e-119
CAGL0B03773g 373956..375773 highly similar to sp|P06775 Saccharo...   360   e-116
Kwal_27.12681                                                         358   e-116
Scas_507.1                                                            355   e-115
YKR039W (GAP1) [3292] chr11 (514705..516513) General amino acid ...   355   e-115
KLLA0A06886g complement(621646..623409) similar to sp|P19145 Sac...   353   e-114
YGR191W (HIP1) [2141] chr7 (880423..882234) Histidine permease, ...   353   e-114
Kwal_33.15407                                                         343   e-110
Kwal_33.14276                                                         343   e-110
Scas_479.1                                                            338   e-108
AGR319W [4630] [Homologous to ScYGR191W (HIP1) - SH] complement(...   338   e-108
Scas_607.4                                                            337   e-108
KLLA0A11770g 1014918..1016663 similar to sp|P06775 Saccharomyces...   333   e-106
AFR230C [3422] [Homologous to ScYKR039W (GAP1) - NSH] (855416..8...   327   e-104
AEL030W [2476] [Homologous to ScYOL020W (TAT2) - SH] complement(...   329   e-103
KLLA0A06930g complement(625498..627261) similar to sp|P19145 Sac...   323   e-103
CAGL0D02178g 222597..224330 highly similar to sp|P38967 Saccharo...   323   e-103
CAGL0L03267g 372787..374580 highly similar to sp|P19145 Saccharo...   323   e-102
YOL020W (TAT2) [4796] chr15 (286172..287950) High affinity trypt...   321   e-102
KLLA0A10813g complement(936126..937880) similar to sp|P38967 Sac...   294   2e-91
Kwal_34.16254                                                         288   2e-90
Kwal_56.22951                                                         281   3e-86
YLL061W (MMP1) [3363] chr12 (17956..19707) High affinity S-methy...   276   1e-84
KLLA0B06776g 594172..595938 similar to sgd|S0006195 Saccharomyce...   270   2e-82
YPL274W (SAM3) [5177] chr16 (22938..24701) High affinity S-adeno...   260   1e-78
AER405C [2905] [Homologous to ScYPL274W (SAM3) - NSH] (1413790.....   244   1e-73
Scas_520.2*                                                           215   5e-64
Scas_536.1                                                            211   2e-62
AFR667C [3860] [Homologous to ScYNL268W (LYP1) - SH] (1657064..1...   215   4e-62
Scas_706.37                                                           212   5e-61
Scas_706.36d                                                          211   3e-60
CAGL0J08162g complement(801555..803348) Highly similar to sp|P32...   210   7e-60
YNL268W (LYP1) [4340] chr14 (138549..140384) High affinity lysin...   210   8e-60
Kwal_33.13411                                                         207   4e-59
Kwal_33.13401                                                         205   2e-58
YEL063C (CAN1) [1365] chr5 complement(31694..33466) Permease for...   204   7e-58
KLLA0C02343g complement(203552..205297) similar to sp|P04817 Sac...   202   3e-57
CAGL0J08184g 804507..806225 similar to sp|P04817 Saccharomyces c...   202   5e-57
KLLA0E16335g 1455271..1457088 gi|28565044|gb|AAO32605.1 Kluyvero...   201   1e-56
YNL270C (ALP1) [4339] chr14 complement(135939..137660) Arginine ...   197   2e-55
CAGL0A01199g 121067..122908 similar to sp|P53388 Saccharomyces c...   195   2e-54
YOR348C (PUT4) [5125] chr15 complement(986894..988777) High affi...   192   3e-53
KLLA0C02365g 208462..210201 similar to sp|P32487 Saccharomyces c...   191   3e-53
AFR668W [3861] [Homologous to ScYEL063C (CAN1) - SH; ScYNL270C (...   191   3e-53
YPL265W (DIP5) [5186] chr16 (41043..42869) Dicarboxylic amino ac...   186   3e-51
Scas_486.2                                                            184   2e-50
YFL055W (AGP3) [1629] chr6 (17004..18680) Amino acid permease fo...   178   1e-48
Scas_377.2                                                            174   1e-47
ACL135W [914] [Homologous to ScYPL265W (DIP5) - NSH] complement(...   175   3e-47
Kwal_33.15545                                                         171   8e-46
KLLA0F27093g 2501049..2502740 similar to sp|P43548 Saccharomyces...   167   2e-44
Kwal_26.6940                                                          163   4e-43
Sklu_2438.14 YOR348C, Contig c2438 29357-31033                        161   1e-42
Kwal_26.9612                                                          160   3e-42
Kwal_23.2817                                                          159   1e-41
CAGL0E05632g complement(556619..558415) similar to sp|P15380 Sac...   157   5e-41
KLLA0F23419g complement(2187386..2189107) similar to sp|P15380 S...   154   9e-40
AFR156W [3348] [Homologous to ScYOR348C (PUT4) - NSH] complement...   151   6e-39
Scas_552.3                                                            149   3e-38
KLLA0B14685g complement(1289025..1290740) similar to sp|P15380 S...   147   1e-37
Scas_84.1                                                             134   4e-36
Scas_377.1                                                            132   6e-36
Kwal_8.590                                                            141   3e-35
CAGL0M00154g 22039..23691 similar to sp|P32487 Saccharomyces cer...   135   1e-33
Kwal_26.8097                                                          129   2e-31
KLLA0C15873g 1381699..1383405 similar to sp|P38090 Saccharomyces...   114   2e-26
Scas_485.4*                                                           107   3e-26
Scas_476.4                                                            107   3e-26
Scas_642.22                                                           104   3e-25
Kwal_23.4026                                                          108   1e-24
Scas_460.3                                                            105   9e-24
AAR038W [224] [Homologous to ScYBR132C (AGP2) - SH] complement(4...   105   1e-23
Kwal_23.3847                                                          104   3e-23
YBR132C (AGP2) [319] chr2 complement(499608..501398) Plasma memb...    96   1e-20
Sklu_2365.9 YDR160W, Contig c2365 13522-15939                          94   1e-19
CAGL0C00539g 57784..59502 highly similar to sp|P38090 Saccharomy...    89   2e-18
Kwal_27.11900                                                          88   8e-18
KLLA0B09922g complement(867748..870141) weakly similar to sp|Q03...    87   1e-17
Scas_619.2*                                                            80   2e-15
AGL171W [4141] [Homologous to ScYDR160W (SSY1) - SH] complement(...    77   2e-14
KLLA0D16830g 1426856..1429354 similar to sp|Q03770 Saccharomyces...    75   5e-14
CAGL0E01089g complement(96582..99143) similar to sp|Q03770 Sacch...    73   4e-13
YDR160W (SSY1) [1002] chr4 (776157..778715) Component of an extr...    69   6e-12
Scas_682.30                                                            61   2e-09
Kwal_53.19461                                                          58   1e-08
Scas_233.1                                                             33   0.19 
Sklu_2346.4 YOL065C, Contig c2346 7444-8354 reverse complement         33   0.39 
Kwal_47.17837                                                          33   0.57 
CAGL0M08272g complement(823019..824884) highly similar to sp|P36...    31   3.3  
Scas_689.19                                                            30   4.7  

>Scas_718.41
          Length = 614

 Score = 1047 bits (2708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/614 (85%), Positives = 524/614 (85%)

Query: 1   MYLSRTPFCRKAHSLTLRLFGKGCAELDMSSIQGEPSMVSIEIESTKKREIEVSEKPIAS 60
           MYLSRTPFCRKAHSLTLRLFGKGCAELDMSSIQGEPSMVSIEIESTKKREIEVSEKPIAS
Sbjct: 1   MYLSRTPFCRKAHSLTLRLFGKGCAELDMSSIQGEPSMVSIEIESTKKREIEVSEKPIAS 60

Query: 61  ADTTVSTSKCNAKTYFQDFCHSFKRKDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIA 120
           ADTTVSTSKCNAKTYFQDFCHSFKRKDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIA
Sbjct: 61  ADTTVSTSKCNAKTYFQDFCHSFKRKDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIA 120

Query: 121 TGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILID 180
           TGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILID
Sbjct: 121 TGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILID 180

Query: 181 PSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDVNPDXXXXXXXXXXXXXNLFGARGY 240
           PSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDVNPD             NLFGARGY
Sbjct: 181 PSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDVNPDIFVLCVFIVVIIVNLFGARGY 240

Query: 241 AETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAHGFKGVCTVFTY 300
           AETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAHGFKGVCTVFTY
Sbjct: 241 AETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAHGFKGVCTVFTY 300

Query: 301 AAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXX 360
           AAFSYGGIEVVVLSIDEQEDPVSAVPNACKK                CFLVPYD      
Sbjct: 301 AAFSYGGIEVVVLSIDEQEDPVSAVPNACKKVVYRILLIYLLTTILVCFLVPYDSPNLLG 360

Query: 361 XXXXXXXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXP 420
                     FVIAIESHGVKVVPHFINAVILI                          P
Sbjct: 361 SSHSGSHASPFVIAIESHGVKVVPHFINAVILISVISVANSSLYSSSRLLLSLSEQGSLP 420

Query: 421 QWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSH 480
           QWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSH
Sbjct: 421 QWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSH 480

Query: 481 IRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVN 540
           IRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVN
Sbjct: 481 IRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVN 540

Query: 541 FFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRRIYSATAVXXXXXXXXXDDX 600
           FFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRRIYSATAV         DD 
Sbjct: 541 FFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRRIYSATAVEEQEQEQEEDDI 600

Query: 601 XXXXXXXXXRDEGK 614
                    RDEGK
Sbjct: 601 QSIQTSIISRDEGK 614

>YBR069C (TAT1) [259] chr2 complement(376534..378393) Amino acid
           permease that transports valine, leucine, isoleucine,
           tyrosine, tryptophan, and threonine, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1860 bp, 619 aa]
          Length = 619

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/560 (58%), Positives = 394/560 (70%), Gaps = 7/560 (1%)

Query: 47  KKREIEVSEKPIASADTTVSTSKCNAKTYFQ----DFCHSFKRK-DSDLDSDVEAQD-TQ 100
           +KR+  ++EK    +  T    + ++K+  Q    +F  SFKR+   D +S++E+Q+   
Sbjct: 30  QKRDFTITEKQDEVSGQTAEPRRTDSKSILQRKCKEFFDSFKRQLPPDRNSELESQEKNN 89

Query: 101 LSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGEL 160
           L+K+IKSRHL+MISLGTGI TGLLVGNGQVL  AGPAGL++GY ++SIM+YCII AAGEL
Sbjct: 90  LTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQAAGEL 149

Query: 161 GICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDVNPDX 220
           G+CY GL GN+TRYPSIL+DPSLGFA+S++YT+QWLTVLPLQLVTAA+T+ +WT VN D 
Sbjct: 150 GLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTSVNADI 209

Query: 221 XXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKY 280
                       NLFG+RGYAE EF  N CKILM+ GF+IL+I+I  GGAG   YIGA+Y
Sbjct: 210 FVAVVFVFVIIINLFGSRGYAEAEFIFNSCKILMVIGFVILAIIINCGGAGDRRYIGAEY 269

Query: 281 WIHPGPFAHGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXX 340
           W +PGPFAHGFKGVCTVF YAAFSYGGIEV++LS  EQE+P  ++PNACKK         
Sbjct: 270 WHNPGPFAHGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNACKKVVYRILLIY 329

Query: 341 XXXXXXXCFLVPYDXXXXX-XXXXXXXXXXXFVIAIESHGVKVVPHFINAVILIXXXXXX 399
                  CFLVPY+                 FVIA+ SHGVKVVPHFINAVILI      
Sbjct: 330 MLTTILVCFLVPYNSDELLGSSDSSGSHASPFVIAVASHGVKVVPHFINAVILISVISVA 389

Query: 400 XXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFT 459
                               P+ L ++D NGRP+ CF +S++FG IGFVA SD  E VFT
Sbjct: 390 NSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFFVSLVFGCIGFVATSDAEEQVFT 449

Query: 460 WLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSL 519
           WLLAIS LSQLFIWMSMSLSHIR RDAM  QG+S++E+GYKAQTGYWGSWLAV I  F L
Sbjct: 450 WLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQTGYWGSWLAVLIAIFFL 509

Query: 520 VTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSH 579
           V QFWVAIAPV +HG+L+V  FFQNYLA PIVL AY GHKIY+K+W  WIPA+KIDLDSH
Sbjct: 510 VCQFWVAIAPVNEHGKLNVKVFFQNYLAMPIVLFAYFGHKIYFKSWSFWIPAEKIDLDSH 569

Query: 580 RRIYSATAVXXXXXXXXXDD 599
           R I+ + ++         DD
Sbjct: 570 RNIFVSPSLTEIDKVDDNDD 589

>AGR040C [4350] [Homologous to ScYBR069C (TAT1) - SH]
           (782289..784010) [1722 bp, 573 aa]
          Length = 573

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/546 (52%), Positives = 365/546 (66%), Gaps = 13/546 (2%)

Query: 42  EIESTKKREIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKR-KDSDLDSDVEAQD-- 98
            I S+KK E  V   P      TV +         + F  SF+R +D DL    +A+D  
Sbjct: 7   SISSSKKDESYVKVSP-----NTVGSGDERRTGIMRGFIDSFRRGRDVDLMCKADAEDGT 61

Query: 99  -TQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAA 157
             ++ KTIK+RHLLMI+LGTGI TGLLVGNG  LAKAGPAGLI+GY VSS M+Y I+ AA
Sbjct: 62  TAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVEAA 121

Query: 158 GELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDVN 217
           GELGICY G+ GN+T Y S+L+DP++GF++S +Y +QW+TV PLQLVTAA+ I +WTD+N
Sbjct: 122 GELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWTDIN 181

Query: 218 PDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIG 277
           PD             NLFGA+GYAE EFF N CK+LMI GF+IL +VI  GGAG  GYIG
Sbjct: 182 PDIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSGYIG 241

Query: 278 AKYWIHPGPFAHGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXX 337
            KYW  P PF +GFKG+C VF YAAF+YGGIEV+VLS  EQE+P  ++ +ACKK      
Sbjct: 242 DKYWHEPRPFMNGFKGLCFVFCYAAFAYGGIEVMVLSASEQENPRKSISSACKKVIYRIV 301

Query: 338 XXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKVVPHFINAVILIXXXX 397
                     CFLVP D                 VIA+  HGVK+VPH INAVILI    
Sbjct: 302 LIYLLTTVIVCFLVPAD---HPSLASEGSRASPLVIAVSFHGVKIVPHIINAVILIAVVS 358

Query: 398 XXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDV 457
                                 P+   +ID  GRP+  F ++++FG++ F+AAS  ++DV
Sbjct: 359 VGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGLLAFLAASPAQDDV 418

Query: 458 FTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFF 517
           F WLLAISGLSQ+FIWMS+ +SHIR RDAMK+QG+S+ E+GYKA+TGYWGSW+AV   F 
Sbjct: 419 FGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKARTGYWGSWIAVVTAFL 478

Query: 518 SLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLD 577
            L+ QFWVAI+PVE  G +D  +FFQ+YLAFPI+L+AY G+KIY+K+WR+ IPA ++DL 
Sbjct: 479 ILIAQFWVAISPVETKG-VDARSFFQSYLAFPILLLAYFGYKIYHKDWRICIPASEVDLI 537

Query: 578 SHRRIY 583
           SHR+++
Sbjct: 538 SHRQVF 543

>YDR508C (GNP1) [1322] chr4 complement(1466441..1468432) High
           affinity glutamine permease, may also transports
           leucine, cysteine, methionine, serine, threonine and
           asparagine, member of the amino acid-polyamine-choline
           (APC) family of membrane transporters [1992 bp, 663 aa]
          Length = 663

 Score =  489 bits (1260), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 255/555 (45%), Positives = 331/555 (59%), Gaps = 16/555 (2%)

Query: 43  IESTKKREIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKDSDLDSD--------V 94
           I+S ++ E   +  P +S   +  T+  + K       +   RK S +  D         
Sbjct: 81  IDSFRRAEGSHANSPDSS--NSNGTTPISTKDSSSQLDNELNRKSSYITVDGIKQSPQEQ 138

Query: 95  EAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCII 154
           E +   L K+IK RH +M+SLGTGI TGLLVGN +VL  AGP GLIIGY +    +YCII
Sbjct: 139 EQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCII 198

Query: 155 HAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWT 214
            A GEL + Y  L+G F  YP  L+DP+LGF+++ L+ LQWL V PL+LVTA++TI +WT
Sbjct: 199 QACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWT 258

Query: 215 -DVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKD 273
             VNPD             N+FGA+GYAE +FF NCCKILMI GF IL+I+I  GGAG D
Sbjct: 259 TSVNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTD 318

Query: 274 GYIGAKYWIHPGPFA-----HGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNA 328
           GYIG+KYW  PG F        FKGV   F  AAF++G  E + ++  EQ +P  A+P+A
Sbjct: 319 GYIGSKYWRDPGAFRGDTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSA 378

Query: 329 CKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKVVPHFIN 388
            KK                 FLVPY                 +VIA+ SHGV+VVPHFIN
Sbjct: 379 AKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFIN 438

Query: 389 AVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFV 448
           AVIL+                          P+  ++ID  GRP    ++S LFG+I F 
Sbjct: 439 AVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVIAFC 498

Query: 449 AASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGS 508
           A+S K EDVFTWLLAISGLSQLF W+++ LSHIR R AMK QG+SL E+GYK+Q G WGS
Sbjct: 499 ASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGS 558

Query: 509 WLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLW 568
             AV +   +L+ QFWVAIAP+   G+L   +FF+NYLA PI +  Y+ +K++ K+W L+
Sbjct: 559 AYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKVWKKDWSLF 618

Query: 569 IPADKIDLDSHRRIY 583
           IPADK+DL SHR I+
Sbjct: 619 IPADKVDLVSHRNIF 633

>CAGL0B01012g 91330..93201 similar to sp|P25376 Saccharomyces
           cerevisiae YCL025c AGP1 Asparagine/glutamine permease or
           sp|P48813 Saccharomyces cerevisiae YDR508c GNP1,
           hypothetical start
          Length = 623

 Score =  485 bits (1248), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 259/583 (44%), Positives = 337/583 (57%), Gaps = 49/583 (8%)

Query: 42  EIESTKKREIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKR---------------- 85
           E+E    RE+ V+ +  A+ +T        A + F+ F  SFKR                
Sbjct: 19  EVEYMSPREVSVTPETSATPNTP-------APSQFRRFVDSFKRAEQQNNSEITSAASCD 71

Query: 86  -------KDSDLDSDVEAQDTQ------------LSKTIKSRHLLMISLGTGIATGLLVG 126
                  KD    +D+E Q+ Q            L +TIK RH+++ISLGTGI TGLLVG
Sbjct: 72  GSSENLDKDGKEVADLEVQENQVLTEKSNQKNKELKQTIKPRHVILISLGTGIGTGLLVG 131

Query: 127 NGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFA 186
           N + L  AGPAGL+IGY++    +YCII AAGEL + Y  L G F  YPS L+DP+ GF+
Sbjct: 132 NAKALHNAGPAGLLIGYSIMGTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPAFGFS 191

Query: 187 ISLLYTLQWLTVLPLQLVTAAITISFW-TDVNPDXXXXXXXXXXXXXNLFGARGYAETEF 245
           ++ +Y +QWL V PL+LVTA++TI +W T VN D             N FGARGYAE EF
Sbjct: 192 VAWVYCIQWLCVCPLELVTASMTIKYWTTTVNADIFVGIFYVLIIVINTFGARGYAEAEF 251

Query: 246 FCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFA-----HGFKGVCTVFTY 300
           F NCCKILM+ GF IL IVI TGGAG DGYIG +YW  PG FA       FKG+      
Sbjct: 252 FFNCCKILMMIGFFILGIVINTGGAGNDGYIGDRYWHTPGAFAGDRPIDHFKGIMATMVT 311

Query: 301 AAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXX 360
           AAF++G  E + L+  EQ +P  A+P+A KK                 FLVPYD      
Sbjct: 312 AAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLMG 371

Query: 361 XXXXXXXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXP 420
                     +V+A+ +HGVKVVPHFINAVIL+                          P
Sbjct: 372 SGGSATKASPYVLAVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAP 431

Query: 421 QWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSH 480
           ++ +++D  GRP R  + + +F +I F AAS K E VFTWLLAISGLSQ+F W ++ LSH
Sbjct: 432 KFFDYVDREGRPFRAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSH 491

Query: 481 IRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVN 540
           IR R AM  Q +SL EIG+KAQTG WGS+   F+    L+ QFWVAIAP+   G+LD   
Sbjct: 492 IRFRKAMFVQKRSLGEIGFKAQTGVWGSYYVCFMLVMILIAQFWVAIAPI-GEGKLDAQG 550

Query: 541 FFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRRIY 583
           FF+NYLA PI+++ Y+G+KI+ K+W L+I A+ IDLD HR+I+
Sbjct: 551 FFENYLAMPILILFYVGYKIWKKDWSLFIRANNIDLDKHRQIF 593

>Kwal_33.13204
          Length = 607

 Score =  482 bits (1240), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 254/530 (47%), Positives = 331/530 (62%), Gaps = 18/530 (3%)

Query: 71  NAKTYFQDFCHSFKRKDSDLD----SDVE-------AQDTQLSKTIKSRHLLMISLGTGI 119
           ++K+ F+ F  +F R D   D    +DVE         +T+L +TI  RH+ M+SLGTGI
Sbjct: 49  DSKSRFRRFARTFHRADGLGDGASGNDVEFGAEVARQTETKLKQTITFRHVFMMSLGTGI 108

Query: 120 ATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILI 179
            TG+LVGNG+ L   GPAGL+IGY +    +YCII AAGEL + Y  L GNF  YPS+LI
Sbjct: 109 GTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCIIQAAGELAVSYSSLSGNFNAYPSMLI 168

Query: 180 DPSLGFAISLLYTLQWLTVLPLQLVTAAITISFW-TDVNPDXXXXXXXXXXXXXNLFGAR 238
           + + GF+++ +Y LQWL VLPL+LVTA+ITI +W T VNPD             N+FGAR
Sbjct: 169 EQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWTTSVNPDIFVAIFYVLIILVNMFGAR 228

Query: 239 GYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPF-----AHGFKG 293
           GYAE EFF NCCK+LMI GF IL I++  GGAG DGYIG +YW +PG F      H FKG
Sbjct: 229 GYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAGNDGYIGGRYWNNPGAFYGTKPIHHFKG 288

Query: 294 VCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPY 353
           + +    AAF++G  E + L+  EQ +P  A+P+A KK                 FLVP+
Sbjct: 289 IISTMVTAAFAFGATEFIALTAAEQANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPH 348

Query: 354 DXXXXXXXXXXXXXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXX 413
           +                +VIA+ SHGV+VVPHFINAVIL+                    
Sbjct: 349 NSPELMGSGSSATHASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLAL 408

Query: 414 XXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIW 473
                 P WL FID +GRP+R  ++S +FG+I FVAAS K E VFTWLLAISGLSQLF W
Sbjct: 409 ADQHYAPAWLKFIDRSGRPMRAMLVSCVFGLISFVAASPKEETVFTWLLAISGLSQLFTW 468

Query: 474 MSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKH 533
           +S+ +SHIR R A+  QGK + E+GYK+QTG  GS+ A FI    L+ QFWVAIAP+   
Sbjct: 469 ISICVSHIRFRKALIVQGKPIGELGYKSQTGVAGSYYATFIMGCILIGQFWVAIAPMGS- 527

Query: 534 GELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRRIY 583
            +LD  +FF+NYLA P+ +V Y G KI+ ++WRL+IP ++IDLDSHR+ +
Sbjct: 528 AKLDANSFFENYLALPLFVVLYFGFKIWKRDWRLYIPLEQIDLDSHRKTF 577

>CAGL0K05753g 564282..566264 highly similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1, start by
           similarity
          Length = 660

 Score =  483 bits (1242), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 239/499 (47%), Positives = 312/499 (62%), Gaps = 6/499 (1%)

Query: 91  DSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMI 150
           +  ++ ++  L K+IK RH++MISLGTGI TGLLVGN + L  AGPAGL+IGY +    I
Sbjct: 132 NGQMKFEEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCI 191

Query: 151 YCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITI 210
           YCII AAGE+ + Y  L+G F  YPS+L+DP  GFA++ +Y LQWL V PL+LVT ++TI
Sbjct: 192 YCIIQAAGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTI 251

Query: 211 SFWTD-VNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGG 269
            +WT  VNPD              +FGARGYAE EFF NCCKILMI GF IL I+I  GG
Sbjct: 252 KYWTTTVNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGG 311

Query: 270 AGKDGYIGAKYWIHPGPFA-----HGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSA 324
           AG DGY+GAKYW  PG F        FKG+   F  AAF++G  E + L+  EQ +P  A
Sbjct: 312 AGNDGYLGAKYWHDPGAFRGTNGIQRFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKA 371

Query: 325 VPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKVVP 384
           +P+A KK                 FLVP+D                +V+AI  HGV+VVP
Sbjct: 372 IPSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATKASPYVLAISIHGVRVVP 431

Query: 385 HFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGM 444
           HFINAVILI                          P++ +++D  GRP R    + LFG+
Sbjct: 432 HFINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGV 491

Query: 445 IGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTG 504
           I F AAS K + VFTWLLAISGLSQLF W+++ +SHIR R AM  QG+SL EIG+KAQ G
Sbjct: 492 IAFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLG 551

Query: 505 YWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKN 564
            +GS+ A  +   +L+ QFWVAIAP+  +G+LD   FF+NYLA PI++  Y G+K++ ++
Sbjct: 552 VYGSYYATIMMVLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRD 611

Query: 565 WRLWIPADKIDLDSHRRIY 583
           WRL+I A  IDLDS+R+++
Sbjct: 612 WRLFIRAKDIDLDSYRQVF 630

>YBR068C (BAP2) [258] chr2 complement(373821..375650) Branched-chain
           amino acid permease, also transports alanine and
           aromatic and sulfur containing amino acids [1830 bp, 609
           aa]
          Length = 609

 Score =  474 bits (1219), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 254/546 (46%), Positives = 317/546 (58%), Gaps = 21/546 (3%)

Query: 59  ASADTTVSTSKCNAKTYFQDFCHSFKRKD-------------SDLDSDVEA--QDTQLSK 103
           +S++ T S  K  +      F  SFKR +             SDL+  VE+   D++L K
Sbjct: 34  SSSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKK 93

Query: 104 TIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGIC 163
           ++KSRH++M+SLGTGI TGLLV N + L   GPA LIIGY + S   Y +I AAGE+ + 
Sbjct: 94  SMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVT 153

Query: 164 YRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTD-VNPDXXX 222
           Y  L  NF  Y SI I  S GFA   LY  QWLTVLPL+L+TA++TI F  D +NPD   
Sbjct: 154 YPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYI 213

Query: 223 XXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWI 282
                     + FG + Y ETEF  NCCKILMI GFIILSIVI  GGAG DGYIGA YW 
Sbjct: 214 LIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWH 273

Query: 283 HPGPFAHG-----FKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXX 337
           +PG FA       FK VC +   A FS+GG+E+  LS+ EQ +P  + P A K+      
Sbjct: 274 NPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIV 333

Query: 338 XXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKVVPHFINAVILIXXXX 397
                      F VPY+                +V+A   HGVK+VPH INAVILI    
Sbjct: 334 VIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVS 393

Query: 398 XXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDV 457
                                 P++L+++D  GRP+R  I+  +FG+I FVAAS K E V
Sbjct: 394 VANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIV 453

Query: 458 FTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFF 517
           FTWL AI+GLS+LF W S+ LSH+R R AMK QG+SLDE+GYKA TG WGS   VF    
Sbjct: 454 FTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNIL 513

Query: 518 SLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLD 577
             V QFWVA+AP+   G+ D  +FFQNYLAFPI L  Y G+ +Y +++ L  P DKIDLD
Sbjct: 514 VFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLD 573

Query: 578 SHRRIY 583
            HRRIY
Sbjct: 574 FHRRIY 579

>AGR039C [4349] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C
           (BAP2) - SH] (779726..781486) [1761 bp, 586 aa]
          Length = 586

 Score =  461 bits (1187), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 239/529 (45%), Positives = 321/529 (60%), Gaps = 20/529 (3%)

Query: 71  NAKTYFQDFCHSFKRKDSDLDSDVEAQDTQ---------LSKTIKSRHLLMISLGTGIAT 121
           NA T F D   SFKR   D   D+E +D           L   IK+RHL MISLGTGI T
Sbjct: 32  NAWTRFTD---SFKRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHLTMISLGTGIGT 88

Query: 122 GLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDP 181
           GLLV +G+ L   GPAGL+IGY  +S M+YC++ A  ELG+ Y  L GN+  YP+ L+D 
Sbjct: 89  GLLVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDK 148

Query: 182 SLGFAISLLYTLQWLTVLPLQLVTAAITISFWTD-VNPDXXXXXXXXXXXXXNLFGARGY 240
             GFA++L+Y LQW TVLPL+LVTA++T+ +WT  VNPD             + FG+RGY
Sbjct: 149 GFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGY 208

Query: 241 AETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFA-----HGFKGVC 295
           AE EF  N  K+L++ GFII++I + T GA + GYIG +YW  PG F        FKG+C
Sbjct: 209 AEAEFIFNSLKVLLMAGFIIMAISL-TAGASEQGYIGGQYWHDPGAFGGDRAIDRFKGIC 267

Query: 296 TVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDX 355
           +V+  AAF+YGG E + L+  EQ +P  +VP A K+                 FLVP++ 
Sbjct: 268 SVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNS 327

Query: 356 XXXXXXXXXXXXXXX-FVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXX 414
                           FVIA   HGV+VVPH IN +IL                      
Sbjct: 328 DQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLA 387

Query: 415 XXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWM 474
                P+   ++D  GRP+   I   LFG+I FVAAS++ E+VFTWL AI+GLSQLF W 
Sbjct: 388 EHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWT 447

Query: 475 SMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHG 534
           ++++SH+R R AM+ QG+SL E+GY+A TG  GS+ A+F     L+ QFW+AIAP+ KHG
Sbjct: 448 AIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHG 507

Query: 535 ELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRRIY 583
           ELDV  FFQNYLAFP+++V YLG+K++ +++RL IP+ ++DL SHR+I+
Sbjct: 508 ELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIF 556

>Kwal_33.13215
          Length = 598

 Score =  461 bits (1187), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 250/564 (44%), Positives = 334/564 (59%), Gaps = 31/564 (5%)

Query: 43  IESTKKREIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKDSDLDS---------- 92
           +ES    E+   E P          S   +   F+ F  SF+R ++              
Sbjct: 17  VESFDSVEVLKEESP---------RSDSRSDGLFRRFADSFRRHEAHNGGGGDGDDEDHE 67

Query: 93  -----DVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSS 147
                +  ++   L + I+ RH+LMISL TGI TG+LVGNG+ L   GPA L+IGY + S
Sbjct: 68  GLTPIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVS 127

Query: 148 IMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAA 207
            M+YC+I +A EL I Y  L G F  YPS+L+D + GF++S +Y LQWL VLPL+LVTA+
Sbjct: 128 SMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTAS 187

Query: 208 ITISFWTD-VNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVII 266
           +TI +W   +NPD             N  GA GYAE EFF NCCK+LMI GF IL I+I 
Sbjct: 188 MTIKYWNQTINPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIIN 247

Query: 267 TGGAGKDGYIGAKYWIHPGPFA-----HGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDP 321
            GGAG DGY+GA+YW  PG F      + FKG+  V   AAF+YGG E  VL+  EQ++P
Sbjct: 248 CGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307

Query: 322 VSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVK 381
             ++ +A KK                 FLVP++                FVIA+ SHGV+
Sbjct: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVR 367

Query: 382 VVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISIL 441
           VVPHFINAVIL+                          P++LN++D  GRP+ C ++S +
Sbjct: 368 VVPHFINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVSCV 427

Query: 442 FGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKA 501
           FG++ FVAAS K E VFTWLLAISGLS+LF W S+SLSH+RLR AM  QG+S DE+GY A
Sbjct: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487

Query: 502 QTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIY 561
            TG WG++ A+ +    LV QFWVAI+PV  + +LD  NFF+NYLA PI++  YLG+KI+
Sbjct: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSN-KLDANNFFENYLAMPILIFLYLGYKIW 546

Query: 562 YKNWRLWIPADKIDLDSHRRIYSA 585
            ++WRL IP+ ++DL +HR+I+ A
Sbjct: 547 TRDWRLLIPSSEVDLVAHRKIFDA 570

>YCL025C (AGP1) [519] chr3 complement(76131..77918) Broad substrate
           range amino acid permease with high affinity for
           asparagine and glutamine [1788 bp, 595 aa]
          Length = 595

 Score =  459 bits (1182), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 235/493 (47%), Positives = 304/493 (61%), Gaps = 8/493 (1%)

Query: 84  KRKDSD-LDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIG 142
           K + SD + ++   +   L KTI+ RH+LMI+LGTGI TGLLVGNG  L  AGPAGL+IG
Sbjct: 98  KNESSDNIGANTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIG 157

Query: 143 YTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQ 202
           Y +   ++YCII A GE+ + Y  L G +  YPS L+D   GFA++ +Y LQWL V PL+
Sbjct: 158 YAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLE 217

Query: 203 LVTAAITISFW-TDVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIIL 261
           LVTA++TI +W T VNPD             N+FGARGYAE EFF NCCKILM+TGF IL
Sbjct: 218 LVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFIL 277

Query: 262 SIVIITGGAGKDGYIGAKYWIHPGPF--AHG---FKGVCTVFTYAAFSYGGIEVVVLSID 316
            I+I  GGAG DG+IG KYW  PG F   H    FKGV      AAF++GG E + ++  
Sbjct: 278 GIIIDVGGAGNDGFIGGKYWHDPGAFNGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTA 337

Query: 317 EQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIE 376
           EQ +P  A+P A K+                 FLVPY+                +VIA+ 
Sbjct: 338 EQSNPRKAIPGAAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVA 397

Query: 377 SHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCF 436
           SHGV+VVPHFINAVIL+                          P+  ++ID  GRP+   
Sbjct: 398 SHGVRVVPHFINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAM 457

Query: 437 IISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDE 496
            +S LF +I F AAS K E VFTWLLAISGLSQLF W ++ LSH+R R AMK QG+SL E
Sbjct: 458 GVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGE 517

Query: 497 IGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYL 556
           +G+K+QTG WGS  A  +    L+ QFWVAIAP+ + G+LD   FF+NYLA PI++  Y+
Sbjct: 518 LGFKSQTGVWGSAYACIMMILILIAQFWVAIAPIGE-GKLDAQAFFENYLAMPILIALYV 576

Query: 557 GHKIYYKNWRLWI 569
           G+K+++K+W+L+I
Sbjct: 577 GYKVWHKDWKLFI 589

>AGR038C [4348] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C
           (BAP2) - SH] (777535..779277) [1743 bp, 580 aa]
          Length = 580

 Score =  457 bits (1176), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 234/544 (43%), Positives = 319/544 (58%), Gaps = 13/544 (2%)

Query: 52  EVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKDSDLDSDVE------AQDTQLSKTI 105
           + +EK +     + S +   +   F+ F  SF+R+D+    D+E         T+L + +
Sbjct: 8   KFNEKTVVQTAYSPSYASPESTGPFRRFVDSFRREDTSRSGDLEDGEINSTDTTKLQQRM 67

Query: 106 KSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYR 165
           ++RH++M+SLGTGI TGLLV N   L   GPAGL+IGY + SI+ Y ++HAAGE+ + Y 
Sbjct: 68  RTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYP 127

Query: 166 GLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFW-TDVNPDXXXXX 224
            L GNF  Y SI I    GFA   L+ LQWLTV PL+L+TA I I +W   VN +     
Sbjct: 128 TLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVI 187

Query: 225 XXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHP 284
                   + FGARGY ETEF  N CK+LMI GF+I+ I+I  G  G  GYIG +YW +P
Sbjct: 188 FYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNP 247

Query: 285 GPFAHG-----FKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXX 339
           G F  G      KG   V   A FS+GG+E+  LS++E  +P +A+P+ACKK        
Sbjct: 248 GSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLV 307

Query: 340 XXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKVVPHFINAVILIXXXXXX 399
                    FLVP+D                +V+AIE HGVKV+PH +NAVILI      
Sbjct: 308 YLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVG 367

Query: 400 XXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFT 459
                               P+ L++ID  GRP+   I+  +FG+I F AASD +E +F 
Sbjct: 368 NSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFI 427

Query: 460 WLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSL 519
           WL AI+GLS+LF W S+ LSH R R AMK QG+SL+ +GY+A TG WGS  AVF      
Sbjct: 428 WLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVF 487

Query: 520 VTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSH 579
           + QFWVA+ P+ K  ++DV++FFQNY+AFP+ L+ +LG+ +Y +NW L  P DK+DLD+H
Sbjct: 488 IAQFWVALVPIAKK-KVDVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTH 546

Query: 580 RRIY 583
           RR+Y
Sbjct: 547 RRVY 550

>YDR046C (BAP3) [899] chr4 complement(548758..550572) Branched chain
           amino acid permease, also transports threonine, alanine
           and aromatic and sulfur containing amino acids [1815 bp,
           604 aa]
          Length = 604

 Score =  457 bits (1175), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 240/574 (41%), Positives = 331/574 (57%), Gaps = 27/574 (4%)

Query: 35  EPSMVSIEIESTKKREIEVSEKPIASADTTVST----------SKCNAKTYFQDFCHSFK 84
           +P + S ++E  K  E EV++  + +   T +T          S+ +       F  SF+
Sbjct: 3   DPIVTSSKME--KSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFR 60

Query: 85  RKDS---DLDSDVE------AQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAG 135
           R +S   + D+D+E        +  L K++KSRH++M+SLGTGI TGLLV N + L+ AG
Sbjct: 61  RAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAG 120

Query: 136 PAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQW 195
           P  L+IGY + S + Y ++ AAGE+G+ Y  L GNF  Y SI I  S GFA + L+ +QW
Sbjct: 121 PGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQW 180

Query: 196 LTVLPLQLVTAAITISFWTD-VNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILM 254
           LTVLPL+L+T+++T+ +W D +N D             + FG + Y ETEF  N CKILM
Sbjct: 181 LTVLPLELITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILM 240

Query: 255 ITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAHG-----FKGVCTVFTYAAFSYGGIE 309
           + GFIILS+VI  GGAG DGYIG KYW  PG FA G     FKG+C +   A FS+GGIE
Sbjct: 241 VAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIE 300

Query: 310 VVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXX 369
           + VLSI+EQ +P  + P A K+                 F VP++               
Sbjct: 301 LFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHAS 360

Query: 370 XFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMN 429
            +V+A   H V+V+PH INAVILI                          P++LN+ID  
Sbjct: 361 PYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDRE 420

Query: 430 GRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKS 489
           GRP+R  ++  L G++GFVA S + E  FTWL AI+GLS+LF W  + LSHIR R AMK 
Sbjct: 421 GRPLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKV 480

Query: 490 QGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFP 549
           QG+SLDE+GYKA TG WGS+  VF      + QFWVA++P+   G+ D   FF++YLA P
Sbjct: 481 QGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAP 540

Query: 550 IVLVAYLGHKIYYKNWRLWIPADKIDLDSHRRIY 583
           + +  Y+G+ +Y +++    P DKIDLD HRR+Y
Sbjct: 541 LWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVY 574

>AFR698C [3891] [Homologous to ScYDR508C (GNP1) - SH; ScYCL025C
           (AGP1) - SH] (1725946..1727775) [1830 bp, 609 aa]
          Length = 609

 Score =  454 bits (1167), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 249/527 (47%), Positives = 306/527 (58%), Gaps = 17/527 (3%)

Query: 74  TYFQDFCHSFKRKDSDLDSDV------EAQDTQLSKTIKSRHLLMISLGTGIATGLLVGN 127
           T F+ F  SFKR      +D        A+   L +TIKSRH++MISLGTGI TGLLVG+
Sbjct: 57  TRFKRFLSSFKRAHGSGGTDTEGGGGQNAKHENLKQTIKSRHMIMISLGTGIGTGLLVGS 116

Query: 128 GQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAI 187
           G  L   GPAG  IG+ +  + +YC+I AAGEL +CY  L G F  YPS LIDP+LGFA 
Sbjct: 117 GTALHDGGPAGSAIGFLIMGLCVYCVIQAAGELAVCYTSLAGGFNAYPSFLIDPALGFAT 176

Query: 188 SLLYTLQWLTVLPLQLVTAAITISFW---TDVNPDXXXXXXXXXXXXXNLFGARGYAETE 244
           + +Y LQWL V PL+LVTA+ITI FW     VNPD             N FGARGYAE E
Sbjct: 177 AWVYCLQWLCVFPLELVTASITIKFWPGSRSVNPDIYVAIFYVLIIVINFFGARGYAEAE 236

Query: 245 FFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGP------FAHGFKGVCTVF 298
           FF N CK+LM+ GF I+ I+I TG  G  GYIG KYW  PG       F H FKG+    
Sbjct: 237 FFFNSCKVLMMIGFFIVGILINTGAVGTSGYIGGKYWRDPGSLGGRTHFDH-FKGIVATL 295

Query: 299 TYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXX 358
             AAFS G  E V L+  EQ +P  ++P A KK                 FLVP D    
Sbjct: 296 VNAAFSLGCSEFVALTAAEQANPRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHEL 355

Query: 359 XXXXXXXXXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXX 418
                       +VIA+  HGV VVP FINAVIL+                         
Sbjct: 356 MGSNDSDLHVSPYVIAVRMHGVNVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNY 415

Query: 419 XPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSL 478
            P+   +ID  GRP+   IISILFG I FVAAS K E+VF WLLAISGLSQLF W ++ L
Sbjct: 416 APKIFKYIDRAGRPLMAMIISILFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICL 475

Query: 479 SHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDV 538
           SHIR R A+  QG S DE+G+KAQTG  GS+++  +   +L+ QFWV++ P+    E D 
Sbjct: 476 SHIRFRRALAVQGYSTDELGFKAQTGIIGSYVSAIMMVLALIGQFWVSLVPMGAT-EPDA 534

Query: 539 VNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRRIYSA 585
            +FF  YLA P+ L+ Y G+KI+ K+WRL+I AD+IDL SHRRI+ A
Sbjct: 535 ESFFTGYLAMPMFLLFYFGYKIWNKDWRLFIRADQIDLVSHRRIFDA 581

>Scas_569.5
          Length = 593

 Score =  449 bits (1156), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 233/558 (41%), Positives = 316/558 (56%), Gaps = 17/558 (3%)

Query: 43  IESTKKREIEVSE-----KPIASADTTVSTSKCNAKTYFQDFCHSFKRKDSDLDSDVE-- 95
           I+  K++ ++ S        + S    +  ++ +       F  SFKR     ++D+E  
Sbjct: 6   IQPNKEKTVDYSSTEYLPNELESPSFNLDATEESRSGLVHRFVDSFKRAQDSTENDLEDG 65

Query: 96  ----AQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIY 151
                  + L K +KSRH++M+ +GTGI TGLLV N   L+  GP  L+IGY + S + Y
Sbjct: 66  TKPLGDASHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTY 125

Query: 152 CIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITIS 211
            +I AAGE+ + Y  L GNF  Y S+ I    GFA   L+ +QWLTV PL+L+TA++TI 
Sbjct: 126 FMIQAAGEMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIK 185

Query: 212 FWTD-VNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGA 270
           +W D +N D             + FG + Y E EF  N CK+LMI GFIILSIVI  GGA
Sbjct: 186 YWNDKINADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGA 245

Query: 271 GKDGYIGAKYWIHPGPFAHG-----FKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAV 325
           GKDGYIGAKYW  PG FA G     FKG+C +   A FSYGG E+  LS++EQE+P  + 
Sbjct: 246 GKDGYIGAKYWRDPGSFAEGDSVEKFKGICYILVTAYFSYGGAELFSLSVNEQENPRKST 305

Query: 326 PNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKVVPH 385
           P A K+                 F VP++                +V+A   HGVKVVPH
Sbjct: 306 PQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHGVKVVPH 365

Query: 386 FINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMI 445
           FINAVILI                          P++L+++D  GRP+R  I+  +FG+I
Sbjct: 366 FINAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVI 425

Query: 446 GFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGY 505
           GFV+AS K E+VFTWL AI+GLS+LF W  + LSH+R R  MK  G+S +EIG++A TG 
Sbjct: 426 GFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGI 485

Query: 506 WGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNW 565
           WGS   +       + QFWVA+AP   HG++D  +FFQ+YLA PI L  Y G+ +Y +++
Sbjct: 486 WGSMYGISFNMLVFIAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLFFYFGYMLYKRDF 545

Query: 566 RLWIPADKIDLDSHRRIY 583
              +P DKIDL+ HRRIY
Sbjct: 546 TFLVPLDKIDLNFHRRIY 563

>Scas_718.42
          Length = 595

 Score =  444 bits (1142), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 242/567 (42%), Positives = 318/567 (56%), Gaps = 17/567 (2%)

Query: 30  SSIQGEPSMVSIEIESTKKREIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKDSD 89
           SS + E S     I S+  +   V+EK     DTT        +T+F  F  SFKR + +
Sbjct: 3   SSKKNETSPEVNSITSSTLKTPNVTEKFEPYPDTTA----VKHRTHFNRFVDSFKRAEVN 58

Query: 90  LDS-DVE------AQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIG 142
            +  D+E        D  L K +KSRH++M+SLGTGI TGLLV N + L  AGPA L+IG
Sbjct: 59  HNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIG 118

Query: 143 YTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQ 202
           Y + S + Y +I AAGE+ + Y  L G F  Y SI +    GFA   L+ +QWLTVLPL+
Sbjct: 119 YFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLE 178

Query: 203 LVTAAITISFWTD-VNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIIL 261
           L+TA++TI +W D +N D             + FG R Y E EF  N CKILMI GF+IL
Sbjct: 179 LITASMTIKYWNDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVIL 238

Query: 262 SIVIITGGAGKDGYIGAKYWIHPGPFAHG-----FKGVCTVFTYAAFSYGGIEVVVLSID 316
           SIV+  GGAG DGYIG KYW  PG FA       FKGV  V   A FSYGG+E+  LS++
Sbjct: 239 SIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSVN 298

Query: 317 EQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIE 376
           EQE+P  + P A K+                 F VP++                +V+A+ 
Sbjct: 299 EQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHASPYVLAVS 358

Query: 377 SHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCF 436
            HGVKVVPH INAVILI                          P++ N++D  GRP+R  
Sbjct: 359 IHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRAL 418

Query: 437 IISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDE 496
           I+  +FG+I F A SD+ E +FTWL AI+GLS+LF W S+ LSH+R R AMK+QGKSL+E
Sbjct: 419 ILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNE 478

Query: 497 IGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYL 556
           +GY + TG WGS    F      + QFWVA++P    G      FF++YLAFP+ L  YL
Sbjct: 479 LGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYL 538

Query: 557 GHKIYYKNWRLWIPADKIDLDSHRRIY 583
           G+ +Y +++       KIDLD+HRR+Y
Sbjct: 539 GYMLYSRDFTFLTDLKKIDLDNHRRLY 565

>KLLA0C01606g complement(123485..125347) similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1 high-affinity
           glutamine permease, start by similarity
          Length = 620

 Score =  437 bits (1125), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 232/554 (41%), Positives = 310/554 (55%), Gaps = 24/554 (4%)

Query: 50  EIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKDS-----DLDSDVEAQDTQ---- 100
           E E  EK  + +D   +       + +  F  SFKR D        ++++E   +Q    
Sbjct: 41  EAEYYEKTFSQSDEEYAAKS----SVWHRFKDSFKRADHINTNIHGNAELELNPSQSLLP 96

Query: 101 -----LSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIH 155
                L + IK RH++M+SL TGI TGLLVGNG+ LA  GPAGL IGY +    +Y II 
Sbjct: 97  EKGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQ 156

Query: 156 AAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFW-T 214
           AAGEL + Y  L GNF  YPS L+DP++ FA + LY +QWL V PL++++AAITI +W T
Sbjct: 157 AAGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNT 216

Query: 215 DVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDG 274
            +NP+             N+ G+ GYAE +FF N CKILM  GF IL I+I  GGAG   
Sbjct: 217 SINPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSV 276

Query: 275 YIGAKYWIHPGPFA-----HGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNAC 329
           YIG KYW  PG F        FK + +    AAF++G  E V L+  EQ +P  A+P+A 
Sbjct: 277 YIGGKYWNDPGAFNGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAIPSAA 336

Query: 330 KKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKVVPHFINA 389
           K+                 FLVPY+                +VIA+ SHGVKVVP FINA
Sbjct: 337 KQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVPSFINA 396

Query: 390 VILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVA 449
           VILI                          P++  ++D  GRP+   I+  L G I FV+
Sbjct: 397 VILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCICFVS 456

Query: 450 ASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSW 509
           AS   E VFTWL+A+SGLSQLF W ++ +SH+R R AM+ Q +S+ E+G+++Q G WGS+
Sbjct: 457 ASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGVWGSY 516

Query: 510 LAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWI 569
             +F+     + QFWVA+ PV      D  NFF NYLA P+ L  Y G KI+ K+WRL+I
Sbjct: 517 YGIFMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFKIWKKDWRLYI 576

Query: 570 PADKIDLDSHRRIY 583
           PA +IDL SHR+I+
Sbjct: 577 PASEIDLISHRKIF 590

>Scas_517.2
          Length = 679

 Score =  438 bits (1126), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 242/572 (42%), Positives = 323/572 (56%), Gaps = 25/572 (4%)

Query: 28  DMSSIQGEPSMVSIEIESTKKREIEVSEKPIASADTTVSTSKCNAKT-------YFQDFC 80
           D      +PS +   ++S K+ E    + P     T V+ +  N+++       Y +D  
Sbjct: 87  DFEEHTTKPSRIRNFMDSFKRAE----QHP-----TNVNNNGANSESDLENMILYNEDGT 137

Query: 81  HSFKRKDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLI 140
                   D   +  ++  +L KTIK RH+LMISLGTGI TGLLVG G  L +AGPAGLI
Sbjct: 138 PKPLPHHHDAQINDNSKSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLI 197

Query: 141 IGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLP 200
           IG+ +    +YCII A GEL + Y  LVG F  YPS L+D +  FA++ LY +QWL V P
Sbjct: 198 IGFGIMGSCLYCIIQAVGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCP 257

Query: 201 LQLVTAAITISFW-TDVNPDXXXXXXXXXXXXXNLF-GARGYAETEFFCNCCKILMITGF 258
           L+LVTA++TI +W T V+PD             NL  GA GYAE EF  N CKI+M+ GF
Sbjct: 258 LELVTASMTIKYWTTKVDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGF 317

Query: 259 IILSIVIITGGAGKDGYIGAKYWIHPGPFA-----HGFKGVCTVFTYAAFSYGGIEVVVL 313
            IL I +I GGAG DGYIGAKYW  PG          FKG       AAF++G  E + +
Sbjct: 318 FILGITVICGGAGTDGYIGAKYWHDPGALRGDTSIQRFKGCMATLVNAAFAFGMSEFIGV 377

Query: 314 SIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVI 373
           +  EQ +P  A+P+A KK                 FLVPY+                +V+
Sbjct: 378 TASEQSNPRKAIPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVL 437

Query: 374 AIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPI 433
           AI +HGV+VVPHFINAVILI                          P+  ++ID  GRP+
Sbjct: 438 AISTHGVRVVPHFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPL 497

Query: 434 RCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKS 493
                + +FG+I F A S K ++VF WLLAISGLSQLF WM++ +SHIR R AM  QG+S
Sbjct: 498 VGMATAAIFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRS 557

Query: 494 LDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHG--ELDVVNFFQNYLAFPIV 551
           + E+G+++Q G++GS  A  + F  L+ QFWVA+ P+      +LD  NFF+NYLA PI+
Sbjct: 558 IGELGFRSQVGWYGSAYAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPIL 617

Query: 552 LVAYLGHKIYYKNWRLWIPADKIDLDSHRRIY 583
           L  Y G+KI+ K+W+L+I A  IDL SHR I+
Sbjct: 618 LAFYFGYKIWKKDWKLFIRAKNIDLISHRNIF 649

>CAGL0H08393g 821998..823836 highly similar to sp|P41815
           Saccharomyces cerevisiae YDR046c PAP1, hypothetical
           start
          Length = 612

 Score =  436 bits (1120), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 230/521 (44%), Positives = 304/521 (58%), Gaps = 13/521 (2%)

Query: 75  YFQDFCHSFKRKD-----SDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQ 129
           + Q F  SFKR D     +DL+    A   Q  KT+KSRH++M+SLGTGI TGLLV NG+
Sbjct: 63  HLQGFIDSFKRADDSPDHNDLEKTTTAHQEQ-KKTMKSRHVIMMSLGTGIGTGLLVSNGK 121

Query: 130 VLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISL 189
            L+ AGPA L+I Y + S + Y +I AAGE+ + Y  L G+F  Y S  I    GFA + 
Sbjct: 122 GLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTW 181

Query: 190 LYTLQWLTVLPLQLVTAAITISFW-TDVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCN 248
           L+ +QWLTVLPL+L+TAA+TI +W T ++PD             + FG + Y ETEF  N
Sbjct: 182 LFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFN 241

Query: 249 CCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAHG-----FKGVCTVFTYAAF 303
            CKILMI GFII +IV+  GGAGKDGYIG KYW  PG FA       FKG+C     A F
Sbjct: 242 ACKILMIGGFIIFAIVVNCGGAGKDGYIGGKYWHDPGAFASSNGASRFKGICYNLVNAYF 301

Query: 304 SYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXX 363
           SYGG E+ VLS+++Q++P  + P A K                  F+VP++         
Sbjct: 302 SYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASG 361

Query: 364 XXXXXXX-FVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQW 422
                   +V+A   HG+KVVPH INAVILI                          P++
Sbjct: 362 GNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRF 421

Query: 423 LNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIR 482
           L+++D  GRP+   ++S L G+IGF A S + E+VFTWL AISGLS+LF W S+  SHIR
Sbjct: 422 LSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIR 481

Query: 483 LRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFF 542
            R AMK Q KSLD +GYKA TG WGS+  V         QFWVA++P    G+ D  +FF
Sbjct: 482 FRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFF 541

Query: 543 QNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRRIY 583
            +YLA PI LV Y G+  +YK++ +    +++DLD+HR++Y
Sbjct: 542 ASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVY 582

>CAGL0L07546g complement(831824..833728) highly similar to sp|P38084
           Saccharomyces cerevisiae YBR068c BAP2 or sp|P41815
           Saccharomyces cerevisiae YDR046c PAP1, start by
           similarity
          Length = 634

 Score =  423 bits (1088), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 238/566 (42%), Positives = 318/566 (56%), Gaps = 18/566 (3%)

Query: 28  DMSSIQGEP--SMVSIEIESTKK-REIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFK 84
           D +SI+ EP   +V   ++S K+ +++    K     +   S +K      F++   S  
Sbjct: 47  DNTSIESEPRTKLVHRFVDSFKRAQDVPTGRKSKEIGNNGGSKTKGG----FEE--DSLD 100

Query: 85  RKDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYT 144
            + SD DS +   +T L K +KSRH++M+SLGTGI TGLLV N + L   GPA L+IGY 
Sbjct: 101 LEGSDHDSII--TNTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALVIGYV 158

Query: 145 VSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLV 204
           + S + Y +I AAGE+ + Y  L GNF  Y SI +  + GFA   ++ +QWLTVLPL+L+
Sbjct: 159 LVSFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLPLELI 218

Query: 205 TAAITISFWTD-VNPDXXXXXXXXXXXXXNLFGAR-GYAETEFFCNCCKILMITGFIILS 262
           TA++TI +W D +N D             +LFG    Y ETEF  N CKILM+ GFII+S
Sbjct: 219 TASLTIKYWNDKINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVIGFIIMS 278

Query: 263 IVIITGGAGKDGYIGAKYWIHPGPFA-----HGFKGVCTVFTYAAFSYGGIEVVVLSIDE 317
           IVI  GGAG   YIG K+W  PG FA       FKG+C V     FSYGG E+  LS++E
Sbjct: 279 IVINAGGAGNREYIGGKFWHDPGAFAGKTAGSRFKGICYVLVSGYFSYGGTELFALSVNE 338

Query: 318 QEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIES 377
           Q +P  + P A K                  F VPYD                +V+A   
Sbjct: 339 QSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGSATHASPYVLAASL 398

Query: 378 HGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFI 437
           +GVK+ PHFINAVILI                          P++L+++D  GRP+   I
Sbjct: 399 NGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLDYVDRQGRPLLALI 458

Query: 438 ISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEI 497
             +L G+IGFVAAS K E+VFTWL AI+GLS+LF W S+ LSH+R R AMK Q +SL+E+
Sbjct: 459 ACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFRMAMKLQNRSLEEL 518

Query: 498 GYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLG 557
           GYKA TG +GS   V         QFW A+ P    G+ +  +FF NYLA PI LV Y G
Sbjct: 519 GYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFANYLAMPIWLVFYFG 578

Query: 558 HKIYYKNWRLWIPADKIDLDSHRRIY 583
           + ++ ++++L  P DKIDLD HRRIY
Sbjct: 579 YMLWTRDFQLLKPLDKIDLDFHRRIY 604

>Kwal_27.10538
          Length = 602

 Score =  421 bits (1083), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 236/568 (41%), Positives = 322/568 (56%), Gaps = 26/568 (4%)

Query: 42  EIESTKK-REIEVSEKPIASADTTVSTS---KCNA-----KTYFQDFCHSFKRKD---SD 89
           EI S  + ++ + S +P+ S+  + S S   + NA     +  +  F +SFKR +   + 
Sbjct: 5   EIHSMSEIKDSDDSAQPVLSSVKSESGSIGQEWNAWDNENRNAWGRFVNSFKRAEKHSTP 64

Query: 90  LDSDVE-------AQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIG 142
            + D+E       A  + L ++IK RH+ M+S+ TGI TGLLV NG+ L   GPAGLIIG
Sbjct: 65  SNGDLEHATTHSVASSSPLKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAGLIIG 124

Query: 143 YTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQ 202
           Y   S++ Y ++ AAGE+ + Y  L GNF  Y S LI    GFA   LY +QWLTVLPL+
Sbjct: 125 YAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTVLPLE 184

Query: 203 LVTAAITISFWTD-VNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIIL 261
           L+TA++TI +W D +N D             + FG+RGY E+EF    CK+LMI GF+IL
Sbjct: 185 LITASLTIKYWNDSINADVFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIGFVIL 244

Query: 262 SIVIITGGAGKDGYIGAKYWIHPGPFAHG-----FKGVCTVFTYAAFSYGGIEVVVLSID 316
           SIVI  GGAG   YIGAKYW  PG FA G     FKGV  V     FSYGG E+  ++++
Sbjct: 245 SIVINCGGAGDRKYIGAKYWYDPGAFAVGSGATKFKGVAYVLVTGYFSYGGTELYAMTVN 304

Query: 317 EQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXX-FVIAI 375
           EQ +P  A+ +  K+                 FLVP+                  +V+A+
Sbjct: 305 EQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKSATHASPYVLAV 364

Query: 376 ESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRC 435
             HGVK+VPH INAVILI                          P++L ++D  GRP+  
Sbjct: 365 SLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYVDRAGRPLVA 424

Query: 436 FIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLD 495
            I   +FG++ FVAASD  EDVFTWL AI+GLS+LF W ++ LSH+R R AM+   + L 
Sbjct: 425 LIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQAMRYNNRPLS 484

Query: 496 EIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAY 555
           E+GYKA TG  GS L +       + QFWV+IAP  K G+LDV++FFQ+YLAFP+ +V +
Sbjct: 485 ELGYKANTGVLGSVLGLSFNILVFIAQFWVSIAPFGKDGKLDVLSFFQSYLAFPLWVVLF 544

Query: 556 LGHKIYYKNWRLWIPADKIDLDSHRRIY 583
            G+ I ++NW +  P   IDLD +R IY
Sbjct: 545 FGYMIVFRNWEIIKPLKDIDLDHYRSIY 572

>Sklu_2029.2 , Contig c2029 2095-3891
          Length = 598

 Score =  400 bits (1028), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 203/493 (41%), Positives = 284/493 (57%), Gaps = 5/493 (1%)

Query: 96  AQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIH 155
           +++ +L ++IK  H+ MI++ TGI TGLLVGNG+ ++ AG  G ++GY +   M+ C + 
Sbjct: 65  SENEKLKQSIKPYHVFMITMATGIGTGLLVGNGKSISDAGVGGTLVGYFIIGSMLVCCMQ 124

Query: 156 AAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTD 215
           + GEL + +  L G F  Y    +DPS GF ++ L+ LQW  VLPL+LVTA++TI +W +
Sbjct: 125 SVGELVVAFPSLAGGFNSYGKRFVDPSFGFTVAWLFCLQWQIVLPLELVTASMTIKYWNN 184

Query: 216 -VNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDG 274
            +NP              + FGARGYA+ EF  N  K+LMITGFIIL I+I  G AG  G
Sbjct: 185 SLNPSIFVAIFYSLILGISFFGARGYADAEFLFNLSKVLMITGFIILGIIISFGAAGTSG 244

Query: 275 YIGAKYWIHPGPFA--HGFKGVCTVFTYAAFSYGGIEVVVLSIDEQE--DPVSAVPNACK 330
           YIG KY   PG F   + FK +C+    A FS GG+E + LS  EQ   +   ++  AC 
Sbjct: 245 YIGIKYLKTPGAFNTRNTFKSICSTLVNACFSCGGVEFLALSAAEQARGNISKSIKRACG 304

Query: 331 KXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKVVPHFINAV 390
           +                  LVPY+                +VIA+ SHGVKVVPH INAV
Sbjct: 305 QVLVRMCVFYILSIFVIGLLVPYNSPELMGSSSEIIHSSPYVIAVASHGVKVVPHLINAV 364

Query: 391 ILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAA 450
           ILI                          P +   +D  GRP RC ++S +FG++ F+A 
Sbjct: 365 ILIAVVSVANSAMYSSSRTLHALAEQGFAPSYFAKLDSKGRPFRCLVVSGVFGLLSFIAE 424

Query: 451 SDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWL 510
              +E VF WLL+ISGLS +F W  + ++H+R R AMK Q  SL+E+G++A +G +GS+ 
Sbjct: 425 YKDQESVFVWLLSISGLSTIFTWTMICVAHLRFRAAMKDQNHSLEELGHRAWSGIYGSYY 484

Query: 511 AVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIP 570
            + I   +LV QFWV++ P++  G  D VNFFQNY+A P  L  Y+GHKIY ++W+  IP
Sbjct: 485 VIAINSLTLVVQFWVSLFPLDGDGRPDFVNFFQNYMAVPFALCLYVGHKIYTRSWQFIIP 544

Query: 571 ADKIDLDSHRRIY 583
           ADKID+D+ R IY
Sbjct: 545 ADKIDVDTSRDIY 557

>ADL272W [1469] [Homologous to ScYDR508C (GNP1) - NSH]
           complement(227416..229110) [1695 bp, 564 aa]
          Length = 564

 Score =  396 bits (1017), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 197/507 (38%), Positives = 291/507 (57%), Gaps = 6/507 (1%)

Query: 86  KDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTV 145
            D++  S   ++   L ++IK RH+ MIS+ TGI TGLLVGNG+ +A AG  G +IGY +
Sbjct: 10  SDAEKLSSEGSEPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIGYLI 69

Query: 146 SSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVT 205
             +M+ C + + GEL + +  L G F  Y    IDPSLGF +S L+ LQW+ VLPL+LVT
Sbjct: 70  IGVMVVCCMQSVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLELVT 129

Query: 206 AAITISFW-TDVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIV 264
           A++TI +W ++++P              N FG+ GYAE EF  NC K++++  FI+L IV
Sbjct: 130 ASMTIKYWNSNLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVLGIV 189

Query: 265 IITGGAGKDGYIGAKYWIHPGPFAHG---FKGVCTVFTYAAFSYGGIEVVVLSIDEQ--E 319
           IITGG G  G IG +Y   PG F      FK        AAFS GG+E + LS  EQ  +
Sbjct: 190 IITGGLGNSGPIGFQYLKTPGAFNTNYNVFKATAGTLVNAAFSCGGVEFLALSAAEQNRD 249

Query: 320 DPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHG 379
           +   ++  AC++                  LVPYD                +V AI  HG
Sbjct: 250 NMPKSIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTSPYVAAIALHG 309

Query: 380 VKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIIS 439
           V++VPH INAVILI                          P++   ++ +G+P+RC ++S
Sbjct: 310 VRIVPHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQPMRCLVVS 369

Query: 440 ILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGY 499
            + G+I F+A    +E VF WLL+ISGLS +F W ++ ++HIR R+A+K QG+SLD +GY
Sbjct: 370 AIVGLISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSLDTLGY 429

Query: 500 KAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHK 559
           ++ TG  GS++A  I    ++ QFWV++ P+E +G+ D V FFQNY+A P+ ++ YLGHK
Sbjct: 430 RSNTGVIGSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPVAVLLYLGHK 489

Query: 560 IYYKNWRLWIPADKIDLDSHRRIYSAT 586
           +Y  +W  WI    +D+++ R +Y+ +
Sbjct: 490 LYTNDWTPWIRTHCVDINTDRDVYAPS 516

>Sklu_2390.1 YGR191W, Contig c2390 5453-7270 reverse complement
          Length = 605

 Score =  368 bits (945), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 197/503 (39%), Positives = 280/503 (55%), Gaps = 11/503 (2%)

Query: 88  SDLDSDV--EAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTV 145
           SD +++V   A D++L+K +  RHLL +++G  I TGL V +G  L   GPA LI+ + +
Sbjct: 73  SDFENNVYDTANDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVI 132

Query: 146 SSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVT 205
            S  ++ I++A GEL   +  +VG F  Y +  ++PS GFA+++ Y  QW  +LPL+LV 
Sbjct: 133 VSTCLFTIVNALGELAAVFP-VVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVA 191

Query: 206 AAITISFWTD-VNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIV 264
           A+ITI +W + +N D             N+   + + ETEF  +  KIL I GF IL IV
Sbjct: 192 ASITIRYWNNTINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIV 251

Query: 265 IITGGAGKDGYIGAKYWIHPGPF-----AHGFKGVCTVFTYAAFSYGGIEVVVLSIDEQE 319
           +  GG     YIG +YW  PG F        FKGVC VF  AAFSY G E+V +S  E  
Sbjct: 252 LACGGGPSGEYIGGRYWNDPGAFVGDTPGRRFKGVCAVFVTAAFSYSGTELVAVSAAESH 311

Query: 320 DPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPY-DXXXXXXXXXXXXXXXXFVIAIESH 378
           +P   +P A K+                  LVPY D                 VIAIE+ 
Sbjct: 312 NPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAASPLVIAIENG 371

Query: 379 GVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFII 438
           G+K +P  +NA+ILI                          P+ LN+ID  GRP+     
Sbjct: 372 GIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFA 431

Query: 439 SILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIG 498
           +++FG++ F+AASDK+E+VFTWL A+SGLS LF W S++LSHIR R AMK+Q +SL+E+ 
Sbjct: 432 TLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNELP 491

Query: 499 YKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGH 558
           + + TG +GSW    + F  L+  FW ++ PV   G  D  +FF+ YL+ PI +V YLGH
Sbjct: 492 FVSITGVYGSWYGCIVIFLVLIASFWTSLFPVGSDGA-DAESFFEGYLSLPIFIVCYLGH 550

Query: 559 KIYYKNWRLWIPADKIDLDSHRR 581
           K+Y K+WRL++    +DLD+ RR
Sbjct: 551 KVYKKDWRLYVKTKDMDLDTGRR 573

>KLLA0F01012g complement(90772..92442) similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1 high-affinity
           glutamine permease, hypothetical start
          Length = 556

 Score =  366 bits (940), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 192/519 (36%), Positives = 281/519 (54%), Gaps = 6/519 (1%)

Query: 76  FQDFCHSFKRKDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAG 135
           F +     +    D  +DV     +L ++IK  H+ M+S  TGI TGLLVGNG+ +A AG
Sbjct: 12  FSNLSDPTRTNSIDTTADVTLPKNELKQSIKPFHVFMMSTATGIGTGLLVGNGRSIAIAG 71

Query: 136 PAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQW 195
             G ++GY +  IM+ C +   GEL + +  + G FT Y    IDPS+GF IS L+ L W
Sbjct: 72  VGGTLVGYLIIGIMLTCCMQTVGELVVAFPSMPGGFTSYGKRFIDPSVGFTISWLFFLNW 131

Query: 196 LTVLPLQLVTAAITISFWTD-VNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILM 254
             VLPL++  A++TI+FW + +NP              N FGAR YA+ +   NC K+LM
Sbjct: 132 TVVLPLEICVASMTINFWNENINPSIVVALCYSLVCGVNFFGARCYADADCIFNCLKVLM 191

Query: 255 ITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAHG---FKGVCTVFTYAAFSYGGIEVV 311
           I GFIIL I + TG  G  GY+G KY+  PG F +    FK +      A FS GG E V
Sbjct: 192 ILGFIILGIFVNTGVVGTSGYLGFKYFHSPGFFRNDEGLFKSIAATLITACFSTGGTEFV 251

Query: 312 VLSIDEQ--EDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXX 369
            LS  EQ  ED   ++  A  +                  LVP++               
Sbjct: 252 ALSCAEQNTEDMPRSIKRASIQVVVRIAIIFCVSLMIIGLLVPFNSPYLMGSGSELTHAS 311

Query: 370 XFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMN 429
            +V+A+ ++GV+++PH +NA+IL+                           ++   +D +
Sbjct: 312 PYVVALTTNGVRIIPHIVNAIILLSIISVANNAMYSSSRTLHSLAEQGFAMKYFCKLDES 371

Query: 430 GRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKS 489
           G+P RC  +S   G+  F+A    +E VF WLL+ISGLS +F W    +SH+R R AMK 
Sbjct: 372 GKPFRCLCVSAFTGLFSFIAEYKDQETVFVWLLSISGLSTIFTWSMTCVSHLRFRKAMKD 431

Query: 490 QGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFP 549
           Q ++LD++GY++  G +GS++++FI    L+ QFWV++ P+E +G L+VV+F QNY+A P
Sbjct: 432 QDQALDQLGYQSPCGVYGSYISLFICAIILIVQFWVSLFPLESNGRLNVVSFLQNYMAVP 491

Query: 550 IVLVAYLGHKIYYKNWRLWIPADKIDLDSHRRIYSATAV 588
           I +V YLGHK Y  NW+ +I A +ID+ + R IY    V
Sbjct: 492 ITIVLYLGHKAYTGNWKPFIRAPEIDIQTDRDIYCVDEV 530

>CAGL0B03773g 373956..375773 highly similar to sp|P06775
           Saccharomyces cerevisiae YGR191w HIP1 Histidine
           permease, start by similarity
          Length = 605

 Score =  360 bits (923), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 196/498 (39%), Positives = 283/498 (56%), Gaps = 9/498 (1%)

Query: 95  EAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCII 154
           +  +T L+K +  RHLL +++G  I TGL V +G  L   GPA L+IG+ + S  ++ +I
Sbjct: 82  DINNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVI 141

Query: 155 HAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWT 214
           ++ GEL   +  +VG F  Y +  I+PS  FAI+L Y  QWL +LPL+LV A+ITI +W 
Sbjct: 142 NSLGELAAAFP-VVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWN 200

Query: 215 D-VNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKD 273
           D +N D             N+   + + ETEF  +  KIL I GF IL IV+  GG    
Sbjct: 201 DKINSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHG 260

Query: 274 GYIGAKYWIHPGPF-----AHGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNA 328
           GYIG KYW +PG F        FKG+C+VF  AAFSY GIE+  +S  E  +P   +P A
Sbjct: 261 GYIGGKYWHNPGAFVGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKETIPKA 320

Query: 329 CKKXXXXXXXXXXXXXXXXCFLVPY-DXXXXXXXXXXXXXXXXFVIAIESHGVKVVPHFI 387
            K+                  LVPY D                 VIAIE+ G+K +P  +
Sbjct: 321 AKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIAIENGGIKGLPSLM 380

Query: 388 NAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGF 447
           NA+ILI                          P++L+ +D  GRP+   ++++ FG++ F
Sbjct: 381 NAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFGLLSF 440

Query: 448 VAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWG 507
           +AASDK+E+VFTWL A+SGLS +F WM+++LS IR RDAMK+QG+SLDE+ + +Q+G WG
Sbjct: 441 IAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQSGTWG 500

Query: 508 SWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRL 567
           +W  V + F  LV  FW ++ PV         +FF+ YL+ PI++  Y+GHK++ ++WRL
Sbjct: 501 AWYGVIVLFLVLVASFWTSLFPVGSSTA-SAKSFFEGYLSLPILIACYVGHKLWKRDWRL 559

Query: 568 WIPADKIDLDSHRRIYSA 585
            +P  ++DLDS RR+  A
Sbjct: 560 LVPLMEMDLDSGRRVLDA 577

>Kwal_27.12681
          Length = 593

 Score =  358 bits (918), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 208/559 (37%), Positives = 305/559 (54%), Gaps = 27/559 (4%)

Query: 47  KKREIEVSEKPIASADTTVSTSKCNA--------KTYFQDFCHSFKRKD-SDLDSDV-EA 96
           KK  +   E+P+ + D   S+ +  +        K+ +QDF   FKR +  +LD ++ EA
Sbjct: 6   KKNFVYAQEEPLEAQDAGHSSYETGSSPGQTQASKSRWQDFKDGFKRVELEELDPNLTEA 65

Query: 97  Q-------DTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIM 149
           +        + L + +K+RHL MI++G  I TGL VG+G+ L   GPAG++IG+ +  +M
Sbjct: 66  EKIAIITAQSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLM 125

Query: 150 IYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAIT 209
           IYC++ + GEL + +  + G FT Y +  +D S GFAI+  Y LQWL VLPL++V A+IT
Sbjct: 126 IYCVVMSMGELAVTFP-VSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASIT 184

Query: 210 ISFWTDVNP--DXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIIT 267
           ++FW       D             N FG RGY E EF  +  K++ + GFIIL IV++ 
Sbjct: 185 VNFWGTPPKYRDGFVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVC 244

Query: 268 GGAGKDGYIGAKYWIHPGPFA-----HGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPV 322
           GG    GYIG KYW +PG F+       FKGVC+VF  AAFS+ G E+V L+  E  +P 
Sbjct: 245 GGGPVGGYIGGKYWHNPGAFSGDDAGSRFKGVCSVFVTAAFSFAGTELVGLASAETANPR 304

Query: 323 SAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKV 382
            A+P A K+                  LVP+                 FV+AI++HG+K 
Sbjct: 305 KALPRAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVLAIQTHGIKG 364

Query: 383 VPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILF 442
           +P  IN VILI                          P    +ID  GRP+   I + +F
Sbjct: 365 LPSVINVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVF 424

Query: 443 GMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQ 502
           G++ F+A S+K  DVF WLLA+SGLS LF W ++ + HIR R A+ +QG+S DE+ + + 
Sbjct: 425 GLLSFIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSY 484

Query: 503 TGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYY 562
            G  GS+  V +    L+ QFWVA+ P+   G  +  +FF  YL+FP++L  Y+ HKI+ 
Sbjct: 485 AGIAGSYFGVILVLLVLIAQFWVAVWPI--GGSPNAEDFFSAYLSFPVLLAFYIFHKIWK 542

Query: 563 KNWRLWIPADKIDLDSHRR 581
           +NW+L+  A  ID+D+ RR
Sbjct: 543 RNWKLFTRAKDIDIDTGRR 561

>Scas_507.1
          Length = 592

 Score =  355 bits (911), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 202/540 (37%), Positives = 288/540 (53%), Gaps = 19/540 (3%)

Query: 49  REIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKDSDLDSDVEAQDTQLSKTIKSR 108
            E + +  P+AS D+ V   K    T   DF      +D       +  +  L+K +  R
Sbjct: 33  EEKDSTLSPLASLDSKVPHEKIQTTT---DFASVISHED-------DINNVNLNKNLSIR 82

Query: 109 HLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLV 168
           HLL +++G  I  GL V +G  LA  GPA L+I + + S  ++ +I+A GE+   +  +V
Sbjct: 83  HLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINALGEMAAAFP-VV 141

Query: 169 GNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTD-VNPDXXXXXXXX 227
           G F  Y +  IDPS+GFA+++ Y  QWL +LPL+LV A++TI +W + +N D        
Sbjct: 142 GGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNETINSDAWVAIFYC 201

Query: 228 XXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPF 287
                N+   + + ETEF  +  KIL I GF IL IV+  GG    G+IG KYW HPG F
Sbjct: 202 VIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGGFIGGKYWNHPGSF 261

Query: 288 -AHG----FKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXX 342
             H     FKG+C+VF  AAFSY GIE+  +S  E +DP + +P A K+           
Sbjct: 262 VGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTIPKAAKRTFWLITASYVT 321

Query: 343 XXXXXCFLVPYDXXXXXXXXXXXXXXXX-FVIAIESHGVKVVPHFINAVILIXXXXXXXX 401
                  LVPYD                  VIAIE+ G+K +P  +NA+ILI        
Sbjct: 322 ILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGLPSLMNAIILISIISVANS 381

Query: 402 XXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWL 461
                             P+ LN +D  GRP+   I ++ FG++ FVAASD++ DVFTWL
Sbjct: 382 AVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFTWL 441

Query: 462 LAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVT 521
            A+SGLS +F WM+++LSHIR R +M  Q +SLDE+ + +QTG WGSW    + F  LV 
Sbjct: 442 SALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTGVWGSWYGTIVLFLVLVA 501

Query: 522 QFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRR 581
            FW ++ P+      D  +FF+ YL+FPI+L  Y GHK+Y +     +    +DLD+ RR
Sbjct: 502 SFWTSLFPLGGTSA-DAESFFEGYLSFPILLACYFGHKLYVRKREFMVGLADMDLDTGRR 560

>YKR039W (GAP1) [3292] chr11 (514705..516513) General amino acid
           permease, proton symport transporter for all
           naturally-occurring L-amino acids, 4-aminobutyric acid
           (GABA), ornithine, citrulline, some D-amino acids, and
           some toxic analogs [1809 bp, 602 aa]
          Length = 602

 Score =  355 bits (912), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 216/547 (39%), Positives = 310/547 (56%), Gaps = 21/547 (3%)

Query: 53  VSEKPIA--SADTTVSTSKCNAKTYFQDFCHSFKR-KDSDLDSDV-EAQ-------DTQL 101
           ++++PI   S  + VS  +  + + +QDF  SFKR K  ++D ++ EA+        T L
Sbjct: 27  LTQEPITIPSNGSAVSIDETGSGSKWQDFKDSFKRVKPIEVDPNLSEAEKVAIITAQTPL 86

Query: 102 SKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELG 161
              +K+RHL MI++G  I TGLLVG+G  L   GPA L+IG+  +  MIY ++ A GEL 
Sbjct: 87  KHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELA 146

Query: 162 ICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFW-TDVN-PD 219
           + +  + G FT Y +  ID S G+A +  Y LQWL VLPL++V+A+IT++FW TD    D
Sbjct: 147 VIFP-ISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRD 205

Query: 220 XXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAK 279
                        N+FG +GY E EF  +  K++ + GFIIL I++  GG    GYIG K
Sbjct: 206 GFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYIGGK 265

Query: 280 YWIHPGPFA-----HGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXX 334
           YW  PG FA       FKGVC+VF  AAFS+ G E+V L+  E  +P  +VP A K+   
Sbjct: 266 YWHDPGAFAGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVPKAAKQVFW 325

Query: 335 XXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKVVPHFINAVILIX 394
                          LVPY+                FVIAI++HG+K +P  +N VILI 
Sbjct: 326 RITLFYILSLLMIGLLVPYNDKSLIGASSVDAAASPFVIAIKTHGIKGLPSVVNVVILIA 385

Query: 395 XXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKR 454
                                    P+  +++D  GRP+    ++  FG+I FVAAS K 
Sbjct: 386 VLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIAFVAASKKE 445

Query: 455 EDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFI 514
            +VF WLLA+SGLS LF W  + + HIR R A+ +QG+ LDE+ +K+ TG WGS+  +F+
Sbjct: 446 GEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPTGVWGSYWGLFM 505

Query: 515 GFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKI 574
                + QF+VA+ PV      +   FF+ YL+FP+V+V Y+GHKIY +NW+L+IPA+K+
Sbjct: 506 VIIMFIAQFYVAVFPVGDSPSAE--GFFEAYLSFPLVMVMYIGHKIYKRNWKLFIPAEKM 563

Query: 575 DLDSHRR 581
           D+D+ RR
Sbjct: 564 DIDTGRR 570

>KLLA0A06886g complement(621646..623409) similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, start by similarity
          Length = 587

 Score =  353 bits (905), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/553 (37%), Positives = 310/553 (56%), Gaps = 16/553 (2%)

Query: 42  EIESTKKREIEVSEKPIASADTTVSTSKCN--AKTYFQDFCHSFKRKDS-DLD---SDVE 95
           +++ +  +E ++        ++ VS S  +    T ++ F  SFKR D+ DLD   +D E
Sbjct: 6   KLDYSIDQETQLESGEFHEQNSYVSQSDASPVEGTRWERFRDSFKRADTQDLDPNLTDAE 65

Query: 96  -----AQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMI 150
                  +  L +T+KSRHL MI++G  I TGL VG+G+ LA AGPAG++IG+ ++  MI
Sbjct: 66  KMAILTANAPLKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMI 125

Query: 151 YCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITI 210
           YC++ A GEL + +  + G FT Y S  +D S GFA + +Y LQWL VLPL++V A+IT+
Sbjct: 126 YCMVMAMGELAVTFP-IAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITV 184

Query: 211 SFW--TDVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITG 268
           ++W   D   D             N FG +GY E EF  +  K++ + G+IIL ++++ G
Sbjct: 185 NYWGTPDKYRDGFVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCG 244

Query: 269 GAGKDGYIGAKYWIHPGPFAHGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNA 328
           G  + GYIG + W +PG FA+GFKGVC+VF  AAFS+ G E+V L+  E  +P  ++P+A
Sbjct: 245 GGPQGGYIGGRLWHNPGAFANGFKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSA 304

Query: 329 CKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKVVPHFIN 388
            K+                  LVPY                 FVI+I++ G+K +P  IN
Sbjct: 305 AKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVIN 364

Query: 389 AVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFV 448
            VILI                          P+   +ID  GRP+   I++ +FG++ F+
Sbjct: 365 VVILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFI 424

Query: 449 AASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGS 508
           AAS K  +VF WLLA+SGLS LF W  + L HIR+R A+ +Q ++  E+ + A TG WGS
Sbjct: 425 AASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVWGS 484

Query: 509 WLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLW 568
                +    L+ QFW+A+ P+          FF+ YL+FPI++  Y+GHKI+ KNW+L+
Sbjct: 485 VYGFVLIILILMAQFWIALFPIGDKPSASA--FFEAYLSFPILIAFYIGHKIWKKNWKLF 542

Query: 569 IPADKIDLDSHRR 581
           I A  ID+D+ RR
Sbjct: 543 IRAKNIDIDTGRR 555

>YGR191W (HIP1) [2141] chr7 (880423..882234) Histidine permease,
           member of the amino acid permease family of membrane
           transporters [1812 bp, 603 aa]
          Length = 603

 Score =  353 bits (905), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 206/558 (36%), Positives = 299/558 (53%), Gaps = 18/558 (3%)

Query: 31  SIQGEPSMVSIEIESTKKREIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKDSDL 90
           + + E    +   E T K +   S  P++S D+       N  T    F     R++ D 
Sbjct: 25  AFENEKESTTFVTELTSKTD---SAFPLSSKDSPGINQTTNDITSSDRF-----RRNEDT 76

Query: 91  DSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMI 150
           + + +  +T LSK +  RHLL +++G  I TGL V  G  L+  GPA L+I + + S  +
Sbjct: 77  EQE-DINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCL 135

Query: 151 YCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITI 210
           + +I++ GEL   +  +VG F  Y    I+PS  FA++L Y  QWL +LPL+LV A+ITI
Sbjct: 136 FTVINSLGELSAAFP-VVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAASITI 194

Query: 211 SFWTD-VNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGG 269
            +W D +N D             N+   + + ETEF  +  KIL I GF IL IV+  GG
Sbjct: 195 KYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGG 254

Query: 270 AGKDGYIGAKYWIHPGPF-AHG----FKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSA 324
               GYIG KYW  PG F  H     FKG+C+VF  AAFSY GIE+  +S  E ++P   
Sbjct: 255 GPHGGYIGGKYWHDPGAFVGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 325 VPNACKKXXXXXXXXXXXXXXXXCFLVP-YDXXXXXXXXXXXXXXXXFVIAIESHGVKVV 383
           +P A K+                  LVP  D                 VIAIE+ G+K +
Sbjct: 315 IPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGL 374

Query: 384 PHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFG 443
           P  +NA+ILI                          P++LN +D  GRP+   ++++ FG
Sbjct: 375 PSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFG 434

Query: 444 MIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQT 503
           ++ FVAASDK+ +VFTWL A+SGLS +F WM+++LSHIR R AMK Q +SLDE+ + +QT
Sbjct: 435 LLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQT 494

Query: 504 GYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYK 563
           G  GSW    + F  L+  FW ++ P+   G     +FF+ YL+FPI++V Y+GHK+Y +
Sbjct: 495 GVKGSWYGFIVLFLVLIASFWTSLFPLGGSGA-SAESFFEGYLSFPILIVCYVGHKLYTR 553

Query: 564 NWRLWIPADKIDLDSHRR 581
           NW L +  + +DLD+ R+
Sbjct: 554 NWTLMVKLEDMDLDTGRK 571

>Kwal_33.15407
          Length = 587

 Score =  343 bits (881), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 191/494 (38%), Positives = 276/494 (55%), Gaps = 9/494 (1%)

Query: 95  EAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCII 154
           +A+D++ +K +  RHLL +++G  I TGL V +G  L   GP  L+I + + S  ++ I+
Sbjct: 64  DAEDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIV 123

Query: 155 HAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFW- 213
           +A GEL   +  +VG F  Y S  ++PS GFA++L Y  QW  +LPL+LV A++TI +W 
Sbjct: 124 NALGELSSTFP-VVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWN 182

Query: 214 TDVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKD 273
           + +N D             NL   + + ETEF  +  KIL I GF IL IV+  GG  + 
Sbjct: 183 STINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEG 242

Query: 274 GYIGAKYWIHPGPF-----AHGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNA 328
           GYIG KYW +PG F     +  F G+C+VF  AAFSY G E++ +S  E  +P   +P A
Sbjct: 243 GYIGGKYWSNPGAFVGNTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKA 302

Query: 329 CKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXX-XXXXXXXXXXFVIAIESHGVKVVPHFI 387
           CK+                  LVP D                  VIAIE+ G+K +P  +
Sbjct: 303 CKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGGIKGLPSLM 362

Query: 388 NAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGF 447
           NA+ILI                          P+  +++D  GRP+   + +++FG++ F
Sbjct: 363 NAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLLSF 422

Query: 448 VAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWG 507
           +AAS+K+E VFTWL A+SGLS LF W ++++SHIR R  MK +G+SLDE+ + + TG WG
Sbjct: 423 IAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVSMTGVWG 482

Query: 508 SWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRL 567
           S+    I F  LV  FW A+ P    G     +FF+ YL+FPI+LV Y+GHK+Y K+WRL
Sbjct: 483 SYYGCVIIFVVLVVCFWTALFP-STEGVASAESFFETYLSFPILLVCYIGHKLYTKSWRL 541

Query: 568 WIPADKIDLDSHRR 581
             P  +ID+DS RR
Sbjct: 542 LTPTTEIDIDSGRR 555

>Kwal_33.14276
          Length = 596

 Score =  343 bits (880), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/566 (34%), Positives = 295/566 (52%), Gaps = 28/566 (4%)

Query: 41  IEIESTKKREIEVSEKPIASADTTVSTSKCN-------------AKTYFQDFCHSFKR-K 86
           IEI     RE+++ +         + TS  N             +K++  +F   F+  K
Sbjct: 2   IEILKDVDRELDLKKDQNLYFTQDIETSSENEGYDKYERESKSSSKSWIHNFVDGFREYK 61

Query: 87  DSDLDSDVEAQD--------TQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAG 138
             D+D ++ + +        + L + +K+RHL MI++G  I TGL VG+G+ L   GPA 
Sbjct: 62  LDDVDPNLSSTERAAIATARSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAA 121

Query: 139 LIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTV 198
           +I+ + ++  M+Y ++ A GEL +    + G++  Y S  IDPS GFAI+  Y +  L  
Sbjct: 122 VILAWILTGSMVYSVVQAIGELCVALP-VSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVT 180

Query: 199 LPLQLVTAAITISFWT--DVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMIT 256
           +PL++V A+IT+ +W       D             N  G +GY E EF  +  K+L I 
Sbjct: 181 MPLEIVAASITVDYWNVDHKYADGFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIV 240

Query: 257 GFIILSIVIITGGAGKD-GYIGAKYWIHPGPFAHGFKGVCTVFTYAAFSYGGIEVVVLSI 315
           GFIIL IV++ GG   + GYIG KYW +PG FAHGFKG   +F  +AFS+ G E+  L  
Sbjct: 241 GFIILGIVLVCGGGSNNTGYIGTKYWHNPGGFAHGFKGFAAIFVTSAFSFSGSEMFALGA 300

Query: 316 DEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAI 375
            E ++P   +P A K+                  LVPY                 FVIAI
Sbjct: 301 AESKNPRRDLPKAAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASASPFVIAI 360

Query: 376 ESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRC 435
           +  G+  +P  IN VIL+                          P+   ++D  GRP+  
Sbjct: 361 KEAGISGLPSVINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAG 420

Query: 436 FIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLD 495
            I+S++FG++ F+++S  +  VF W+LA+SGL   F W S+ + H+R R  +++QG+S D
Sbjct: 421 LILSMVFGLLSFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTD 480

Query: 496 EIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAY 555
           E+ +KAQTG WGS   + +    L  QFWVA+ P+ K       +FF+ YL+ P+V+V Y
Sbjct: 481 ELAFKAQTGIWGSIYGITLISVVLCFQFWVALFPLSK--SPSAYHFFEQYLSLPVVIVFY 538

Query: 556 LGHKIYYKNWRLWIPADKIDLDSHRR 581
           +GHK+Y +NWRL IPA ++DLD+ RR
Sbjct: 539 MGHKVYSRNWRLVIPAKELDLDTGRR 564

>Scas_479.1
          Length = 595

 Score =  338 bits (868), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/547 (36%), Positives = 295/547 (53%), Gaps = 24/547 (4%)

Query: 52  EVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKDSDLDSDV----------EAQDTQL 101
           E  E+ I  + + V +   N  + F +     K KDS ++ ++          E  +  L
Sbjct: 24  EEGEEGIGRSSSQVHSFTSNTPSPFNE-----KSKDSPIEDNIDITSQSSVTKEDINKSL 78

Query: 102 SKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELG 161
           +K +  RHLL +++G  I  GL V +G  LA  GPA L+I + + S  ++ +I++ GEL 
Sbjct: 79  NKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINSLGELA 138

Query: 162 ICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFW-TDVNPDX 220
             +  +VG F  Y +  +DPS  FA++L Y  QWL +LPL+LV A+ITI +W + +N D 
Sbjct: 139 AAFP-VVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNSTINSDA 197

Query: 221 XXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKY 280
                       N+   + + ETEF  +  KIL I GF IL IV+  GG  K GY+G KY
Sbjct: 198 WVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPKGGYLGGKY 257

Query: 281 WIHPGPF-----AHGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXX 335
           W +PG F        FKG+C+VF  AAFSY GIE+  +S  E +DP   +P A K+    
Sbjct: 258 WHNPGAFVGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRKTIPKAAKRTFWL 317

Query: 336 XXXXXXXXXXXXCFLVPYDXXXXXX-XXXXXXXXXXFVIAIESHGVKVVPHFINAVILIX 394
                         LVPYD                  VIAIE+ G+K +   +NA+ILI 
Sbjct: 318 ITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAASPLVIAIENGGIKGLDSLMNAIILIS 377

Query: 395 XXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKR 454
                                    P+ L  +D  GRPI   ++++ FG++ F+AASDK+
Sbjct: 378 IISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFFGLLSFIAASDKQ 437

Query: 455 EDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFI 514
            +VFTWL A+SGLS +F WM++++SHIR R AM  Q +SLDE+ Y +QTG WGS   V +
Sbjct: 438 NEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYLSQTGVWGSLYGVVV 497

Query: 515 GFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKI 574
            F  LV  FW ++ P+      DV +FF+ YL+ PI++V Y+GHK+Y+KNW   +  +++
Sbjct: 498 LFLVLVASFWTSLFPLGGDSA-DVQSFFEGYLSLPILIVCYIGHKLYFKNWSWVVTLEEM 556

Query: 575 DLDSHRR 581
           DLD+ R+
Sbjct: 557 DLDTGRK 563

>AGR319W [4630] [Homologous to ScYGR191W (HIP1) - SH]
           complement(1327939..1329819) [1881 bp, 626 aa]
          Length = 626

 Score =  338 bits (868), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 191/496 (38%), Positives = 272/496 (54%), Gaps = 9/496 (1%)

Query: 93  DVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYC 152
           D     +QLSK +  RHLL +++G  I TGL V +G  L   GP  ++I +T+ S  ++ 
Sbjct: 101 DAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTCLFT 160

Query: 153 IIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISF 212
           I+++ GEL   +  +VG F  Y +  ++PS GFA+++ Y  QW  +LPL+L  A+ITI +
Sbjct: 161 IVNSLGELASAFP-VVGGFNVYITRFVEPSFGFAVNISYLAQWAVLLPLELAAASITIKY 219

Query: 213 WTD-VNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAG 271
           W + +N D             N+   + + ETEF  +  KIL I GF IL  V+I GG  
Sbjct: 220 WNNKINSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAILGTVLICGGGP 279

Query: 272 KDGYIGAKYWIHPGPF-----AHGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVP 326
             G+IGAKYW  PG F        FKG+C+VF  AAFSY G E+V +S  E  +P   +P
Sbjct: 280 VGGFIGAKYWHDPGAFVGDTPGAQFKGLCSVFVTAAFSYSGTELVGVSAAESINPRYTIP 339

Query: 327 NACKKXXXXXXXXXXXXXXXXCFLVPY-DXXXXXXXXXXXXXXXXFVIAIESHGVKVVPH 385
            A K+                  LVP  D                 VIAIE+ G++ VP 
Sbjct: 340 RASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGMSSVDVAASPLVIAIENGGIRGVPS 399

Query: 386 FINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMI 445
            +NA+ILI                          P+  N+ID  GRP+   + +++FG++
Sbjct: 400 LMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVFNYIDRKGRPLVAILATLVFGLL 459

Query: 446 GFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGY 505
            FVAASDK+E +FTWL A+SGLS LF W ++++SHIR R AM +Q +SLDE+ Y + TG 
Sbjct: 460 SFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRFRRAMCAQQRSLDELPYLSLTGV 519

Query: 506 WGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNW 565
            GSW    +  F LV  FW ++ P    G     +FF+ YL+FPI L+ Y+ HK+Y ++W
Sbjct: 520 LGSWYGAAVLLFVLVLSFWTSLFPPGSSGP-SAESFFEGYLSFPIFLICYISHKLYKRDW 578

Query: 566 RLWIPADKIDLDSHRR 581
           RL+IPA +ID+DS RR
Sbjct: 579 RLFIPAGQIDVDSGRR 594

>Scas_607.4
          Length = 599

 Score =  337 bits (863), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 191/517 (36%), Positives = 285/517 (55%), Gaps = 19/517 (3%)

Query: 73  KTYFQDFCHSFKRK-DSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVL 131
           +  FQ    SFK   D   D++       L +++K+RHL+MI++G  I TGL VG+GQ +
Sbjct: 62  RNIFQRCIDSFKPPLDGSFDTN------NLKRSLKARHLIMIAIGGSIGTGLFVGSGQAI 115

Query: 132 AKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLY 191
           A  GP  ++IG+ ++   I   IH  GE+ + +  +VG F  Y +  +DPSL F IS +Y
Sbjct: 116 ATGGPLAVVIGWAIAGSQIIGTIHGLGEITVRFP-VVGAFANYSTRFLDPSLSFVISTIY 174

Query: 192 TLQWLTVLPLQLVTAAITISFWTD-VNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCC 250
            +QW  VLPL+++++A+T+ +W   ++P              NLFGARG+ E EF  +  
Sbjct: 175 VIQWFFVLPLEIISSAMTVQYWNQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSV 234

Query: 251 KILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAHGFKGVCTVFTYAAFSYGGIEV 310
           K+L I GFIIL IV+I GG     ++GAKYW  PG  AHGF GV +V   A++S GG E+
Sbjct: 235 KVLTICGFIILCIVLICGGGPDHDFVGAKYWHDPGCLAHGFPGVLSVLVVASYSLGGTEM 294

Query: 311 VVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXX 370
           V L+  E  DP   +P+A K+                 FLVPY                 
Sbjct: 295 VCLASGET-DP-KELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSSVNNSP-- 350

Query: 371 FVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNG 430
           FVIAI+ H +KV+P  +NAVILI                          P++  +ID  G
Sbjct: 351 FVIAIKLHQIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAG 410

Query: 431 RPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQ 490
           RP+   I + LFG++ F+  S    +VF WL+AI+GL+   +W+S+++SHIR R AMK+Q
Sbjct: 411 RPLTGIITNSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQ 470

Query: 491 GKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVE--KHGELDVVNFFQNYLAF 548
           G+SLDE+ + +  G WGS  +  I    LV QF+ A+ P+   ++  +    FFQ+YL  
Sbjct: 471 GRSLDELEFVSAVGIWGSAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCA 530

Query: 549 PIVLVAYLGHKIYYK----NWRLWIPADKIDLDSHRR 581
            I++V ++GHKI+Y+     W   +P +KIDL++ R+
Sbjct: 531 LIMIVLFVGHKIFYRYKTGKWWSMLPLNKIDLETDRK 567

>KLLA0A11770g 1014918..1016663 similar to sp|P06775 Saccharomyces
           cerevisiae YGR191w HIP1 histidine permease, start by
           similarity
          Length = 581

 Score =  333 bits (854), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/509 (37%), Positives = 278/509 (54%), Gaps = 14/509 (2%)

Query: 84  KRKDSDLDSDVE-----AQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAG 138
           + KD    +DVE      +D++L+K +  RHLL +++G  I TGL V +G  L+  GPA 
Sbjct: 42  EEKDYADMNDVEKAIYNTKDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPAS 101

Query: 139 LIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTV 198
           L+I +T+ S  ++ I+++ GEL   +  +VG F  Y +  ++PS GFA++  Y  QW  +
Sbjct: 102 LVIAWTIISTCLFTIVNSLGELSATFP-VVGGFNVYVTRFVEPSFGFAVNFNYLAQWAIL 160

Query: 199 LPLQLVTAAITISFWT-DVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITG 257
           LPL+L  A+ITI +W   +NPD             N+   + + ETEF  +  KIL I G
Sbjct: 161 LPLELCAASITIRYWNKSINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIG 220

Query: 258 FIILSIVIITGGAGKDGYIGAKYWIHPGPF-----AHGFKGVCTVFTYAAFSYGGIEVVV 312
           F IL IV+I GG    G+IG KYW  PG F     A  FKG+  VF  AAFSY G+E+V 
Sbjct: 221 FTILGIVLICGGGPSGGFIGGKYWNDPGAFVGDTPAQRFKGLSAVFITAAFSYSGLELVG 280

Query: 313 LSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVP-YDXXXXXXXXXXXXXXXXF 371
           +S  E  +P   +P A K+                  LVP  D                 
Sbjct: 281 VSAAESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASPL 340

Query: 372 VIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGR 431
           VIAI++ G+K +P  +NA+ILI                          P+ L  +D  GR
Sbjct: 341 VIAIQNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGR 400

Query: 432 PIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQG 491
           P+    I++L G++ F+AAS+KR++VFTWL A+SGLS LF W +++L+H+R R AMK Q 
Sbjct: 401 PLYAIAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQN 460

Query: 492 KSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIV 551
           +SL+E+ Y + TG WGSW    +    L+  FW ++ P   +G  D  +FF++YL+ PI 
Sbjct: 461 RSLEELPYVSMTGEWGSWYGCIVIGLVLIASFWTSLFPAGGNGA-DATSFFESYLSLPIF 519

Query: 552 LVAYLGHKIYYKNWRLWIPADKIDLDSHR 580
           +  YLGHKI+ +N RL+I   ++D+DS R
Sbjct: 520 IACYLGHKIWKRNLRLYIKLSEVDVDSGR 548

>AFR230C [3422] [Homologous to ScYKR039W (GAP1) - NSH]
           (855416..857230) [1815 bp, 604 aa]
          Length = 604

 Score =  327 bits (839), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 191/576 (33%), Positives = 299/576 (51%), Gaps = 27/576 (4%)

Query: 29  MSSIQGEPSMVSIEIESTKKREIEVSEKPIASADTTVS---TSKCNAKTYFQDFCHSFKR 85
           M+   G P     +IE  K   +   E+   S D  V    + +   +  +  F  +F+R
Sbjct: 1   MAKQAGTPDDDVEDIE--KSFYVSGKEQARVSTDLAVDEPISVQPEPRKGWNGFVDTFRR 58

Query: 86  K-----DSDLDSD----VEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGP 136
                 D +L       +      LS+ +K+RHL MI++G  I  GL VG+G+ LA AGP
Sbjct: 59  AEMPVIDPNLSEAEKLAIRTAAAPLSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGP 118

Query: 137 AGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWL 196
           AG++IG+ +++ MI  +  + GEL + +  + G +  Y +  ID S GFA +  Y +Q +
Sbjct: 119 AGVLIGWGLTATMILIMCLSLGELAVTFP-VSGGYITYAARFIDESWGFANNFNYMMQAM 177

Query: 197 TVLPLQLVTAAITISFWTDVNPDXXXXXXX---XXXXXXNLFGARGYAETEFFCNCCKIL 253
            V+PL++V A++T+ +W D +P                 NLFG RG+ E E   +  K++
Sbjct: 178 VVMPLEIVAASVTVGYW-DTDPKYKLAFVALFWVVIVSINLFGVRGFGEAESIFSLIKVI 236

Query: 254 MITGFIILSIVIITGGAGKDGYIGAKYWIHPGPF-----AHGFKGVCTVFTYAAFSYGGI 308
            I GFII+ +V+I+GG      IG KYW  PGPF     +  FKGVC+VF  AAFS+ G 
Sbjct: 237 TIIGFIIMGVVLISGGGPDHEVIGGKYWNDPGPFVGNAPSDKFKGVCSVFVTAAFSFAGS 296

Query: 309 EVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXX 368
           E++ L+  E  +P  ++P A K+                  LVP +              
Sbjct: 297 ELIGLAAAETREPRKSIPKAAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAH 356

Query: 369 XXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDM 428
             FVIA++ H ++V+P  IN VIL                           P+   +ID 
Sbjct: 357 SPFVIAMDMHRIRVLPSIINVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDR 416

Query: 429 NGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMK 488
            GRP+     + LFG++ FVA + +  ++F WLLAISGLS  F W++++L+H+R R A+K
Sbjct: 417 KGRPLFAICFTSLFGLLCFVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALK 476

Query: 489 SQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHG---ELDVVNFFQNY 545
           +QG++ +E+ + + TG+ GS  AV +    LV QFWVA+ P    G   +   + FF+ Y
Sbjct: 477 AQGRTTNELSFTSPTGFIGSCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQY 536

Query: 546 LAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRR 581
           L+F + +V YL HKI+ +NW+ +I A ++D+D+ RR
Sbjct: 537 LSFAVAIVMYLAHKIWSRNWKFFIKAKEMDIDTGRR 572

>AEL030W [2476] [Homologous to ScYOL020W (TAT2) - SH]
           complement(577332..579551) [2220 bp, 739 aa]
          Length = 739

 Score =  329 bits (844), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 199/569 (34%), Positives = 296/569 (52%), Gaps = 25/569 (4%)

Query: 21  GKGCAELDMSSIQGEPSMVSIEIESTKKREIEVSEKPIASADTTVSTSKCNAKTYFQDFC 80
           GK   + D+     E S  S      KKR   + E  +      +  S+ N +   +   
Sbjct: 156 GKMIHQKDVEKAASELSNTSAVQRVLKKRSSVLEESRL------LEESRTNKRGLVRRCI 209

Query: 81  HSFKRK-DSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGL 139
            SFK   D   D D       L +T+KSRHL+MI++G  I TGL +G+G+ LA  GP  +
Sbjct: 210 DSFKPPVDGSFDPD------NLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAV 263

Query: 140 IIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVL 199
           +IG+T++   +   IH  GE+ + +  +VG F  Y +  +DPS+ F +S +Y LQW  VL
Sbjct: 264 LIGWTLAGTQMVGTIHGLGEVTVRF-PVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVL 322

Query: 200 PLQLVTAAITISFWT-DVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGF 258
           PL+++ +AIT+ FWT  V+P              NLFG R + + +F  +  K++ I GF
Sbjct: 323 PLEIIASAITMEFWTTSVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGF 382

Query: 259 IILSIVIITGGAGKDGYIGAKYWIHPGPFAHGFKGVCTVFTYAAFSYGGIEVVVLSIDEQ 318
           IIL +V+I GG     +IGA+YW  PG  A+GFKGV  V   A++S GG E+  L+  E 
Sbjct: 383 IILCLVLILGGGPTHEFIGARYWHDPGALANGFKGVAAVMVTASYSLGGSEMTCLASGET 442

Query: 319 EDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESH 378
            DP   +P+A K+                 FLVPY                 FVIAI+ H
Sbjct: 443 -DP-KEIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLGGSNVNNSP--FVIAIKMH 498

Query: 379 GVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFII 438
            ++V+PH IN VIL+                          P+   ++D  GRP+   + 
Sbjct: 499 NIRVLPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILT 558

Query: 439 SILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIG 498
           + LFG++ F+  S     VFTWL+A++GL+   +W+S+++SHIR R AMK+QGKSLDE+ 
Sbjct: 559 NSLFGLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELE 618

Query: 499 YKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVE--KHGELDVVNFFQNYLAFPIVLVAYL 556
           + +  G WGS  +  +    LV QF+V++ P+E  K        FFQNYL   I+L  ++
Sbjct: 619 FVSAVGMWGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFV 678

Query: 557 GHKIYYKN----WRLWIPADKIDLDSHRR 581
            HKIYY++    W   +P  +IDL+S R+
Sbjct: 679 AHKIYYRSTTGQWWKILPLAEIDLESGRK 707

>KLLA0A06930g complement(625498..627261) similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, hypothetical start
          Length = 587

 Score =  323 bits (829), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 201/546 (36%), Positives = 303/546 (55%), Gaps = 16/546 (2%)

Query: 49  REIEVSEKPIASADTTVSTSKCN--AKTYFQDFCHSFKRKDS-DLDSDVE--------AQ 97
           +E ++        ++ VS S  +    T ++ F  SF+  ++ DLD  +           
Sbjct: 13  QETQLEPGEFDELNSYVSQSDTSRVGGTRWERFKDSFREAETVDLDPSLTPAEKMAILTA 72

Query: 98  DTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAA 157
           +  L +T+KSRHL MI +G  I TGL VG+G+ LA AGPAG++IG+ ++  MIYC++ A 
Sbjct: 73  NAPLKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAM 132

Query: 158 GELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDVN 217
           GEL + +  + G +T Y S  +D S GFA + +Y + WL  LPL++V A+IT+++W    
Sbjct: 133 GELAVTFP-VAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPA 191

Query: 218 P--DXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGY 275
              D             NLFG +GY E EF  +  K++ + GFIIL ++++ GG  + GY
Sbjct: 192 KYRDAFVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGY 251

Query: 276 IGAKYWIHPGPFAHGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXX 335
           IG + W +PG FA+GFKGVC+VF  AAFS+ G E+V L+  E  +P  ++P+A K+    
Sbjct: 252 IGGRLWHNPGAFANGFKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAAKQVFWR 311

Query: 336 XXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKVVPHFINAVILIXX 395
                         LVPY                 FVI+I++ G+K +P  IN VILI  
Sbjct: 312 ITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAV 371

Query: 396 XXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKRE 455
                                   P+   +ID  GRP+   +++ +FG++ F+AAS K  
Sbjct: 372 LSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIAASPKEG 431

Query: 456 DVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIG 515
           +VF WLLA+SGLS LF W  + L HIR+R A+ +Q ++  E+ + A T  WGS  ++ + 
Sbjct: 432 EVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVWGSVYSLILI 491

Query: 516 FFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKID 575
              L+ QFW+A+ P+   G+     FF+ YL+FPI +V Y+GHKI+ KNW+L+I A  ID
Sbjct: 492 ILILIAQFWIALFPI--GGKPSAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLFIKASDID 549

Query: 576 LDSHRR 581
           +DS RR
Sbjct: 550 IDSGRR 555

>CAGL0D02178g 222597..224330 highly similar to sp|P38967
           Saccharomyces cerevisiae YOL020w SCM2 high affinity
           tryptophan transport protein, hypothetical start
          Length = 577

 Score =  323 bits (828), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 192/536 (35%), Positives = 282/536 (52%), Gaps = 20/536 (3%)

Query: 54  SEKPIASADTTVSTSKCNAKTYFQDFCHSFKRK-DSDLDSDVEAQDTQLSKTIKSRHLLM 112
           S+KP  S+  +        +  FQ    SFK   D   D+      + L +T+KSRHL+M
Sbjct: 22  SQKPYYSSGES-PEPVVTKRNIFQRCVDSFKPPVDGSFDT------SNLKRTLKSRHLIM 74

Query: 113 ISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFT 172
           I++G  I TGL +G+GQ LA  GP  +IIG+T++   I   IH  GE+ + +  +VG F 
Sbjct: 75  IAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVGTIHGLGEITVRFP-VVGAFA 133

Query: 173 RYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFW-TDVNPDXXXXXXXXXXXX 231
            Y +  +DPS+ F +S +Y +QW  VLPL+++ +AITI +W + ++P             
Sbjct: 134 DYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYWNSSIDPVVWVAIFYGVIVS 193

Query: 232 XNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAHGF 291
            NLFGARG+ E EF  +  K + I GFIIL IV+I GG     +IGAKYW  PG  AHGF
Sbjct: 194 INLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGGPDHEFIGAKYWHDPGALAHGF 253

Query: 292 KGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLV 351
            GV +V   A++S GG E+  L+  E  DP   +P+A K+                 FLV
Sbjct: 254 PGVLSVLVVASYSLGGTEMTCLASGET-DP-KELPSAIKQVFWRILFFFLASLTLVGFLV 311

Query: 352 PYDXXXXXXXXXXXXXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXX 411
           PY                 FVIAI+ H +K +P  +NAVILI                  
Sbjct: 312 PYTNENLLGGSSVDNSP--FVIAIKLHHIKALPSIVNAVILISILSVGNSCIFASSRTLC 369

Query: 412 XXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLF 471
                   P++  +ID  GRP+   + + LFG++ F+  S    +VF WL+AI+GL+   
Sbjct: 370 SMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFGLLAFLVKSSSVSEVFDWLMAIAGLATCI 429

Query: 472 IWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVE 531
           +W+S++LSHIR R AMK+Q K+LDE+ + +  G WGS  +  I    L+ QF++++ P+ 
Sbjct: 430 VWLSINLSHIRFRLAMKAQNKTLDELEFVSAVGIWGSAYSALINVLILIAQFYISLWPIG 489

Query: 532 --KHGELDVVNFFQNYLAFPIVLVAYLGHKIYYK----NWRLWIPADKIDLDSHRR 581
                      FFQ+YL   I+L+ +  HK+YY+     W    P   IDL++ R+
Sbjct: 490 GWTDSSQRAKKFFQSYLCALIMLLIFCIHKVYYRVSFGKWWDVKPLKDIDLETGRK 545

>CAGL0L03267g 372787..374580 highly similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, hypothetical start
          Length = 597

 Score =  323 bits (827), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 211/568 (37%), Positives = 303/568 (53%), Gaps = 27/568 (4%)

Query: 38  MVSIEIESTKKREIEVS-----EKPIASA---DTTVSTSKCNAKTYFQDFCHSFKRKD-- 87
           M S+E     K E+++      E+P+  +   +++ S     + + ++ F  SFK  D  
Sbjct: 1   MSSLEKTDLPKNELQIDSEFLREEPLEISNFEESSSSQGPQPSGSRWRKFKDSFKPLDEA 60

Query: 88  --SDLDSDVE-----AQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLI 140
             +D  SD+E          L   +K+RHL MI++G  I TGL VG+G  L  AGPAG++
Sbjct: 61  VVTDDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGIL 120

Query: 141 IGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLP 200
           IG+ ++  MIYC++ A GEL + +  + G FT Y +  ID S GFA +  Y LQWL VLP
Sbjct: 121 IGWGLTGTMIYCMVMAMGELSVVFP-ISGGFTTYATRFIDESFGFANNFNYMLQWLCVLP 179

Query: 201 LQLVTAAITISFW-TDVN-PDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGF 258
           L++V A+IT+++W TD    D             NLFG +GY E EF  +  K+L + GF
Sbjct: 180 LEIVAASITVNYWGTDPKYRDGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGF 239

Query: 259 IILSIVIITGGAGKDGYIGAKYWIHPGPF-----AHGFKGVCTVFTYAAFSYGGIEVVVL 313
           II+ IV+  GG  + GYIG KY+  PG F        F+GVC+VF  AAFS+ G E++ +
Sbjct: 240 IIMGIVLNCGGGPEGGYIGGKYFHDPGAFVGDTAGARFQGVCSVFVTAAFSFAGSELIGI 299

Query: 314 SIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVI 373
           +  E  +P  +VP A K+                  LVPY                 FVI
Sbjct: 300 AAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAAASPFVI 359

Query: 374 AIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPI 433
           AI SHG++ +P  +N VILI                          P+   +ID +GRP+
Sbjct: 360 AITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGRPL 419

Query: 434 RCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKS 493
                +  FG++ FVA S K  +VF WLLA+SGLS LF W  +   HIR R A+ +QG+S
Sbjct: 420 FGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQGRS 479

Query: 494 LDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLV 553
            DE+ +KA  G +GS   +F+     + QF+VA+ P    G+     FFQ+YL+FP+VL 
Sbjct: 480 TDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFP--PGGKPSAEVFFQSYLSFPVVLA 537

Query: 554 AYLGHKIYYKNWRLWIPADKIDLDSHRR 581
            Y GHK+Y +NW+L IP  K+D+D+ RR
Sbjct: 538 FYFGHKLYARNWKLLIPLSKLDIDTGRR 565

>YOL020W (TAT2) [4796] chr15 (286172..287950) High affinity
           tryptophan permease, also transports other aromatic
           amino acids, alanine and glycine, member of the amino
           acid permease family [1779 bp, 592 aa]
          Length = 592

 Score =  321 bits (823), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 189/516 (36%), Positives = 276/516 (53%), Gaps = 17/516 (3%)

Query: 73  KTYFQDFCHSFKRKDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLA 132
           +  FQ    SFK   S LD   +  +  L +T+K RHL+MI++G  I TGL VG+G+ +A
Sbjct: 55  RNIFQRCVDSFK---SPLDGSFDTSN--LKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIA 109

Query: 133 KAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYT 192
           + GP G++IG+ ++   I   IH  GE+ + +  +VG F  Y +  +DPS+ F +S +Y 
Sbjct: 110 EGGPLGVVIGWAIAGSQIIGTIHGLGEITVRFP-VVGAFANYGTRFLDPSISFVVSTIYV 168

Query: 193 LQWLTVLPLQLVTAAITISFW-TDVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCK 251
           LQW  VLPL+++ AA+T+ +W + ++P              NLFG RG+ E EF  +  K
Sbjct: 169 LQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIK 228

Query: 252 ILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAHGFKGVCTVFTYAAFSYGGIEVV 311
            + + GFIIL +V+I GG     +IGAKYW  PG  A+GF GV +V   A++S GGIE+ 
Sbjct: 229 AITVCGFIILCVVLICGGGPDHEFIGAKYWHDPGCLANGFPGVLSVLVVASYSLGGIEMT 288

Query: 312 VLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXF 371
            L+  E  DP   +P+A K+                 FLVPY                 F
Sbjct: 289 CLASGET-DP-KGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSSVDNSP--F 344

Query: 372 VIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGR 431
           VIAI+ H +K +P  +NAVILI                          P W  +ID  GR
Sbjct: 345 VIAIKLHHIKALPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGR 404

Query: 432 PIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQG 491
           P+   + + LFG++ F+  S    +VF WL+AI+GL+   +W+S++LSHIR R AMK+QG
Sbjct: 405 PLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQG 464

Query: 492 KSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVE--KHGELDVVNFFQNYLAFP 549
           KSLDE+ + +  G WGS  +  I    L+ QF+ ++ P+     G+     FFQNYL   
Sbjct: 465 KSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCAL 524

Query: 550 IVLVAYLGHKIYYK----NWRLWIPADKIDLDSHRR 581
           I+L  ++ HKIYYK     W        IDL++ R+
Sbjct: 525 IMLFIFIVHKIYYKCQTGKWWGVKALKDIDLETDRK 560

>KLLA0A10813g complement(936126..937880) similar to sp|P38967
           Saccharomyces cerevisiae YOL020w SCM2 high affinity
           tryptophan transport protein, hypothetical start
          Length = 584

 Score =  294 bits (752), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 194/571 (33%), Positives = 300/571 (52%), Gaps = 38/571 (6%)

Query: 26  ELDMSSIQG--EPSMVSIEIE-----STKKREIEVSEKPIASADTTVSTSKCNAKTYFQD 78
           E DMS +     PS   +E++      +K+ EI++ +K            +   K   + 
Sbjct: 5   EYDMSKMDNLLSPSSGDLEMKFSDGIMSKETEIDLDKK------------EDKNKNIVRR 52

Query: 79  FCHSFKRK-DSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPA 137
              SFK   D    SD       L + +KSRHL+MI++G  I TGL VG+G+ LA  GP 
Sbjct: 53  MIDSFKPPLDGSYHSD------NLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPL 106

Query: 138 GLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLT 197
            +IIG++++   +   IH  GE+ + +  +VG F  Y + L+DPS+ F +S +Y  QW  
Sbjct: 107 AMIIGWSIAGSQMVGTIHGLGEITMRFP-VVGAFANYSTRLLDPSISFMVSSIYICQWYF 165

Query: 198 VLPLQLVTAAITISFWT-DVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMIT 256
           VLP++L+ +A+T+ FWT  V+P              NLFG + + E EF  +  K++ I 
Sbjct: 166 VLPIELIASAMTVQFWTTKVDPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITII 225

Query: 257 GFIILSIVIITGGAGKDGYIGAKYWIHPGPFAHGFKGVCTVFTYAAFSYGGIEVVVLSID 316
           GFIILSI++I GG     +IG +YW HPG  A+GFKGV +VF  A++S GG E+V L   
Sbjct: 226 GFIILSIILICGGGPDHRFIGTEYWHHPGALANGFKGVASVFVTASYSLGGSEMVCLC-S 284

Query: 317 EQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIE 376
            + DP   +P+A K+                 FLVPY                 FVIAI+
Sbjct: 285 AETDP-KELPHAIKQVFWRIVFFFLVSLTLVGFLVPY--TNENLLGGSSVNNSPFVIAIK 341

Query: 377 SHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCF 436
             G++V+P  INAVILI                          P+   ++D  GRP+   
Sbjct: 342 LSGIRVLPSIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGI 401

Query: 437 IISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDE 496
           I++ LFG++ F+  S     VF WL+AI+GL+   +W+S+++SHIR R AMK+Q +SLDE
Sbjct: 402 IVNSLFGLLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDE 461

Query: 497 IGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVE--KHGELDVVNFFQNYLAFPIVLVA 554
           + +K+  G +GS  +  +    L+ QF++++ PV      +    +FF+NYL   +++  
Sbjct: 462 LEFKSSVGVYGSIYSATVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVFV 521

Query: 555 YLGHKIYYK----NWRLWIPADKIDLDSHRR 581
           ++ HKIY+K     W  + P  +IDL++ R+
Sbjct: 522 FVTHKIYFKCSTGKWFDFKPLAEIDLETDRK 552

>Kwal_34.16254
          Length = 481

 Score =  288 bits (736), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 169/469 (36%), Positives = 247/469 (52%), Gaps = 21/469 (4%)

Query: 50  EIEVSEKPIASADTTVSTSKCN--------AKTYFQDFCHSFKR-KDSDLDSDVEAQDTQ 100
           E   S + I S+D +  T+  N         +   Q    SFK  +D    SD       
Sbjct: 19  EAYASGQEIKSSDFSEKTTPENDGVRRRSTNRNVLQRMVDSFKPPEDGSFHSD------N 72

Query: 101 LSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGEL 160
           L K++K+RHL+MI++G  I TGL +G+G+ LA  GP  LIIG+T++   +   IH  GE+
Sbjct: 73  LKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGTIHGLGEI 132

Query: 161 GICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFW-TDVNPD 219
            + +  +VG F  Y +  ++PS+ F + L+Y LQW  VLPL+++ AA+T+ +W T V+P 
Sbjct: 133 TVRFP-VVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDTSVSPV 191

Query: 220 XXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAK 279
                        NL G RG+ E EF  +  K++ I GFIIL IV+I GG  K  ++GAK
Sbjct: 192 VWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKKEFVGAK 251

Query: 280 YWIHPGPFAHGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXX 339
           YW  PGP A+GFKGV  V   A++S GG E+  L+  E  DP   +P+A K+        
Sbjct: 252 YWHDPGPLANGFKGVAGVLVIASYSLGGTEMACLASGET-DP-KELPSAIKQVFWRIVFF 309

Query: 340 XXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKVVPHFINAVILIXXXXXX 399
                    FLVPY                 FVIAI  HG+  +P  +NAVIL+      
Sbjct: 310 FLVSLTLVGFLVPYT--NQNLMGGSSVDNSPFVIAIRLHGINALPSIVNAVILVSLLSVG 367

Query: 400 XXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFT 459
                               P+   +ID  GRP+   + ++LFG++ F+  S    DVFT
Sbjct: 368 NSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFLVKSGSAGDVFT 427

Query: 460 WLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGS 508
           WL+AI+GL+   +W+S+++SHIR R AMK+QG  L+E+ + +  G +GS
Sbjct: 428 WLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEFVSGVGIYGS 476

>Kwal_56.22951
          Length = 596

 Score =  281 bits (718), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 187/545 (34%), Positives = 281/545 (51%), Gaps = 27/545 (4%)

Query: 60  SADTTVSTSKCNAKTYFQDFCHSFKRK--------DSDLDSDVEAQDTQLS-----KTIK 106
           ++ + ++  K  ++    D  HSF+R+        D  L S+ + ++ +L+     K++ 
Sbjct: 26  TSGSLINRFKQKSRRQIHDIAHSFQRQEAPNSEGVDLSLLSEEQRRNYELANQPYEKSLS 85

Query: 107 SRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRG 166
            RHL+MIS+G  + TGL +G G  LA +GP  L+IG+ +  +M++C++ +A E+  C   
Sbjct: 86  QRHLMMISIGGTLGTGLFIGLGFSLA-SGPGSLLIGFLIVGLMMFCVVQSAAEMA-CQYP 143

Query: 167 LVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDVNPDXXXXXXX 226
           + G+F+ + S  ++PS+GF +S  Y L WL   P +L+  AIT+ +W+ VN         
Sbjct: 144 VSGSFSTHVSRFMEPSIGFTVSTNYALAWLISFPSELIGCAITLRYWSSVNGAVWVAIFY 203

Query: 227 XXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGA-GKDGYIGAKYWIHPG 285
                 NLFG RGY E EF+ +  K++ I  FII+ IV+I GG     GYIG KYW +PG
Sbjct: 204 VFIMQLNLFGVRGYGEAEFWMSLFKVVAIVIFIIIGIVLICGGGPHSSGYIGTKYWHNPG 263

Query: 286 PFAHG-FKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXX 344
            FA   FKG+C  F  AAFS+GG E+VVL+  E +  V +V  A K              
Sbjct: 264 SFAKPVFKGLCNTFISAAFSFGGAELVVLTASESKK-VESVSRAAKGTFWRIAIFYITTV 322

Query: 345 XXXCFLVPY-DXXXXXXXXXXXXXXXXFVIAIESHGV--KVVPHFINAVILIXXXXXXXX 401
                LVPY D                FVIA+   G     V HF+NAVILI        
Sbjct: 323 VVIGCLVPYTDDRLLGGDTGEDITASPFVIALSGQGSMGTKVSHFMNAVILIAVLSVCNS 382

Query: 402 XXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWL 461
                             P+   +ID  GRP+    I  +FG++GF+ A DK++DVFTWL
Sbjct: 383 CVYASSRVIQALGACGQLPRACGYIDKKGRPLVGIAICGVFGLLGFLVACDKQDDVFTWL 442

Query: 462 LAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVT 521
            A+  +S  F W  + +S +R R A+++QG+S DEI +K+  G +G  L   +    +  
Sbjct: 443 FALCSISSFFTWFCICVSQVRFRLALRAQGRSTDEIAHKSMLGIYGGILGGVLNILLIAG 502

Query: 522 QFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNW----RLWIPADKIDLD 577
           + +V+I P+   G      FFQ  ++ PI++V Y  HK Y        R+ +P  +IDLD
Sbjct: 503 EIYVSIFPL--GGSPSAEQFFQYCMSIPIMIVVYALHKTYKATRRDAKRILVPLSEIDLD 560

Query: 578 SHRRI 582
           S RRI
Sbjct: 561 SGRRI 565

>YLL061W (MMP1) [3363] chr12 (17956..19707) High affinity
           S-methylmethionine permease, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1752 bp, 583 aa]
          Length = 583

 Score =  276 bits (705), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 191/559 (34%), Positives = 275/559 (49%), Gaps = 35/559 (6%)

Query: 42  EIESTKKREIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKDS----------DLD 91
           E ESTK  +++ S        + +ST           F +SFKR DS          +L 
Sbjct: 3   EFESTKLSKVQFST-------SVLSTPSNEGNNLIHRFKNSFKRNDSPAIQEGLLYSELS 55

Query: 92  SDVEAQ----DTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSS 147
            + + Q    +    K +  RHL MI++G  + TGL +G G+ LA +GPA L+IG+ +  
Sbjct: 56  EEEKIQWDLANQPYKKVLDQRHLTMIAIGGTLGTGLFIGLGESLA-SGPASLLIGFLLVG 114

Query: 148 IMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAA 207
             + C++    EL  C   + G++  + S  IDPS+GF+I + Y L WL   P +LV  +
Sbjct: 115 ASMLCVVQCGAELS-CQYPVSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCS 173

Query: 208 ITISFWT-DVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVII 266
           +TIS+W   VNP              NLFGARG+AE+EF+ +  KI+ +  FII+ IV+I
Sbjct: 174 LTISYWAPSVNPAAWVAIAFVLSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIVLI 233

Query: 267 TGGAGKD--GYIGAKYWIHPGPFAHG-FKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVS 323
            GG G D  GYIG KYW  PG FA   FK +C  F  AA+S+ G E+VVL+  E    VS
Sbjct: 234 AGG-GPDSTGYIGTKYWHDPGSFAVPVFKNLCNTFVSAAYSFSGTEMVVLTSTEARS-VS 291

Query: 324 AVPNACKKXXXXXXXXXXXXXXXXCFLVPY-DXXXXXXXXXXXXXXXXFVIAIESHGV-- 380
           +V  A K                   LVPY D                FVIA+ + G   
Sbjct: 292 SVSRAAKGTFWRIIIFYIVTVIIIGCLVPYNDPRLISGSSSEDITASPFVIALSNTGAMG 351

Query: 381 KVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISI 440
             V HF+NAVILI                          P+   ++D NGRP+    I  
Sbjct: 352 TRVSHFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPKICAYMDRNGRPLVGMAICG 411

Query: 441 LFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYK 500
            FG++GF+  S  +  VFTWL A+  +S    W  +    +R R AMK+QG+S D+I Y+
Sbjct: 412 AFGLLGFLVVSKNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYR 471

Query: 501 AQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKI 560
           +  G +G      +    ++ + +V+ APV         NFF+  ++ PI++  Y+GH+I
Sbjct: 472 STLGIYGGIFGCILNVLLVIGEIYVSAAPVGSPS--SAANFFEYCMSIPIMIAVYIGHRI 529

Query: 561 YYKNWRLW-IPADKIDLDS 578
           Y ++WR W I    IDLDS
Sbjct: 530 YRRDWRHWYIKRMDIDLDS 548

>KLLA0B06776g 594172..595938 similar to sgd|S0006195 Saccharomyces
           cerevisiae YPL274w SAM3 high affinity
           S-adenosylmethionine permease, start by similarity
          Length = 588

 Score =  270 bits (690), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 187/553 (33%), Positives = 277/553 (50%), Gaps = 31/553 (5%)

Query: 48  KREIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRK--------DSDLDSDVEAQDT 99
           K   +VSE    S    + T +  +++ F     SFKR+        D D  S  + Q T
Sbjct: 10  KDPTQVSENFTQS----LYTDEDGSRSLFTRVKDSFKRQELVETEGIDLDTYSMTDYQRT 65

Query: 100 QL-------SKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYC 152
                     K +  RHL MI++G  + TGL +G G  LA +GP  L+IG+ ++ + I+C
Sbjct: 66  NYLLAKQPYQKNLSQRHLTMIAIGGTLGTGLFIGIGWSLA-SGPGNLLIGFLLTGLAIFC 124

Query: 153 IIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISF 212
           ++  A EL  C   + G+F  + S  +DPS GF ++  Y L W    P +L+  A+TI +
Sbjct: 125 VVQCAAELS-CQYPVSGSFASHVSRFVDPSWGFTVTTNYCLAWSISFPSELIGCAMTIGY 183

Query: 213 W-TDVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGA- 270
           W + VNP              NLFG RG+AETE+  +  KIL I  F+I+ +V+I GG  
Sbjct: 184 WDSSVNPVVWVIIFWLFIMALNLFGVRGFAETEYVLSIFKILAIIIFLIIGVVLICGGGP 243

Query: 271 GKDGYIGAKYWIHPGPF-AHGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNAC 329
             +GYIG KYW  PG F A  FK +C  F  AAFS+GG E+VVL+  E    V ++  A 
Sbjct: 244 NSNGYIGTKYWHDPGSFKAPVFKSLCNTFVSAAFSFGGTELVVLTAAESRK-VESISRAA 302

Query: 330 KKXXXXXXXXXXXXXXXXCFLVPY-DXXXXXXXXXXXXXXXXFVIAIESHGV--KVVPHF 386
           K                   LVPY D                FVIA+ + G   + V +F
Sbjct: 303 KGTFWRVIVFYVSTVVVIGCLVPYTDERLLGGDTSEDIAASPFVIALANTGKFGERVSNF 362

Query: 387 INAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIG 446
           +NAVILI                          P    ++D  GRP+   ++  LFG + 
Sbjct: 363 MNAVILIAVLSVCNSCVYAASRVIQSLGASGQLPSICGYVDRKGRPLFGILVVGLFGFLP 422

Query: 447 FVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYW 506
           F+ AS+K  +VF WL A+  +S +FIW S+  S++R R A+K Q +S DEI YK+  G W
Sbjct: 423 FIVASNKVSEVFDWLFALCSISSMFIWFSICYSYLRYRWALKKQNRSADEIAYKSMLGIW 482

Query: 507 GSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWR 566
           G++L + +    +V + +V++ P+ +    +   FF+  L+ PI++  Y+GHK Y  NW+
Sbjct: 483 GAYLGLLLSALLIVGEIYVSLFPLGESPSAEA--FFKYCLSIPIMIAVYIGHKSYTGNWK 540

Query: 567 LW-IPADKIDLDS 578
            + IP   IDLD+
Sbjct: 541 SFVIPLSGIDLDT 553

>YPL274W (SAM3) [5177] chr16 (22938..24701) High affinity
           S-adenosylmethionine permease, member of the amino acid
           permease family of membrane transporters [1764 bp, 587
           aa]
          Length = 587

 Score =  260 bits (664), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 180/542 (33%), Positives = 273/542 (50%), Gaps = 26/542 (4%)

Query: 58  IASADTTVSTSKCNAKTYFQDFCHSFKRKD-----SDLDSDVEAQDTQLS---------K 103
           I +  TT+      + +  +    SFK+ +      DL++  + +  ++          K
Sbjct: 16  IETESTTIPNDSDRSGSLIRRMKDSFKQSNLHVIPEDLENSEQTEQEKIQWKLASQPYQK 75

Query: 104 TIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGIC 163
            +  RHL MI++G  + TGL +G G  LA +GPA L+IG+ +    ++C++ +A EL  C
Sbjct: 76  VLSQRHLTMIAIGGTLGTGLFIGLGYSLA-SGPAALLIGFLLVGTSMFCVVQSAAELS-C 133

Query: 164 YRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTD-VNPDXXX 222
              + G++  + S  ID S+GF ++  Y L WL   P +L+  A+TIS+W   VNP    
Sbjct: 134 QFPVSGSYATHVSRFIDESVGFTVATNYALAWLISFPSELIGCALTISYWNQTVNPAVWV 193

Query: 223 XXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGA-GKDGYIGAKYW 281
                     NLFG RG+AETEF  +  K++ I  FII+ IV+I GG     GYIGAKYW
Sbjct: 194 AIFYVFIMVLNLFGVRGFAETEFALSIIKVIAIFIFIIIGIVLIAGGGPNSTGYIGAKYW 253

Query: 282 IHPGPFAHG-FKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXX 340
             PG FA   FK +C  F  AAFS+GG E+V+L+  E ++ +SA+  A K          
Sbjct: 254 HDPGAFAKPVFKNLCNTFVSAAFSFGGSELVLLTSTESKN-ISAISRAAKGTFWRIAIFY 312

Query: 341 XXXXXXXCFLVPY-DXXXXXXXXXXXXXXXXFVIAIESHGV--KVVPHFINAVILIXXXX 397
                    LVPY D                FVIA+ + G     V +F+N VIL+    
Sbjct: 313 ITTVVIIGCLVPYNDPRLLSGSNSEDVSASPFVIALSNTGSMGAKVSNFMNVVILVAVVS 372

Query: 398 XXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDV 457
                                 P   +++D  GRP+    IS  FG++GF+ AS K ++V
Sbjct: 373 VCNSCVYASSRLIQALGASGQLPSVCSYMDRKGRPLVGIGISGAFGLLGFLVASKKEDEV 432

Query: 458 FTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFF 517
           FTWL A+  +S  F W  + +S IR R A+K+QG+S DEI YK+  G +G  L   +   
Sbjct: 433 FTWLFALCSISSFFTWFCICMSQIRFRMALKAQGRSNDEIAYKSILGVYGGILGCVLNAL 492

Query: 518 SLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWR-LWIPADKIDL 576
            +  + +V+ APV      +   FF+  L+ PI++V Y  H+ Y ++W+  +I   +IDL
Sbjct: 493 LIAGEIYVSAAPVGSPSSAEA--FFEYCLSIPIMIVVYFAHRFYRRDWKHFYIKRSEIDL 550

Query: 577 DS 578
           D+
Sbjct: 551 DT 552

>AER405C [2905] [Homologous to ScYPL274W (SAM3) - NSH]
           (1413790..1415283) [1494 bp, 497 aa]
          Length = 497

 Score =  244 bits (624), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 158/477 (33%), Positives = 246/477 (51%), Gaps = 19/477 (3%)

Query: 112 MISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNF 171
           MIS+G  + TGL +G GQ L ++GP  L+IG+ +  + I+C+I +A EL  C   + G+F
Sbjct: 1   MISIGGTLGTGLFIGIGQSL-QSGPGTLLIGFLIVGVSIFCVIQSAAELS-CQYPVSGSF 58

Query: 172 TRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWT-DVNPDXXXXXXXXXXX 230
           + + S  I+PSLGF +S  Y L WL   P +LV  A+TI +W  D+ P            
Sbjct: 59  SSHVSRFIEPSLGFTVSCAYALSWLISFPNELVGLAMTIGYWNEDIPPAVWVLIGYLLVI 118

Query: 231 XXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGA--GKDGYIGAKYWIHPGPFA 288
             NLF  RG+AE+EF+ +  K+L I  F+I+ IVII GG    K+GY+G KYW  PG F 
Sbjct: 119 GLNLFAVRGFAESEFWLSIIKVLAIIIFLIIGIVIICGGGPNNKEGYLGGKYWHDPGAFR 178

Query: 289 HGF-KGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXX 347
             F   +C  F  AAF++GG E+V+L+ +E    + ++  A K                 
Sbjct: 179 PPFFSSLCQTFVSAAFTFGGAELVLLTANESRK-IESISRAAKGTFWRIAIFYISTVIVI 237

Query: 348 CFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGV--KVVPHFINAVILIXXXXXXXXXXXX 405
             LVPY                 FVIA+ + G     V HF+NAVI+             
Sbjct: 238 GCLVPYTSPALDGESIRASP---FVIALSNTGSFGTNVSHFMNAVIVAAVLSVCNSCVYA 294

Query: 406 XXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAIS 465
                         P+   +ID  GRP+    +  +FG++ F+  + K +DVF WL A+ 
Sbjct: 295 ASRVIQSLGACGQLPEIFGYIDKKGRPLVGIGVCAVFGLLAFLVETTKVKDVFNWLFALC 354

Query: 466 GLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWV 525
            ++  F+W  + +S +R R A+K QG   +EI Y++  G W   +   + F  +  + +V
Sbjct: 355 SIAAFFVWFCICVSQLRYRRALKVQGFPTEEIAYQSMLGKWSGVIGTLLNFLLICGEIYV 414

Query: 526 AIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLW-IPADKIDLDSHRR 581
           ++    K G  DV  FFQN ++ P++++ Y  H++Y ++W+ W IPA  +DL++ R+
Sbjct: 415 SV----KDG--DVETFFQNCMSIPLLIIFYFCHRLYRRDWKTWLIPARDLDLNTGRK 465

>Scas_520.2*
          Length = 372

 Score =  215 bits (548), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 126/350 (36%), Positives = 177/350 (50%), Gaps = 18/350 (5%)

Query: 238 RGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPF-AHG----FK 292
           + + ETEF  +  +IL I GF IL IV+  GG     +I  +YW +PG F  H     FK
Sbjct: 3   KSFGETEFVLSMVRILAIIGFTILGIVLACGGGPHGSFIDGQYWNYPGSFVGHNSGTKFK 62

Query: 293 GVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVP 352
           G+C+VF  AAFSY GIE+  +S  E +DP   +P A K+                CF VP
Sbjct: 63  GLCSVFVIAAFSYSGIEMTAVSPVENKDPRITIPKAAKRTFVLIG----------CF-VP 111

Query: 353 YDXXXXXXXXXXXXXXXX-FVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXX 411
           YD                  VIAIE+ G K +   +NA+ILI                  
Sbjct: 112 YDNPRLLSRTSFVDAASSPLVIAIENGGNKGLLTLMNAIILISIISVANSAVYTCSRCMV 171

Query: 412 XXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLF 471
                   P+ LN +D  GRP+   I ++ FG++ FVAASD++ DVFTWL A+SGL  +F
Sbjct: 172 AMVHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFTWLSALSGLFTIF 231

Query: 472 IWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVE 531
            WM+++LSHIR+R AM  Q +SLDE+ + +QTG WGSW    + F  LV  FW ++ P+ 
Sbjct: 232 RWMAINLSHIRVRQAMAKQNRSLDELPFLSQTGVWGSWYGTIVLFSDLVASFWTSLFPLG 291

Query: 532 KHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRR 581
                D   FF+ +     ++   L   +Y +     +    +DLD+ RR
Sbjct: 292 GTSA-DAELFFEVFFTVSHLISMLLCPNLYMRKREFMVGLTDMDLDTGRR 340

>Scas_536.1
          Length = 372

 Score =  211 bits (537), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 132/336 (39%), Positives = 186/336 (55%), Gaps = 7/336 (2%)

Query: 251 KILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPF-AHG----FKGVCTVFTYAAFSY 305
           K+  + GFIIL IV++ GG  K G++GAKYW  PG F  HG    FKGVC+VF  AAFS+
Sbjct: 7   KVTTVIGFIILGIVLVCGGGPKGGFVGAKYWHDPGAFVGHGSGAQFKGVCSVFVTAAFSF 66

Query: 306 GGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXX 365
            G E++ ++  E  +P  ++P A K+                  LVPY+           
Sbjct: 67  AGSELIGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVD 126

Query: 366 XXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNF 425
                FVIAI +HG+K +P  IN VILI                          P+   +
Sbjct: 127 AAASPFVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGY 186

Query: 426 IDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRD 485
           ID +GRP+    I+  FG++ FVAAS K  +VF WLLA+SGLS LF W  + L HIR R 
Sbjct: 187 IDRSGRPLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRM 246

Query: 486 AMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNY 545
           A+K+QG+  +E+ + +  G  GS+  +F+     + QF+VA+ P    G+ D   FFQ+Y
Sbjct: 247 ALKAQGRDTNELTFVSPAGVAGSYWGLFMIVLMFIAQFYVALFP--PGGKPDAEVFFQSY 304

Query: 546 LAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRR 581
           L+FPIV+  Y GHKIY +NW+L+IP + +D+D+ RR
Sbjct: 305 LSFPIVVATYFGHKIYKRNWKLFIPLEDMDIDTGRR 340

>AFR667C [3860] [Homologous to ScYNL268W (LYP1) - SH]
           (1657064..1658755) [1692 bp, 563 aa]
          Length = 563

 Score =  215 bits (548), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 152/556 (27%), Positives = 241/556 (43%), Gaps = 49/556 (8%)

Query: 58  IASADTTVSTSKCNAKTYFQDFCHSFKRKDSDLDSDVEAQ-------------------- 97
           +A  DT VS +   ++         + +K   L++D+E Q                    
Sbjct: 1   MAPKDTAVSETSTRSR---------YIKKGKTLENDIELQSVTPATGEFPEDHTEEGDYQ 51

Query: 98  DTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAA 157
           +T++ + +K+RH+ MI+LG  I TGL +     L  AGP G ++ Y     ++Y I  + 
Sbjct: 52  ETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYSITQSL 111

Query: 158 GELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDVN 217
           GE+   +  +  + T +    + P+ G A   +Y   W     ++L      I +WTD  
Sbjct: 112 GEMA-TFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYWTDRV 170

Query: 218 PDXXXXXXX-XXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYI 276
           P               N F  R Y E EF+    K+L I G++I + +I+ GG+ K G I
Sbjct: 171 PIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGS-KQGPI 229

Query: 277 G-----------AKYWIHPGPFAHGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAV 325
           G           A+         HGF G  +    AAF+Y G E+V ++  E  +P   V
Sbjct: 230 GLPATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGESTNPRKNV 289

Query: 326 PNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKVVPH 385
           P A  K                  LVPYD                FVI+I++ G K++P 
Sbjct: 290 PKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDVNASPFVISIKNAGTKILPD 349

Query: 386 FINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMI 445
             NAV+LI                          P+ L F+   G P    +I+ L G++
Sbjct: 350 IFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLITSLMGLM 409

Query: 446 GFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGY 505
            F+  +      F WL+ IS L+ L  W+ +SL+HIR    +K +G S D++ +KA+   
Sbjct: 410 SFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKAKFMP 469

Query: 506 WGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNW 565
           W ++ A F     +  Q + A  P     + DV  FF +Y++  ++L+ ++G +IYYK  
Sbjct: 470 WAAYYATFFVTVIIFIQGYTAFTP-----KFDVTTFFTSYISLFLMLLVFIGCQIYYKCR 524

Query: 566 RLWIPADKIDLDSHRR 581
            LW   D ID+DS RR
Sbjct: 525 FLWAVED-IDIDSDRR 539

>Scas_706.37
          Length = 544

 Score =  212 bits (539), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 154/523 (29%), Positives = 236/523 (45%), Gaps = 28/523 (5%)

Query: 77  QDFCHSFKRKDSD-------LDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQ 129
           Q   HSF+   +D       LD D E Q   + + +K RH+ MI+LG  I TGL +G  +
Sbjct: 5   QPQVHSFQVDSNDTPTTISTLDDDQEKQQ-DVKRELKKRHISMIALGGTIGTGLFLGIAR 63

Query: 130 VLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISL 189
            L  AGP G +I Y     +++ +  + GE+   +  +  +FT +    + P+ G A   
Sbjct: 64  PLIIAGPIGALIAYLFMGTVVFSVTQSLGEM-CTFIPVTASFTVFAQRFLSPAFGAANGY 122

Query: 190 LYTLQWLTVLPLQLVTAAITISFWTDVNP-DXXXXXXXXXXXXXNLFGARGYAETEFFCN 248
           +Y   W     L+L      I FWT   P               NLF  R Y E EF+  
Sbjct: 123 MYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIA 182

Query: 249 CCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAHG----------FKGVCTVF 298
             K+L I GFII  I II G AG  G +G +YW +PGP+  G          F G  +  
Sbjct: 183 SVKVLAILGFIIYGICIICG-AGVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSL 241

Query: 299 TYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXX 358
             AAF++ G E+V ++  E ++P   VP A KK                  LVPY+    
Sbjct: 242 INAAFTFQGTELVGITAGEAKNPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL 301

Query: 359 XXXXXXXXXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXX 418
                       F+I I++ G K++PH  NAVILI                         
Sbjct: 302 QSNDSYVSSSP-FIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKA 360

Query: 419 XPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSL 478
            P++       G P    + + +FG + ++  +   +  FTWLL I G++  F W+ +S 
Sbjct: 361 APKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISC 420

Query: 479 SHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDV 538
           SHIR   A+K +G S +++ YKA    W ++ AVF     +V Q + + AP     +  V
Sbjct: 421 SHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKV 475

Query: 539 VNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRR 581
            NFF  Y++  + ++ ++  +I++K   +W   D +DLD+ RR
Sbjct: 476 ANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQD-VDLDTDRR 517

>Scas_706.36d
          Length = 607

 Score =  211 bits (538), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 151/572 (26%), Positives = 250/572 (43%), Gaps = 21/572 (3%)

Query: 22  KGCAELDMSSIQGEPSMVSIEIESTKKREIEVSEKPIASADTTVSTSKCNAKTYFQD-FC 80
           K   E+  S+   + S     IE  K   +E  +K IA  +   S       +  +    
Sbjct: 21  KHVTEIHTSTEDEQTSPDDHSIEIIKNEILEKDKKKIAHTNQFSSDIHSITDSLARSRLP 80

Query: 81  HSFKRKDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLI 140
           H     D +   + +  DT++ + +K RH+ MI+LG  I TGL VG    L  +GP G +
Sbjct: 81  HLGDDDDEEDAEEAQYHDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSL 140

Query: 141 IGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLP 200
           I Y     +IY I  + GE+   +  +  + T +    + P+ G A   +Y   W     
Sbjct: 141 IAYLFMGSIIYSITQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYA 199

Query: 201 LQLVTAAITISFWTDVNP-DXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFI 259
           +++      I +WT   P               N F  + Y E EF+    K+L I G++
Sbjct: 200 VEISVVGQVIEYWTKKVPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYL 259

Query: 260 ILSIVIITGGAGKDGYIGAKYWIHPGPFAHG----------FKGVCTVFTYAAFSYGGIE 309
           + +++I+ GG+ + G IG +YW +PGP+  G          F G  +    AAF+Y G E
Sbjct: 260 LYALIIVCGGSSQ-GPIGFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTE 318

Query: 310 VVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXX 369
           +V ++  E  +P  +VP A  K                  LVPYD               
Sbjct: 319 LVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASSP 378

Query: 370 XFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMN 429
            FVI+I++ G K++P   NA+++I                          P+   ++  +
Sbjct: 379 -FVISIQNAGTKILPDIFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRH 437

Query: 430 GRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKS 489
           G P    + +   G++ F+  ++     F WL+ IS L+ L  W+ +S+SHIR   A+K 
Sbjct: 438 GVPYLGVLCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKF 497

Query: 490 QGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFP 549
           +G S D++ +KA+   W ++ A F     +  Q + A +P       DV  FF  Y++  
Sbjct: 498 RGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGFQAFSP-----HFDVTAFFTAYISLI 552

Query: 550 IVLVAYLGHKIYYKNWRLWIPADKIDLDSHRR 581
           I+ V ++G +IYY+    W   D ID+D+ RR
Sbjct: 553 ILAVLFIGCQIYYRCRFFWKLED-IDIDTDRR 583

>CAGL0J08162g complement(801555..803348) Highly similar to sp|P32487
           Saccharomyces cerevisiae YNL268w LYP1 or sp|P04817
           Saccharomyces cerevisiae YEL063c CAN1 or sp|P38971
           Saccharomyces cerevisiae YNL270c ALP1, hypothetical
           start
          Length = 597

 Score =  210 bits (534), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 140/496 (28%), Positives = 226/496 (45%), Gaps = 20/496 (4%)

Query: 97  QDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHA 156
            DT++ + +K RH+ MI+LG  I TGL VG    L+ +GP G +I Y     +IY +  +
Sbjct: 87  HDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQS 146

Query: 157 AGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDV 216
            GE+   +  +  + T +    + P+ G A   +Y   W     +++      I +WT  
Sbjct: 147 LGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFK 205

Query: 217 NP-DXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGY 275
            P               N F  + Y E EF+    K++ I G++I +++I+ GG+   G 
Sbjct: 206 VPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGS-HQGP 264

Query: 276 IGAKYWIHPGPFAHG----------FKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAV 325
           IG +YW +PG    G          F G  +    AAF+Y G E+V ++  E  +P  +V
Sbjct: 265 IGFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 324

Query: 326 PNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKVVPH 385
           P A  K                  LVPY+                FVI+I++ G KV+P 
Sbjct: 325 PRAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASSP-FVISIQNAGTKVLPD 383

Query: 386 FINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMI 445
             NAV+L+                          P+   ++  +G P    I + L G++
Sbjct: 384 IFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLL 443

Query: 446 GFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGY 505
            F+  +      F WL+ IS L+ L  W+ +SL+HIR   A+K +G S D++ +KA+   
Sbjct: 444 AFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMP 503

Query: 506 WGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNW 565
           WG++ A F     +  Q + A AP     + DV  FF  Y++  +++V + G ++YY+  
Sbjct: 504 WGAYYASFFVTVIIFIQGFQAFAP-----KFDVSEFFTAYISLILLVVLFAGCQLYYRCR 558

Query: 566 RLWIPADKIDLDSHRR 581
            LW   D ID+DS RR
Sbjct: 559 FLWKLED-IDIDSDRR 573

>YNL268W (LYP1) [4340] chr14 (138549..140384) High affinity lysine
           permease, also transports methionine [1836 bp, 611 aa]
          Length = 611

 Score =  210 bits (535), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 148/551 (26%), Positives = 243/551 (44%), Gaps = 34/551 (6%)

Query: 45  STKKREIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKDSDLDSDVEA---QDTQL 101
           +TKK+   +    IA  +     S  N+ T  Q   H     ++D++ D E    +D  +
Sbjct: 57  NTKKKHGSLQGGAIADVN-----SITNSLTRLQVVSH-----ETDINEDEEEAHYEDKHV 106

Query: 102 SKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELG 161
            + +K RH+ MI+LG  I TGL VG    L+ AGP G +I Y     ++Y +  + GE+ 
Sbjct: 107 KRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVYFVTQSLGEMA 166

Query: 162 ICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDVNP-DX 220
             +  +  + T +    + P+ G +   +Y   W     +++      I +WTD  P   
Sbjct: 167 -TFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTDKVPLAA 225

Query: 221 XXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKY 280
                       N F  + Y E EF+    K+L I G++I +++I+ GG+   G IG +Y
Sbjct: 226 WIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCGGS-HQGPIGFRY 284

Query: 281 WIHPGPFAHG----------FKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACK 330
           W +PG +  G          F G  +    AAF+Y G E+V ++  E  +P   VP A  
Sbjct: 285 WRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIN 344

Query: 331 KXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKVVPHFINAV 390
           K                  LVPY+                FVI+I++ G   +P   NAV
Sbjct: 345 KVVFRIVLFYIMSLFFIGLLVPYNDSRLSASSAVIASSP-FVISIQNAGTYALPDIFNAV 403

Query: 391 ILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAA 450
           +LI                          P+   ++   G P    + +   G++ F+  
Sbjct: 404 VLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALGLLAFLVV 463

Query: 451 SDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWL 510
           ++     F WL+ IS L+ L  W+ +SL+HIR   A+K +G S D++ +KA+   +G++ 
Sbjct: 464 NNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKAKLMPYGAYY 523

Query: 511 AVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIP 570
           A F     +  Q + A  P        V  FF +Y++  ++ V ++G +IYYK   +W  
Sbjct: 524 AAFFVTVIIFIQGFQAFCP------FKVSEFFTSYISLILLAVVFIGCQIYYKCRFIWKL 577

Query: 571 ADKIDLDSHRR 581
            D ID+DS RR
Sbjct: 578 ED-IDIDSDRR 587

>Kwal_33.13411
          Length = 560

 Score =  207 bits (527), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 134/502 (26%), Positives = 227/502 (45%), Gaps = 20/502 (3%)

Query: 91  DSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMI 150
           D + + Q+ Q+ + +K RH+ MI+LG  I TGL VG    L+ AGP G +I Y     ++
Sbjct: 44  DDEGDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIV 103

Query: 151 YCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITI 210
           Y +  + GE+   +  +  + T + +  + P+ G A   +Y   W     +++      I
Sbjct: 104 YFVTQSMGEMA-TFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVI 162

Query: 211 SFWTDVNP-DXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGG 269
            +WT   P               N F  R Y E EF+    K++ I G+++ +++I+ GG
Sbjct: 163 QYWTKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGG 222

Query: 270 AGKDGYIGAKYWIHPGPFAHG----------FKGVCTVFTYAAFSYGGIEVVVLSIDEQE 319
           + K G IG +YW +PGP+  G          F G       A+F+Y G E+V ++  E  
Sbjct: 223 S-KQGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAA 281

Query: 320 DPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHG 379
           +P   VP A  K                  LVPY+                FVI+I+S G
Sbjct: 282 NPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGLDKHTSVIASSP-FVISIQSAG 340

Query: 380 VKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIIS 439
            +++P   NAV+L+                          P+  +++   G P    I +
Sbjct: 341 TRILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICT 400

Query: 440 ILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGY 499
            L G++ F+   D   + F WL+ IS L+ L  W+ +S+SHIR    +K +G S D++ +
Sbjct: 401 ALLGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPF 460

Query: 500 KAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHK 559
           K++   +G++ A F     +  Q + A  P     +  V  FF  Y++  ++ V +   +
Sbjct: 461 KSKLMPYGAYYAAFWVAVIIFVQGFQAFCP-----KFKVAEFFTGYISLILLAVVFCLAQ 515

Query: 560 IYYKNWRLWIPADKIDLDSHRR 581
           +YY+  R +   + ID+DS RR
Sbjct: 516 LYYRC-RFFNRLEDIDIDSDRR 536

>Kwal_33.13401
          Length = 559

 Score =  205 bits (522), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 138/507 (27%), Positives = 228/507 (44%), Gaps = 21/507 (4%)

Query: 86  KDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTV 145
           +DS L S    ++  + + +K RH+ MI+LG  I TGL +G    L  AGP G +I Y  
Sbjct: 39  QDSQLGSSGHGRNA-VQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLF 97

Query: 146 SSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVT 205
              + YC+  + GE+   +  +  +FT +    +   LG A   +Y   W     L+L  
Sbjct: 98  MGSIAYCVTQSLGEMA-TFIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSI 156

Query: 206 AAITISFWTDVNPDXXXXXXX-XXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIV 264
               I +WT   P+              NL   + Y E +F+    K++ I GF++  + 
Sbjct: 157 VGQIIEYWTSAVPNAAWIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLC 216

Query: 265 IITGGAGKDGYIGAKYWIHPGPFAHG----------FKGVCTVFTYAAFSYGGIEVVVLS 314
           ++ G AGK G +G +YW +PGP+  G          F G  +    AAF+Y G E+V +S
Sbjct: 217 MVCG-AGKTGPVGFRYWRNPGPWGDGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGIS 275

Query: 315 IDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIA 374
             E  +P   VP A  K                  LVP++                F+IA
Sbjct: 276 AGESANPRKTVPKAINKVFFRILLFYVGSLFFIGLLVPFNDEKLTSSDSYSAGSP-FIIA 334

Query: 375 IESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIR 434
           I++ G K++P   NAVIL                           P++    + +G P  
Sbjct: 335 IQNSGTKILPDIFNAVILATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDV 394

Query: 435 CFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSL 494
             +    FG +G+++ S+     F WLL I+ ++  F W+ +SL H+R   A+K QG S 
Sbjct: 395 AVLFVANFGFLGYLSVSNGASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISR 454

Query: 495 DEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVA 554
           D++ +KA+   WG++ + F     ++ Q + ++AP       +V NFF  Y++  + LV 
Sbjct: 455 DDLPFKAKLMPWGAYYSAFFITLIIIIQGFTSLAPT-----FNVSNFFAAYISVFMFLVI 509

Query: 555 YLGHKIYYKNWRLWIPADKIDLDSHRR 581
           +   + +Y+  R+    + +D+DS RR
Sbjct: 510 WAVFQCWYRT-RIIHRIEHVDIDSDRR 535

>YEL063C (CAN1) [1365] chr5 complement(31694..33466) Permease for
           basic amino acids, arginine, lysine, and histidine,
           member of the amino acid-polyamine-choline (APC) family
           of membrane transporters [1773 bp, 590 aa]
          Length = 590

 Score =  204 bits (520), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 154/566 (27%), Positives = 246/566 (43%), Gaps = 37/566 (6%)

Query: 28  DMSSIQGEPSMVSIEIESTKKREIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKD 87
           D+ + Q      SI ++  K +E+     P+ S  T V+               +F  +D
Sbjct: 26  DVEASQTHHRRGSIPLKDEKSKEL----YPLRSFPTRVNGED------------TFSMED 69

Query: 88  SDLDSDV-EAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVS 146
              D D  E Q+ ++ + +K RH+ MI+LG  I TGL +G    L  AGP G +I Y   
Sbjct: 70  GIGDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFM 129

Query: 147 SIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTA 206
             + Y +  + GE+   +  +  +FT +    + P+ G A   +Y   W     L+L   
Sbjct: 130 GSLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVV 188

Query: 207 AITISFWTDVNP-DXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVI 265
              I FWT   P               NLF  + Y E EF+    K+L I GF+I    +
Sbjct: 189 GQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCM 248

Query: 266 ITGGAGKDGYIGAKYWIHPGPFAHG----------FKGVCTVFTYAAFSYGGIEVVVLSI 315
           + G AG  G +G +YW +PG +  G          F G  +    AAF++ G E+V ++ 
Sbjct: 249 VCG-AGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITA 307

Query: 316 DEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAI 375
            E  +P  +VP A KK                  LVPY+                F+IAI
Sbjct: 308 GEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSP-FIIAI 366

Query: 376 ESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRC 435
           E+ G KV+PH  NAVIL                           P++L+     G P   
Sbjct: 367 ENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIA 426

Query: 436 FIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLD 495
             ++  FG + ++  S   + VF WLL I+G++  F W+ +S+SHIR   A+K +G S D
Sbjct: 427 VFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRD 486

Query: 496 EIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAY 555
           E+ +KA+     ++ A       ++ Q + A AP     + + V+F   Y++  + L  +
Sbjct: 487 ELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAP-----KFNGVSFAAAYISIFLFLAVW 541

Query: 556 LGHKIYYKNWRLWIPADKIDLDSHRR 581
           +  +  ++   +W   D +D+DS RR
Sbjct: 542 ILFQCIFRCRFIWKIGD-VDIDSDRR 566

>KLLA0C02343g complement(203552..205297) similar to sp|P04817
           Saccharomyces cerevisiae YEL063c CAN1 amino acid
           permease, start by similarity
          Length = 581

 Score =  202 bits (515), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 143/541 (26%), Positives = 239/541 (44%), Gaps = 24/541 (4%)

Query: 41  IEIESTKKREIEVSEKPIASADTTVSTSKCNAKTYF-QDFCHSFKRKDSD----LDSDVE 95
           IE+E  +     +S+   A +   VS SK +    F +D   + +  D D     D +  
Sbjct: 8   IELEELEALHSNLSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGS 67

Query: 96  AQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIH 155
               ++ + +K RH+ MI+LG  I TGL +     L  AGP G +I + +   + Y +  
Sbjct: 68  IGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQ 127

Query: 156 AAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTD 215
           + GE+   +  +  +FT +    I P++G A   +Y   W     L+L      I +WTD
Sbjct: 128 SLGEMA-TFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTD 186

Query: 216 VNP-DXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDG 274
             P +             N+F  + Y E EF+    K++ I GF+I S+ ++ G AG +G
Sbjct: 187 AVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG-AGPEG 245

Query: 275 YIGAKYWIHPGPFAHG----------FKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSA 324
            IG +YW  PGP+ +G          F G  +    AAF+Y G E+V ++  E ++P  A
Sbjct: 246 PIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKA 305

Query: 325 VPNACKKXXXXXXXXXXXXXXXXCFLVPY-DXXXXXXXXXXXXXXXXFVIAIESHGVKVV 383
           VP A  K                  LVPY D                F+IAI +    V+
Sbjct: 306 VPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVL 365

Query: 384 PHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFG 443
           PH  NAVIL                           P++ +    +G P    +I+ +FG
Sbjct: 366 PHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFG 425

Query: 444 MIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQT 503
            + ++  S+  ++VF WLL I+ ++    W+ +S+SHIR    +K +G S D++ YKA+ 
Sbjct: 426 FLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKF 485

Query: 504 GYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYK 563
             + ++ A F     ++ Q + A AP       +V +FF  Y++  +  + +   +  Y+
Sbjct: 486 MPYAAYYAAFFITVIIIIQGFTAFAP-----HFNVSDFFAAYISVFLFFIVWAIFQTIYR 540

Query: 564 N 564
            
Sbjct: 541 T 541

>CAGL0J08184g 804507..806225 similar to sp|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or sp|P38971 Saccharomyces
           cerevisiae YNL270c ALP1 or sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1, hypothetical start
          Length = 572

 Score =  202 bits (513), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 144/514 (28%), Positives = 228/514 (44%), Gaps = 26/514 (5%)

Query: 82  SFKRKDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLII 141
           S + +D   + D   +   + +++K RH+ MI+LG  I TGL +G    LA AGP G ++
Sbjct: 47  STQYEDLATEKDELLEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALV 106

Query: 142 GYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPL 201
            Y     +++ +  + GE+   +  +  +F+ +    + P+LG A   +Y L W     L
Sbjct: 107 AYLFMGTVVFSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFAL 165

Query: 202 QLVTAAITISFWTDVNP-DXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFII 260
           +L      I FWT   P               N+F  + Y E EF+    K+L + GF+I
Sbjct: 166 ELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLI 225

Query: 261 LSIVIITGGAGKDGYIGAKYWIHPGPFAHG----------FKGVCTVFTYAAFSYGGIEV 310
            S+ I+ G AGK G IG +YW +PG    G          F G  +    AAF+Y G E+
Sbjct: 226 YSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTEL 284

Query: 311 VVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXX 370
           V ++  E  +P  AVP A +K                   VPY+                
Sbjct: 285 VGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSP- 343

Query: 371 FVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNG 430
           F+I I++ G +V+PH  NAVIL                           P++L    + G
Sbjct: 344 FIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQG 403

Query: 431 RPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQ 490
            P    +    FG + ++  S      F WLL I+G++  F W+ +S SH+R   A+K +
Sbjct: 404 VPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHR 463

Query: 491 GKSLDEIGYKAQTGYWGSWLAVFIGFFSLV---TQFWVAIAPVEKHGELDVVNFFQNYLA 547
           G S D++ YKA    W  WLA +  FF +V    Q + + AP          +F   Y++
Sbjct: 464 GISRDDLPYKA---LWMPWLAYYAIFFMVVIILIQGFTSFAP-----HFSGRDFVAAYIS 515

Query: 548 FPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRR 581
             + LV +   +IY++   +W   D +D+D+ RR
Sbjct: 516 VGLFLVFWGFFQIYFRCRIIWKLED-VDIDTDRR 548

>KLLA0E16335g 1455271..1457088 gi|28565044|gb|AAO32605.1
           Kluyveromyces lactis DIP5, start by similarity
          Length = 605

 Score =  201 bits (512), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 138/505 (27%), Positives = 231/505 (45%), Gaps = 25/505 (4%)

Query: 93  DVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYC 152
           D +    +L K +++RH+ MI++G  + TGLL+G G  LA AGPA ++I Y    ++++ 
Sbjct: 71  DGKHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFF 130

Query: 153 IIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISF 212
           ++   GE+   Y  L G FT Y +   DP+LGFA+   Y  ++  ++P QL   A+ I +
Sbjct: 131 VMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQY 188

Query: 213 WTD---VNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGG 269
           W D   VNP              N  G R + E E++ +  KI ++ G IIL +V+  GG
Sbjct: 189 WVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGG 248

Query: 270 AGKDGYIGAKYWIHPGPFAH------GFKG----VCTVFTYAAFSYGGIEVVVLSIDEQE 319
                 +G KYW +PG F        G KG      +VF  A F+Y G E+  + + E +
Sbjct: 249 GPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECK 308

Query: 320 DPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYD--XXXXXXXXXXXXXXXXFVIAIES 377
           +P  AVP A K                    VP++                  FV+AI +
Sbjct: 309 NPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVN 368

Query: 378 HGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFI 437
            G+ V+PH +NA ILI                          P+     +  G P    +
Sbjct: 369 AGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLL 428

Query: 438 ISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEI 497
           + +LF ++ ++  S    +VFT+ +    +  L  W+S+ +++IR   A + QG     +
Sbjct: 429 VGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTL 488

Query: 498 GYKAQTGYWGSWLAVFIG-FFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYL 556
            Y++    +G+W ++F      L+  F     P       D  +F   Y+  P  +++Y+
Sbjct: 489 AYQSPLQPYGAWFSLFFCILIGLIKNF-----PAFLGDTFDYKSFITGYIGIPTYIISYI 543

Query: 557 GHKIYYKNWRLWIPADKIDLDSHRR 581
           G+K++YK     IP++++DL S + 
Sbjct: 544 GYKLWYKT--KIIPSEEVDLVSFKE 566

>YNL270C (ALP1) [4339] chr14 complement(135939..137660) Arginine
           permease, has strong similarity to basic amino acid
           permeases Can1p and Lyp1p, member of the amino acid
           permease family of membrane transporters [1722 bp, 573
           aa]
          Length = 573

 Score =  197 bits (502), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 149/554 (26%), Positives = 247/554 (44%), Gaps = 20/554 (3%)

Query: 40  SIEIESTKKREIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKDSDLDSDVEAQDT 99
           ++ I+ +K+ + E++   I   +  V                     D+  +++   Q+ 
Sbjct: 4   TVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVEDDAAKETESSPQER 63

Query: 100 -QLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAG 158
            ++ + +K RH+ MI+LG  I TGL++G G  LA AGP G +I Y     +IY +  + G
Sbjct: 64  REVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLG 123

Query: 159 ELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDVNP 218
           E+ + +  +  +F+ +    + P+LG     +Y L W     L+L      I +WT+  P
Sbjct: 124 EM-VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVP 182

Query: 219 -DXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIG 277
                          N+F  + Y E EF     K++ + GFII S  ++ G    DG IG
Sbjct: 183 LAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIG 242

Query: 278 AKYWIHPGPFAHG----------FKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPN 327
            +YW +PG +  G          F G  +    AAF+Y G E+V ++  E  +P  A+P 
Sbjct: 243 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPR 302

Query: 328 ACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKVVPHFI 387
           A KK                  LVPY+                F+I+IE+ G KV+P   
Sbjct: 303 AIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSP-FMISIENSGTKVLPDIF 361

Query: 388 NAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGF 447
           NAV+LI                          P++L+ +   G P    + + +FG + F
Sbjct: 362 NAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAF 421

Query: 448 VAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWG 507
           +  S      F WLL I+G++  F W+ +S SHIR   A++ +G S D++ YKAQ   + 
Sbjct: 422 LEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFL 481

Query: 508 SWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRL 567
           ++ A F     ++ Q + A AP         ++F   Y++  + L  +L  ++++K   L
Sbjct: 482 AYYASFFIALIVLIQGFTAFAPT-----FQPIDFVAAYISIFLFLAIWLSFQVWFKCRLL 536

Query: 568 WIPADKIDLDSHRR 581
           W   D ID+DS RR
Sbjct: 537 WKLQD-IDIDSDRR 549

>CAGL0A01199g 121067..122908 similar to sp|P53388 Saccharomyces
           cerevisiae YPL265w DIP5 dicarboxylic amino acid
           permease, hypothetical start
          Length = 613

 Score =  195 bits (496), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 135/512 (26%), Positives = 228/512 (44%), Gaps = 25/512 (4%)

Query: 85  RKDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYT 144
            K  D   D + + T+L K +K+RH+ MI++G  I TGLL+G G  L  AGP  + I Y 
Sbjct: 70  EKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAGPMSMFIAYA 129

Query: 145 VSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLV 204
              ++++  + A GE+   Y  L G FT Y S   DP+LGFA+   Y  ++L + P QL 
Sbjct: 130 FVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLT 187

Query: 205 TAAITISFWTD---VNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIIL 261
            AA+ I +W D   VNP              N  G + + E EF+ +  K++++ G IIL
Sbjct: 188 AAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIIL 247

Query: 262 SIVIITGGAGKDGYIGAKYWIHPGPFA------HGFKG----VCTVFTYAAFSYGGIEVV 311
             VI+ GG      +G +++ HPG F        G KG       V  YA F+Y GIE+ 
Sbjct: 248 LFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFAYLGIELT 307

Query: 312 VLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYD--XXXXXXXXXXXXXXX 369
            +   E  +P  ++P A K                    V YD                 
Sbjct: 308 GIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKTSGTGAAAS 367

Query: 370 XFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMN 429
            +V+AI + G+K +PH  NA +L+                          P+     +  
Sbjct: 368 PYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRW 427

Query: 430 GRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKS 489
           G P    ++S  F ++ +++ S     +F + + +  +  L  W+S+ ++++    A+K+
Sbjct: 428 GVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKA 487

Query: 490 QGKSLDEIGYKAQTGYWGSWLAV-FIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAF 548
           Q        Y+A    +GS+  + F    + +  F V +     +   D  NF   Y+  
Sbjct: 488 QNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-----NHHFDYKNFITGYIGI 542

Query: 549 PIVLVAYLGHKIYYKNWRLWIPADKIDLDSHR 580
           P+ +++Y G+K + K  ++W P +++DL + +
Sbjct: 543 PVFVISYFGYK-FVKKTKIWKP-EEVDLYTFK 572

>YOR348C (PUT4) [5125] chr15 complement(986894..988777) High
           affinity proline permease, also transports alanine and
           glycine [1884 bp, 627 aa]
          Length = 627

 Score =  192 bits (489), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 147/526 (27%), Positives = 227/526 (43%), Gaps = 43/526 (8%)

Query: 85  RKDSDLDSDVE--------AQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGP 136
           R+D  +D D+E        ++  +L + ++SRH+ +I+LG  I TGLLVG    L   GP
Sbjct: 82  REDLIMDVDLEKSPSVDGDSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGP 141

Query: 137 AGLIIGYTVSSIMIYCIIHAAGELGICY--------RGLVGNF-TRYPSILIDPSLGFAI 187
           AGL I Y + S +IY I+ A GE+ +C+         G   N  TRY    +DPSLGFA 
Sbjct: 142 AGLFISYIIISAVIYPIMCALGEM-VCFLPGDGSDSAGSTANLVTRY----VDPSLGFAT 196

Query: 188 SLLYTLQWLTVLPLQLVTAAITISFWTDVNPDXX-XXXXXXXXXXXNLFGARGYAETEFF 246
              Y   ++ ++  +   A+  + +WT   P               N    + Y E+EF+
Sbjct: 197 GWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFW 256

Query: 247 CNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAH--------GFKGVCTVF 298
               KIL I G IILS ++  GG      +G +YW HPG FAH         F  + T  
Sbjct: 257 FASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGI 316

Query: 299 TYAAFSY-GGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXX 357
              AF++  G E+V ++  E  D    +  A ++                  +VPY+   
Sbjct: 317 IKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPT 376

Query: 358 XXXXXXX---XXXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXX 414
                           FVI I++ G+KV+PH IN  IL                      
Sbjct: 377 LVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMA 436

Query: 415 XXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWM 474
                P+ L  I+  G P     +S L   + ++  S    DVF W   IS +S    WM
Sbjct: 437 QTGQAPKCLGRINKWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWM 496

Query: 475 SMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLA-VFIGFFSLVTQFWVAIAPVEKH 533
              ++++R R A+   G   D + +K     +  W + + IG  ++   + + I    + 
Sbjct: 497 CGCIAYLRFRKAIFYNGL-YDRLPFKTWGQPYTVWFSLIVIGIITITNGYAIFIPKYWR- 554

Query: 534 GELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWR-LWIPADKIDLDS 578
               V +F   Y+  PI LV + GHK+Y + WR  W+P  +ID+ +
Sbjct: 555 ----VADFIAAYITLPIFLVLWFGHKLYTRTWRQWWLPVSEIDVTT 596

>KLLA0C02365g 208462..210201 similar to sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 lysine-specific high-affinity
           permease, hypothetical start
          Length = 579

 Score =  191 bits (486), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 135/502 (26%), Positives = 229/502 (45%), Gaps = 20/502 (3%)

Query: 91  DSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMI 150
           + + +  +T++ + +K RH+ MI+LG  I TGL VG  + L+ +GP G +I Y     ++
Sbjct: 63  EGEGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGSVV 122

Query: 151 YCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITI 210
           Y +  + GE+   +  +  + T +    + P+ G A   +Y   W     ++L      I
Sbjct: 123 YFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQII 181

Query: 211 SFWTDVNP-DXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGG 269
           ++WTD  P               N F  + Y E EF     K++ I G+++ +++I+ GG
Sbjct: 182 NYWTDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCGG 241

Query: 270 AGKDGYIGAKYWIHPGPFAHG----------FKGVCTVFTYAAFSYGGIEVVVLSIDEQE 319
           + + G IG +YW +PGP+  G          F G       A+F+Y G E+V ++  E  
Sbjct: 242 SSQ-GPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEAS 300

Query: 320 DPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHG 379
           +P   VP A  K                  LVPY+                FVI+I++ G
Sbjct: 301 NPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQLESNSAVIASSP-FVISIQNAG 359

Query: 380 VKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIIS 439
            KV+P   NAV+L+                          P+  +++   G P    I +
Sbjct: 360 TKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVICT 419

Query: 440 ILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGY 499
            L G++ F+A ++     F WL+ IS L+ L  W  +S++HIR    +K +G S D + +
Sbjct: 420 ALLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPF 479

Query: 500 KAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHK 559
           KA+   WG++ A F     +  Q + A AP       DV  FF  Y++  +++V ++  +
Sbjct: 480 KAKLMPWGAYYAAFFVGLIVFIQGFTAFAP-----RFDVSEFFTAYISLILLVVLFILCQ 534

Query: 560 IYYKNWRLWIPADKIDLDSHRR 581
           +YY+  R     + ID+DS RR
Sbjct: 535 LYYRC-RFLTKIEDIDIDSDRR 555

>AFR668W [3861] [Homologous to ScYEL063C (CAN1) - SH; ScYNL270C
           (ALP1) - SH] complement(1659469..1661139) [1671 bp, 556
           aa]
          Length = 556

 Score =  191 bits (485), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 133/494 (26%), Positives = 219/494 (44%), Gaps = 21/494 (4%)

Query: 84  KRKDSDLDSDVEAQD-TQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIG 142
               S+++S  E  + + + + +K RH+ MISLG  I TGL +G    +  AGP G ++ 
Sbjct: 31  NHNTSEVESLCEKPNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLA 90

Query: 143 YTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQ 202
           Y   + M YC+  + GE+   +  +  +FT + S  + P+LG A   LY L W     L+
Sbjct: 91  YIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALE 149

Query: 203 LVTAAITISFWTDVNP-DXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIIL 261
           +      I +W+D  P               NL   + Y E EF+    K++ I  F+  
Sbjct: 150 ISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFY 209

Query: 262 SIVIITGGAGKDGYIGAKYWIHPGPFAHG----------FKGVCTVFTYAAFSYGGIEVV 311
            +V++ GG+ K G IG +YW  PGP+  G          F G  +    AAF++ G E+V
Sbjct: 210 GLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELV 268

Query: 312 VLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXX-XXXXXXXXXX 370
            ++  E ++P   VP A                     LV YD                 
Sbjct: 269 GVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASP 328

Query: 371 FVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNG 430
           FV+AI + G KV+P  +N VI++                          P +++     G
Sbjct: 329 FVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRG 388

Query: 431 RPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQ 490
            P    + + +FG +G++  S K   VF WLL+I+ +S  F W+ +S+SHIR    +K +
Sbjct: 389 VPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKR 448

Query: 491 GKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPI 550
           G S D++ +KA+   +G++ A F     ++ Q + A  P         V+F   Y++  I
Sbjct: 449 GISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP------FSAVDFVAYYISAFI 502

Query: 551 VLVAYLGHKIYYKN 564
            +V +L  +  +K 
Sbjct: 503 FVVIWLLFQFLFKG 516

>YPL265W (DIP5) [5186] chr16 (41043..42869) Dicarboxylic amino acid
           permease, also transports alanine, glycine, serine,
           asparagine and glutamine [1827 bp, 608 aa]
          Length = 608

 Score =  186 bits (473), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 136/515 (26%), Positives = 230/515 (44%), Gaps = 25/515 (4%)

Query: 85  RKDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYT 144
           R DS    D + ++T+L K +K+RH+ MI++G  + TGLL+G G  L   GP  ++I Y 
Sbjct: 66  RDDSFAVPDGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYA 125

Query: 145 VSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLV 204
              ++++  +   GE+   Y  L G FT Y S  +DP+LGFAI   Y  ++  + P QL 
Sbjct: 126 FVGLLVFYTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLT 183

Query: 205 TAAITISFWTD---VNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIIL 261
            AA+ I +W     VNP              N+ G + + E EF+ +  K++++ G I+L
Sbjct: 184 AAALVIQYWISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILL 243

Query: 262 SIVIITGGAGKDGYIGAKYWIHPGPFAH------GFKG----VCTVFTYAAFSYGGIEVV 311
             +I+ GG      +G +YW  PG F        G KG       VF Y+ FSY GIE+ 
Sbjct: 244 LFIIMLGGGPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELT 303

Query: 312 VLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYD--XXXXXXXXXXXXXXX 369
            +   E E+P  +VP A K                    V Y+                 
Sbjct: 304 GIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAAS 363

Query: 370 XFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMN 429
            FV+AI++ G++V+PH  NA +L+                          P+        
Sbjct: 364 PFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRW 423

Query: 430 GRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKS 489
           G P    I+S+LF  + ++  S     +F + + +  +  +  W+++ + +I    A ++
Sbjct: 424 GVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRA 483

Query: 490 QGKSLDEIGYKAQTGYWGSWLAVFIG-FFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAF 548
           QG    +  Y A    +G++ A+F     +L+  F V +       + D   F   Y+  
Sbjct: 484 QGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLG-----HKFDYKTFITGYIGL 538

Query: 549 PIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRRIY 583
           P+ ++++ G+K+ YK     I +  +DL + + IY
Sbjct: 539 PVYIISWAGYKLIYKTKV--IKSTDVDLYTFKEIY 571

>Scas_486.2
          Length = 597

 Score =  184 bits (468), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 125/499 (25%), Positives = 221/499 (44%), Gaps = 23/499 (4%)

Query: 82  SFKRKDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLII 141
           S + ++   + D + + T+L K ++ R + M+++G  + TGLL+G G  LA AGP  ++I
Sbjct: 52  SAEDQNDSYNVDGKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLI 111

Query: 142 GYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPL 201
            Y    ++++  + + GE+   Y  L G FT Y +   DP+LGFA+   Y  ++  + P 
Sbjct: 112 AYAFVGLLVFFTMASLGEMA-SYIPLDG-FTSYATRYADPALGFAVGYCYLFKYFILPPN 169

Query: 202 QLVTAAITISFW---TDVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGF 258
           QL  AA+ I +W     VNP              N  G + + E EF+ +  K+L++   
Sbjct: 170 QLTAAALVIQYWIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFAL 229

Query: 259 IILSIVIITGGAGKDGYIGAKYWIHPGPFAH----------GFKGVCTVFTYAAFSYGGI 308
           IIL  +++ GG      +G ++W HPG F +           F    +VF YA F+Y G 
Sbjct: 230 IILLFILMLGGGPNHDRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVFVYATFAYLGT 289

Query: 309 EVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYD--XXXXXXXXXXXX 366
           E+V + + E  +P  +VP A K                    V YD              
Sbjct: 290 ELVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSA 349

Query: 367 XXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFI 426
               FV+AI + G+KV+PH  NA +L+                          P+     
Sbjct: 350 AASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFART 409

Query: 427 DMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDA 486
           +  G P     +S+LF ++ +++ S     +F + + +  +  L  W+ + ++++    A
Sbjct: 410 NRWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRA 469

Query: 487 MKSQGKSLDEIGYKAQTGYWGSWLAVFI-GFFSLVTQFWVAIAPVEKHGELDVVNFFQNY 545
           +++QG       Y A    +G++ A+F     +L+  F V +       + D   F   Y
Sbjct: 470 VRAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNFTVFLG-----HQFDYKTFITGY 524

Query: 546 LAFPIVLVAYLGHKIYYKN 564
           +  P+  ++Y G+K+ YK 
Sbjct: 525 IGIPVFFISYFGYKLIYKT 543

>YFL055W (AGP3) [1629] chr6 (17004..18680) Amino acid permease for
           serine, aspartate and glutamate, member of the amino
           acid permease family of membrane transporters [1677 bp,
           558 aa]
          Length = 558

 Score =  178 bits (452), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 138/522 (26%), Positives = 223/522 (42%), Gaps = 23/522 (4%)

Query: 67  TSKCNAKTYFQDFCHSFKRKDSDLDSDVEAQDTQ--LSKTIKSRHLLMISLGTGIATGLL 124
           T+K + K YF     + +  D D D DV   D Q  + + +K+RH+ +++LG  I  G L
Sbjct: 16  TAKKDIKPYF---ASNVEAVDIDEDPDVSRYDPQTGVKRALKNRHISLLALGGVIGPGCL 72

Query: 125 VGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFT----RYPSILID 180
           VG G  L K GP  L++G+++  I+ + ++ + GE+   Y    G FT    R+ S  + 
Sbjct: 73  VGAGNALNKGGPLALLLGFSIIGIIAFSVMESIGEMITLYPS-GGGFTTLARRFHSDALP 131

Query: 181 PSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDVNPDXXXXXXX-XXXXXXNLFGARG 239
              G+A    Y + +  VL  +  T +  + FW    P                L G   
Sbjct: 132 AVCGYA----YVVVFFAVLANEYNTLSSILQFWGPQVPLYGYILIFWFAFEIFQLVGVGL 187

Query: 240 YAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAHGFKGVCTVFT 299
           + ETE++    KI+ +  + I SIV I+G        G  YW  PG  +HGFKG+  VF 
Sbjct: 188 FGETEYWLAWLKIVGLVAYYIFSIVYISGDIRNRPAFGFHYWNSPGALSHGFKGIAIVFV 247

Query: 300 YAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXX 359
           + +  Y G E V L+  E ++P  AVP A ++                   VP+D     
Sbjct: 248 FCSTFYSGTESVALAATESKNPGKAVPLAVRQTLWRILVVYIGIAVFYGATVPFD--DPN 305

Query: 360 XXXXXXXXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXX 419
                        IAI   G     H +NA ILI                          
Sbjct: 306 LSASTKVLKSPIAIAISRAGWAGGAHLVNAFILITCISAINGSLYIGSRTLTHLAHEGLA 365

Query: 420 PQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLS 479
           P+ L + D  G PI    +    G+I  +  S    + +++++ +SG+    +W  +S +
Sbjct: 366 PKILAWTDRRGVPIPAITVFNALGLISLMNVSVGAANAYSYIVNLSGVGVFIVWGVISYT 425

Query: 480 HIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVV 539
           H+R+R A  +QG+S++E+ Y+A    W   L++    F  + Q W    P       D  
Sbjct: 426 HLRIRKAWVAQGRSIEELPYEALFYPWTPVLSLAANIFLALIQGWSYFVP------FDAG 479

Query: 540 NFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRR 581
           NF   Y+  P+ ++ Y+G  ++  N    +    I+LD  RR
Sbjct: 480 NFVDAYILLPVGILLYIGICVFKSNHFRTVDLRSINLDEGRR 521

>Scas_377.2
          Length = 490

 Score =  174 bits (441), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 125/471 (26%), Positives = 202/471 (42%), Gaps = 21/471 (4%)

Query: 122 GLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDP 181
           GL +G    L  AGP G +I Y   + + Y +  + GE+   +  +  +FT +    + P
Sbjct: 6   GLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSP 64

Query: 182 SLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDVNP-DXXXXXXXXXXXXXNLFGARGY 240
           + G A   +Y   W     L+L      I FWT   P               N+F  + Y
Sbjct: 65  AFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYY 124

Query: 241 AETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAHG---------- 290
            E EF+    K++ I GF+I    ++ G AG  G +G +YW HPG F  G          
Sbjct: 125 GEFEFWVALVKVVAIMGFLIYCFCMVCG-AGVTGPVGFRYWRHPGAFGPGIIAKDKNQAR 183

Query: 291 FKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFL 350
           F G  +    AAF++ G E+V ++  E  +P   VP A KK                  L
Sbjct: 184 FLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIGLL 243

Query: 351 VPYDXXXXXXXXXXXXXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXX 410
           VPYD                F+IAIE+ G  V+PH  NAVI+                  
Sbjct: 244 VPYDDWKLTSTDSYVSASP-FIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIM 302

Query: 411 XXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQL 470
                    P  L+    +G P    +++ LFG + ++  S   +  F WLL I+G++  
Sbjct: 303 YGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGF 362

Query: 471 FIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPV 530
           F W+ +SLSHIR   A++ +G S D++ +KA+   W   LA +  FF  +    + I   
Sbjct: 363 FTWLFISLSHIRFMQALEMRGISRDDLPFKAK---WMPGLAYYGVFFMTLI---IIIQGF 416

Query: 531 EKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRR 581
                 + ++F   Y++  + +  ++  + +++   +W   D +D+D+ RR
Sbjct: 417 TSFCPWNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVED-VDIDTDRR 466

>ACL135W [914] [Homologous to ScYPL265W (DIP5) - NSH]
           complement(115359..117125) [1767 bp, 588 aa]
          Length = 588

 Score =  175 bits (443), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 131/517 (25%), Positives = 224/517 (43%), Gaps = 28/517 (5%)

Query: 84  KRKDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGY 143
           + +  D + D + +  +L K +++RH+ MI++G  + TGLL+G G  L +AGP  ++I Y
Sbjct: 42  EAQSVDWNYDGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAY 101

Query: 144 TVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQL 203
           ++   +++ ++   GE+   Y  L G FT Y +   DP+LGFA+   Y  ++L + P QL
Sbjct: 102 SIMGWVVFTVMSCLGEMA-AYIPLDG-FTSYATRYADPALGFAVGWAYLFKYLVLTPNQL 159

Query: 204 VTAAITISFW---TDVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFII 260
              A+ I FW     V+P              N  G R + E EF+ +  K+L++   +I
Sbjct: 160 TAGALVIQFWIPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMI 219

Query: 261 LSIVIITGGAGKDGYIGAKYWIHPGPFAH-------------GFKGVCTVFTYAAFSYGG 307
           L +V+  GG      +G +YW  PG F                F    +VF YA F+Y G
Sbjct: 220 LLLVLALGGGPTHDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLG 279

Query: 308 IEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYD--XXXXXXXXXXX 365
            E+  +   E +DP   VP A K                    V Y+             
Sbjct: 280 TELCGIVAAECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVS 339

Query: 366 XXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNF 425
                +V+AIE+  + V+P+  NA +L                           P+    
Sbjct: 340 AAASPYVVAIENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFAR 399

Query: 426 IDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRD 485
            +  G P        LF  + +++ S      F + + ++ +  L  W+S+ +++I    
Sbjct: 400 TNKWGVPYNALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDR 459

Query: 486 AMKSQGKSLDEIGYKAQTGYWGSWLA-VFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQN 544
           A ++QG     + Y A    +  W+A +F  F +L+  F   I       E+DV  F   
Sbjct: 460 AFRAQGIPKSTLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGK-----EVDVPTFITG 514

Query: 545 YLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRR 581
           Y+  PI +  ++G+KI +K    WIP+ ++DL + + 
Sbjct: 515 YIGLPIYIFCFIGYKIVHKT--KWIPSKEVDLFTFKE 549

>Kwal_33.15545
          Length = 576

 Score =  171 bits (432), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 129/504 (25%), Positives = 223/504 (44%), Gaps = 25/504 (4%)

Query: 93  DVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYC 152
           D + +  +L K +++RH+ MI++G  + TGLL+G G  LA AGP  ++I Y+   +++Y 
Sbjct: 42  DGKHEGIRLKKELEARHVSMIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYT 101

Query: 153 IIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISF 212
           ++   GE+   +  L G FT Y S  +DP++GFA+   Y  ++  V P QL   A+ + F
Sbjct: 102 VMSCLGEMA-AFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQF 159

Query: 213 WTD---VNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGG 269
           W     VNP              N  G R + E EF+ +  K+L++ G I+L  +I+ GG
Sbjct: 160 WVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGG 219

Query: 270 AGKDGYIGAKYWIHPGPFA------HGFKG----VCTVFTYAAFSYGGIEVVVLSIDEQE 319
                  G ++W  PG F        G KG      +VF  A F+Y G E+  +   E +
Sbjct: 220 GPNHDRTGFRFWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAK 279

Query: 320 DPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYD--XXXXXXXXXXXXXXXXFVIAIES 377
           +P  +VP A K                    V Y+                  FV+AIE+
Sbjct: 280 NPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIEN 339

Query: 378 HGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFI 437
             + V+PH  N  +L+                          P+     +  G P     
Sbjct: 340 ASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLG 399

Query: 438 ISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEI 497
           +S+LF ++ ++  S     VF + + +  +  L  W+++ +++IR   A++ Q      +
Sbjct: 400 LSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSL 459

Query: 498 GYKAQTGYWGSWLAVFI-GFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYL 556
            Y A    W +++A+F      L+  + V +       + D   F   Y+  P+ L+ Y+
Sbjct: 460 SYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGH-----KFDYKTFISGYIGIPVYLICYV 514

Query: 557 GHKIYYKNWRLWIPADKIDLDSHR 580
           G+K+ Y+  +L  P D +DL + +
Sbjct: 515 GYKVVYRT-KLIKPED-VDLYTFK 536

>KLLA0F27093g 2501049..2502740 similar to sp|P43548 Saccharomyces
           cerevisiae YFL055w AGP3 amino acid permease, start by
           similarity
          Length = 563

 Score =  167 bits (422), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 136/511 (26%), Positives = 212/511 (41%), Gaps = 26/511 (5%)

Query: 53  VSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKDS-DLDSDVEAQDTQLSKTIKSRHLL 111
           VS + +  A   V+  + + K        S  R+D+ D DS V+ Q       +K RH+ 
Sbjct: 14  VSNRGLKDAYNEVTEMEVDPKNNEYAEEQSLNREDTFDPDSGVKRQ-------LKDRHIS 66

Query: 112 MISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNF 171
           +++LG  I  G L+G G  LA  GP  L++G+ +  I+ + ++ + GE+   Y    G F
Sbjct: 67  LLALGGIIGPGCLIGAGNALAIGGPLALLLGFGIIGILAFIMMESIGEMITLYPS-GGGF 125

Query: 172 T----RYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDVNPDXXXXXXX- 226
           T    R+ S  +    G+A    Y + +  VL  +  T +  + FW    P         
Sbjct: 126 TTLTRRFHSDALSAVCGYA----YAVVFFAVLANEYNTLSSIMQFWGPQVPLYGYILIFW 181

Query: 227 XXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGP 286
                  L G   + ETE++    KIL +  + I SIV I+GG       G +YW  PG 
Sbjct: 182 AAFQVFQLLGVGAFGETEYWLAWFKILGLLTYYIFSIVYISGGVKNRPAFGFQYWNDPGA 241

Query: 287 FAHGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXX 346
            ++GFKG+  VF + +  Y G E V L+  E ++P  AVP A ++               
Sbjct: 242 LSNGFKGIANVFVFCSTFYSGTESVALAATESKNPRRAVPIAIRQTFWRILIVYLGISIF 301

Query: 347 XCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXX 406
               VPY+                  IAI   G     H +NA ILI             
Sbjct: 302 YGVTVPYN--DENLNFATKVLKSPIAIAISRAGWPAGVHLVNAFILITCISAINGSLYIG 359

Query: 407 XXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISG 466
                        P+ L + D  G PI    +    G+I  +  S    D + +++ +SG
Sbjct: 360 SRTLTHLANEGLAPKLLAWTDRRGVPIPAITVFNALGLISLMNVSVTAVDAYNYIVNLSG 419

Query: 467 LSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVA 526
           +    +W  +SL+H+R R A K QG + DE+ YKA+       +++    F  + Q W  
Sbjct: 420 VGVFIVWGIISLTHLRFRKAWKLQGHTRDELPYKAKLFPVFPIVSIIANIFLGLVQGWSY 479

Query: 527 IAPVEKHGELDVVNFFQNYLAFPIVLVAYLG 557
             P       D  NF   Y+  P  ++ YLG
Sbjct: 480 FKP------FDAKNFVDAYILIPAGIILYLG 504

>Kwal_26.6940
          Length = 570

 Score =  163 bits (412), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 127/514 (24%), Positives = 220/514 (42%), Gaps = 44/514 (8%)

Query: 95  EAQDTQ---LSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIY 151
           E+Q  +   L + ++SRH+ +I+LG  I TGL VG    L+  GPAGL+  Y + S++IY
Sbjct: 40  ESQKREPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIY 99

Query: 152 CIIHAAGELGICY-----RGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTA 206
            +++A GE+ +CY         G+ ++  S   DPSLGFA    Y   ++ ++  +   A
Sbjct: 100 PVMNALGEM-VCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAA 158

Query: 207 AITISFWTDVNPDXXXXXXXXXXXXXNLFG-ARGYAETEFFCNCCKILMITGFIILSIVI 265
           +  +++WT V P                FG  + Y E+EF+    KIL I G + +S ++
Sbjct: 159 SGVVTYWTTVVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFIL 218

Query: 266 ITGGAGKDGYIGAKYWIHPGPFAH--------GFKGVCTVFTYAAFSY-GGIEVVVLSID 316
             GG      +G +YW  PG FA+         F  V T      F++  G E+V ++  
Sbjct: 219 FWGGGPSHDRLGFRYWQKPGAFAYHITTGNTGRFLDVWTGVIKGGFAFILGPELVAVTSS 278

Query: 317 EQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYD---XXXXXXXXXXXXXXXXFVI 373
           E  D    +  A ++                  +V  +                   FVI
Sbjct: 279 EAMDQRRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVI 338

Query: 374 AIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPI 433
           AI++  +K++PH INA IL                           P+    I+  G P 
Sbjct: 339 AIQNAHIKILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPY 398

Query: 434 RCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKS 493
               +S  F  + ++  S      FTW   IS +S    W+ + ++++R R A+  +G  
Sbjct: 399 NAVAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGL- 457

Query: 494 LDEIGYKAQTGYWGSWLAVFI--------GFFSLVTQFWVAIAPVEKHGELDVVNFFQNY 545
            D + +K+    +G++  + +        G+ + + +FW               +F   Y
Sbjct: 458 YDRVPFKSPFQPYGTYFFIIVVSIICLTNGYATFIPRFWKG------------ADFVAAY 505

Query: 546 LAFPIVLVAYLGHKIYYKNWRLW-IPADKIDLDS 578
           +  P+ +V ++GHKIY +    W IP  ++D+ +
Sbjct: 506 ITLPVFVVLWVGHKIYTRTLSTWVIPVAEVDVTT 539

>Sklu_2438.14 YOR348C, Contig c2438 29357-31033
          Length = 558

 Score =  161 bits (408), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 133/536 (24%), Positives = 223/536 (41%), Gaps = 35/536 (6%)

Query: 61  ADTTVSTSKCNAKTYFQDFCHSFKRKDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIA 120
           A+    TS  + K+  + +  +  + +S L+   +  +  L K + SRH+ +I+LG  I 
Sbjct: 7   ANLEKDTSFYDVKSQGETYSGTLNQLESQLEG-TKCDENNLEKGLSSRHIQLIALGGCIG 65

Query: 121 TGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILID 180
           TGL VG    L   GP  L + + + S ++Y +++   E+ ICY    G      S  +D
Sbjct: 66  TGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMNTLAEM-ICYLPQQGTVPELTSRYVD 124

Query: 181 PSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTD-VNPDXXXXXXXXXXXXXNLFGARG 239
           PSLGFA    Y   +  ++  +L  AA  + +WTD V+               N    + 
Sbjct: 125 PSLGFAAGWNYAYSYSILVATELSAAAGVVQYWTDKVHVAVWITIFLVIVVGLNFAPVKF 184

Query: 240 YAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAHGFKG------ 293
           Y E+EF+    KI+ I G +I+SIVI  GGA     +G +YW +PGPFA+   G      
Sbjct: 185 YGESEFWFASLKIICILGLLIVSIVIFFGGAPSHDRLGFRYWNNPGPFAYHITGGNTGRF 244

Query: 294 --VCTVFTYAAFSY-GGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFL 350
             + T    + F++    E++ L+  E +D    +  A ++                 F+
Sbjct: 245 LDIWTAIIKSGFAFILSPELIGLACVEAKDTRRNIEKASRRFIWRIIFFYITSTLCIGFI 304

Query: 351 VPYD---XXXXXXXXXXXXXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXX 407
           +  D                   FV  I + G+ V+ H INAVIL               
Sbjct: 305 LSRDDPKLIQALTSDAPGAASSPFVQGISNAGIPVLNHIINAVILSSAWSSANSFMYASS 364

Query: 408 XXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGL 467
                       P+    I+  G P     +S     + ++ AS     VFTWL  I  +
Sbjct: 365 RSILALAKQGDAPKVFTRINRLGVPYNAVALSTAVSCLTYLNASSSSAQVFTWLSNICTI 424

Query: 468 SQLFIWMSMSLSHIRLRDAM-------KSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLV 520
           S    W  + ++++R R A+       +   KS  +  +      +   L +  G+ + +
Sbjct: 425 SGFIGWALIGITYLRFRKAIFYNNLYERVPFKSALQPYFTYFFVVFVVLLCLTNGYATFI 484

Query: 521 TQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDL 576
            ++W            +  +F   Y+  PI  + YLGHKI++K  R +IP  +ID+
Sbjct: 485 PKYW------------NASDFVAAYITLPIFFLLYLGHKIWFKT-RWYIPFREIDV 527

>Kwal_26.9612
          Length = 543

 Score =  160 bits (405), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 119/486 (24%), Positives = 209/486 (43%), Gaps = 18/486 (3%)

Query: 83  FKRKDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIG 142
            +R ++D  ++ +   + + + +K+RH+ +++LG  I  G L+G G  L K GP  L++G
Sbjct: 25  LQRLETDSLNEFDPH-SGVKRALKNRHISLLALGGIIGPGCLIGAGNALNKGGPLALLLG 83

Query: 143 YTVSSIMIYCIIHAAGELGICYR---GLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVL 199
           + +  ++ + I+ + GEL   Y    G +    R+ S  +    G+A    Y + +  VL
Sbjct: 84  FGIIGLVCFSIMESIGELVTLYPSGGGFITLARRFHSEGLSAVSGYA----YIVVFFAVL 139

Query: 200 PLQLVTAAITISFWTDVNPDXXXXXXX-XXXXXXNLFGARGYAETEFFCNCCKILMITGF 258
             +  T +  + FW    P                L G   + E E++    KIL +  F
Sbjct: 140 ANEYNTISSILQFWGPQVPIYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKILGLVAF 199

Query: 259 IILSIVIITGGAGKDGYIGAKYWIHPGPFAHGFKGVCTVFTYAAFSYGGIEVVVLSIDEQ 318
            I SIV ++GG      IG +YW +PG  +HGF+G+  VF + +  Y G E V L+  E 
Sbjct: 200 YIFSIVYMSGGIPGKPPIGFQYWKNPGALSHGFRGIAVVFVFCSTFYSGTESVALAATES 259

Query: 319 EDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESH 378
            +P  AVP A ++                   VPY+                  IA+   
Sbjct: 260 RNPRKAVPLAVRQTFWRILIVYLGISFFYGVTVPYNDPTLGAQTKSLKSPIS--IALSRA 317

Query: 379 GVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFII 438
           G     H +NA IL+                          P+ L + D  G P+   I+
Sbjct: 318 GWAGGVHLVNAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRILAWTDKRGVPVPALIV 377

Query: 439 SILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIG 498
               G+I  +  S    + + +++ +SG+    +W ++S++H+R R A  +QG+SL E+ 
Sbjct: 378 FNALGLISLMNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLRFRKAWVAQGRSLSELP 437

Query: 499 YKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGH 558
           Y+A    W +  ++    F  + Q W ++ P          +F   Y+  P   + Y+G 
Sbjct: 438 YRALFYPWTTIFSLAANIFLALIQGWTSLVPFVAK------DFVDAYILLPAAGLLYVGI 491

Query: 559 KIYYKN 564
             ++KN
Sbjct: 492 N-FWKN 496

>Kwal_23.2817
          Length = 580

 Score =  159 bits (402), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 127/504 (25%), Positives = 212/504 (42%), Gaps = 37/504 (7%)

Query: 85  RKDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYT 144
            + S  D D     T++S+ +KSRH+  I+LG  I TGL +G+G  L+  GPA L+I Y+
Sbjct: 48  ERGSLSDIDTIKPSTEVSRGLKSRHVQFIALGGAIGTGLFIGSGTALSSCGPAPLLISYS 107

Query: 145 VSSIMIYCIIHAAGELGI--------CYRGLVGNFTRYP-SILIDPSLGFAISLLYTLQW 195
           V S  ++ I++   E+ +            L G +   P S +   +  +A+S+      
Sbjct: 108 VMSFFVWAIMNQMTEMVVLIPLSGESSMASLAGTYLNRPSSFMCGWNCFYAMSM------ 161

Query: 196 LTVLPLQLVTAAITISFWTDVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMI 255
             V+P ++   A+ I +WTD N               +L   + + E+EF  +  KIL I
Sbjct: 162 --VVPTEITACALLIEYWTDANAAIFVTIFMILATLLSLLPVKIFGESEFCVSIIKILTI 219

Query: 256 TGFIILSIVIITGGA-GKDGYIGAKYWIHPGPFAH--------GFKGVCTVFTYAAFSYG 306
            G I++ +VI  GG   +   +G  YW  PG F           F  V      + F++ 
Sbjct: 220 LGLILVGVVIFFGGGPAQHKVLGFHYWNTPGAFNSYLVKGSTGAFLAVWKAIIKSGFAFV 279

Query: 307 GIEVVVLSID-EQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXX-- 363
            I  +  S   E   P   +P AC++                  +V YD           
Sbjct: 280 MIPEITSSCSAEAAFPRKNMPRACQRFVYRLAVFYVLGCLVIGVIVGYDNKTLNEAISSG 339

Query: 364 -XXXXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQW 422
                   FVI I+  G++++PH INA IL                           P++
Sbjct: 340 KANAAASPFVIGIQEAGIRILPHIINACILTSAYSCSTSELYGASRVLHSLALRGDAPKF 399

Query: 423 LNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIR 482
            + ++  G P      + LFG++ ++  S     VF WL  I+ +S    W+ +S++++R
Sbjct: 400 FSKVNKYGVPYYSVAATSLFGVLAYLNCSKSSLVVFNWLSNIATISGFVNWVFVSITYLR 459

Query: 483 LRDAMKSQGKSLDEIGYKAQTGYWGSWL-AVFIGFFSLVTQFWVAIAPVEKHGELDVVNF 541
            R  +    K  D + Y+ +     ++  A+F    ++   F+V IA     G  +V +F
Sbjct: 460 FRK-ITDYLKINDRVPYRRRGQRALAYASAIFFALLAITNGFYVFIA-----GNWNVSDF 513

Query: 542 FQNYLAFPIVLVAYLGHKIYYKNW 565
           F  Y+    V V ++G  IYYK W
Sbjct: 514 FTCYVTIGFVGVLFIGSSIYYKEW 537

>CAGL0E05632g complement(556619..558415) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease, hypothetical start
          Length = 598

 Score =  157 bits (397), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 130/499 (26%), Positives = 207/499 (41%), Gaps = 29/499 (5%)

Query: 100 QLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGE 159
           +L + +KSRH+ +I+LG  I TGL VG    L   GPAGL I Y + S +IY I+   GE
Sbjct: 74  ELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGIGE 133

Query: 160 LGICYRGLVGN----FTRY-PSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWT 214
           + +CY    G+    F  Y     +D SLGFA +  Y   ++ ++  +   A+  + +WT
Sbjct: 134 M-VCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYWT 192

Query: 215 DVNPDXX-XXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKD 273
              P               N    + Y E+EF+    KIL I G IILS ++  GG    
Sbjct: 193 TSVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGGPNH 252

Query: 274 GYIGAKYWIHPGPFAHGFKG--------VCTVFTYAAFSY-GGIEVVVLSIDEQEDPVSA 324
             +G +YW +PG FAH  +G        + T      F++  G E++ ++  E ED    
Sbjct: 253 DRLGFRYWQNPGGFAHHIRGGSFGSFLDIYTGIIKGGFAFILGPEMIAMTSSEVEDQRRN 312

Query: 325 VPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXX---XXXXXFVIAIESHGVK 381
           +  A ++                  +V Y+                   FVI I++ G+K
Sbjct: 313 IAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQNAGIK 372

Query: 382 VVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISIL 441
           V+PH INA IL                           P+    ++  G P     +S  
Sbjct: 373 VLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAVGLSSA 432

Query: 442 FGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKA 501
              + ++  S    DVF W   IS +S    W+ + +++IR   A+   G     + Y A
Sbjct: 433 ISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGMQ-SRLPYTA 491

Query: 502 Q-TGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKI 560
           +   Y   W  + I   +L   + V I         D  NF   Y+  P+  V ++GH++
Sbjct: 492 RGMPYLIYWPLLVISIITLTNGYEVFIPRF-----WDAKNFVAAYITLPVFWVLWIGHRV 546

Query: 561 YYK---NWRLWIPADKIDL 576
           Y +     + W   ++ID+
Sbjct: 547 YRRKIFTLKWWKSIEEIDV 565

>KLLA0F23419g complement(2187386..2189107) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease, start by similarity
          Length = 573

 Score =  154 bits (388), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 130/519 (25%), Positives = 214/519 (41%), Gaps = 29/519 (5%)

Query: 84  KRKDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGY 143
             K+  L +  ++ D  L K +KS H+ +I++G  I TGL VG    L K GPAGL I Y
Sbjct: 35  SEKNGSLPNKPQSGDHNLKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISY 94

Query: 144 TVSSIMIYCIIHAAGELGICYRGLV------GNFTRYPSILIDPSLGFAISLLYTLQWLT 197
            + S +IY +++A  E+     GL       G+ +   +  +D SLGFA+   Y   ++ 
Sbjct: 95  CIMSTIIYPVMNALAEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVI 154

Query: 198 VLPLQLVTAAITISFWTDVNPDXX-XXXXXXXXXXXNLFGARGYAETE-FFCNCCKILMI 255
           ++  +   A+  +++WT   P               N      Y  +E  FC+  KI  I
Sbjct: 155 LVAAECTAASGVVTYWTTAVPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFCS-LKIFCI 213

Query: 256 TGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAH----GFKG----VCTVFTYAAFSY-G 306
            G II+SIV+  GG      +G ++W  PG +A+    G  G    + T    A F++  
Sbjct: 214 LGIIIVSIVLFFGGGPNHDRLGFRFWKDPGAWAYHLADGGAGRLSDIITGVIRAGFAFIL 273

Query: 307 GIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYD---XXXXXXXXX 363
           G E+VVL+  E +D    +  A ++                  +V  +            
Sbjct: 274 GPELVVLTSTEAQDSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGK 333

Query: 364 XXXXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWL 423
                  FVI I++ G+KV+PH IN  IL                           P+  
Sbjct: 334 PGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIF 393

Query: 424 NFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRL 483
           N ++  G P      +  F  + ++  S    DVF W   IS +S    W+   ++++R 
Sbjct: 394 NRVNRWGVPYTGVAFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRF 453

Query: 484 RDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQ 543
           R A+       D + +K     + +W      F+ ++      I   E     +  +F  
Sbjct: 454 RKAVFFN-NLYDRLPFKTPFQPYFTW------FYIILIAIICLINGYESFVHWNYKDFIA 506

Query: 544 NYLAFPIVLVAYLGHKIYYKNWRLW-IPADKIDLDSHRR 581
            Y+  P+ L+ +LGHK Y + W  W I   +ID+ +  R
Sbjct: 507 AYITLPLFLILWLGHKAYTRTWSQWMISVSEIDVTTGLR 545

>AFR156W [3348] [Homologous to ScYOR348C (PUT4) - NSH]
           complement(717645..719321) [1677 bp, 558 aa]
          Length = 558

 Score =  151 bits (381), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 130/514 (25%), Positives = 211/514 (41%), Gaps = 28/514 (5%)

Query: 84  KRKDSDLDSDVEAQDTQ--------LSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAG 135
           K K     + +E  +TQ        L K ++SRH+ +I+LG  I TGL VG    L   G
Sbjct: 21  KVKTPHSRTSLEELETQSAGSEYNTLHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCG 80

Query: 136 PAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQW 195
            A L++ + + S ++Y I+ +  E+ ICY    G+     S  +DPSLGFA    Y   +
Sbjct: 81  AAPLLLSFILISTIVYPIMCSLAEM-ICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAY 139

Query: 196 LTVLPLQLVTAAITISFWTDVNPDXX-XXXXXXXXXXXNLFGARGYAETEFFCNCCKILM 254
             ++  +L  AA  +S+W +  P               N    + Y E EF+    K++ 
Sbjct: 140 AILVAAELSAAASVVSYWDNPVPMAAWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLIC 199

Query: 255 ITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAHG--------FKGVCTVFTYAAFSY- 305
           I G +++S+VI  GGA      G +YW +PGPFA          F  V      +AF++ 
Sbjct: 200 ILGLLVVSVVIFFGGAPNHDRTGFRYWKNPGPFAMSLAPGSTGRFLDVWRAVIKSAFAFI 259

Query: 306 GGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPY---DXXXXXXXX 362
              E++ ++  E +D       A ++                  ++              
Sbjct: 260 LSPELIGIACVEAQDTRRNTEKASRRFIYRIIFFYVSCALMIGVILSRTDPKLIEALETG 319

Query: 363 XXXXXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQW 422
                   FV  I + G+ V+ H IN  IL                           P++
Sbjct: 320 APGAASSPFVQGIANAGIPVLDHVINVAILSSAWSAGNSFMYASTRMVLALAREGNAPKF 379

Query: 423 LNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIR 482
           L  I+  G P    I+  L   + ++       +VF WL  I  +S    W +M ++ IR
Sbjct: 380 LTKINRYGVPYNAVIVCTLVACLAYLNVKTTSANVFQWLSNICTISGFIGWFAMGIAFIR 439

Query: 483 LRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFF 542
            R  +         I Y+   G    ++A +  F ++V           K G  +VV+F 
Sbjct: 440 FRRGIVFNNLQ-SRIPYQ---GPLQPYIAYYFTFMTVVVCLTNGFHVFLK-GRWNVVDFV 494

Query: 543 QNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDL 576
             Y+  PI LV YLGHK++++  R +IP ++ID+
Sbjct: 495 AAYVTLPIYLVLYLGHKLWFRT-RWYIPVEQIDV 527

>Scas_552.3
          Length = 558

 Score =  149 bits (376), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 132/493 (26%), Positives = 199/493 (40%), Gaps = 43/493 (8%)

Query: 88  SDLDSDVEAQDTQ-LSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVS 146
           ++ D D EA   + L + +K RH+ MIS+   I TGL +   + L + GPA L + YT+ 
Sbjct: 40  TEEDYDPEANIREDLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPASLFMNYTIM 99

Query: 147 SIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLT--------V 198
             ++Y  +   GE+   Y  + G+F  Y       S  FA +L++   W          +
Sbjct: 100 GGVVYLTLLCLGEMS-TYMPISGSFCSYAKKFGSES--FACALMWNY-WFNDAVSVASDM 155

Query: 199 LPLQLV-----TAAITISFWTDVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKIL 253
             LQLV     T A    +W                   N+   R Y E E++    K++
Sbjct: 156 TALQLVMDYWDTEASGFPYWA------ASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKVI 209

Query: 254 MITGFIILSIVIITGGAGKDGYIGAKYWIH-PGPFAHGFKGVCTVFTYAAFSYGGIEVVV 312
            I  F ILSIV+  G   +  YIG K W H   PF  GFKG  ++F  A+F+YGG E + 
Sbjct: 210 AIIIFFILSIVVNVGHNPQHEYIGFKNWNHGEAPFVDGFKGFASLFVSASFAYGGTESIT 269

Query: 313 LSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFV 372
           L+  E  +P+   P   K                    +PYD                F 
Sbjct: 270 LTNGEAANPLRNTPKIVKTVFWRILVFYVGSTFFIAMNIPYD---YPGLDTKSVVTSPFT 326

Query: 373 IAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGR- 431
           +  +  G K    F+NAVI+                           P+    +    R 
Sbjct: 327 LVFQMAGTKAAGSFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPK--KIVSRTNRY 384

Query: 432 --PIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKS 489
             P    +I+   G++ F A+      V+TWL  I G+S    W+ + ++ IR R  ++ 
Sbjct: 385 KVPYVSVLITSSIGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEK 444

Query: 490 QGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYL--- 546
           QGK+  E+ YK  T  +G +  V    F ++ Q W A  P       DV NFF  YL   
Sbjct: 445 QGKT-HELRYKNWTYPYGPYFLVIFVTFIILVQGWSAFDP------WDVTNFFSYYLDLF 497

Query: 547 AFPIVLVAYLGHK 559
            FP   + +  +K
Sbjct: 498 VFPFCFIIWWLYK 510

>KLLA0B14685g complement(1289025..1290740) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease P23. 1.f18.1, start by
           similarity
          Length = 571

 Score =  147 bits (372), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 132/540 (24%), Positives = 227/540 (42%), Gaps = 35/540 (6%)

Query: 48  KREIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKDSDLDSDVE--AQDTQLSKTI 105
            +++E+S++  AS   +   S    +  F          D    SD+E      ++ + +
Sbjct: 2   SKKLELSQQ--ASISLSPYISNRIKEQAFSSVNDVIGDSDQGSYSDIENFKPPQKIVRGL 59

Query: 106 KSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYR 165
           K+RH+ +I+LG+ I TGL +G+G  L+  GPA L+I Y + S  ++ I++   E+ +C  
Sbjct: 60  KTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAYIIISFFVWSIMNQMTEM-VCLI 118

Query: 166 GLVGNFTRY--PSILIDPSLGFAI--SLLYTLQWLTVLPLQLVTAAITISFWTDVNPDXX 221
            L G  + Y      ++  + F    +L Y +    ++P ++   A+ + +WTD N    
Sbjct: 119 PLPGEASLYSLAKTYLNSPISFMCGWNLFYAMA--MIVPAEITACALLVQYWTDANSAIF 176

Query: 222 XXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGA-GKDGYIGAKY 280
                       +   + + E+EF+ +  KIL I G II+ IVI  GG   +D  +G  Y
Sbjct: 177 ISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLIIVGIVIFFGGGPAQDHVLGFHY 236

Query: 281 WIHPGPF----AHG----FKGVCTVFTYAAFSYGGIEVVVLSID-EQEDPVSAVPNACKK 331
           W +PG F    A G    F  V T    + FS+  +   V S   E   P   +P AC++
Sbjct: 237 WKNPGAFNPHLAEGNTGRFLAVWTAIIKSGFSFVLVPETVTSCSAECIAPRRNMPKACQR 296

Query: 332 XXXXXXXXXXXXXXXXCFLVPYD---XXXXXXXXXXXXXXXXFVIAIESHGVKVVPHFIN 388
                             +V ++                   FVI I+  G+K++PH IN
Sbjct: 297 FIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSDAAASPFVIGIQEAGIKILPHIIN 356

Query: 389 AVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFV 448
           A IL                           P+    ++  G P     ++ LF  + ++
Sbjct: 357 ACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKVNRFGTPYYSTGLASLFSFLAYL 416

Query: 449 AASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGS 508
             S     VF WL  I+ +S    W+ +S+++IR R  + +   + D + ++       +
Sbjct: 417 NCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKVINALDLN-DRVPFRRPFQVPLA 475

Query: 509 WLAVFIGFF---SLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNW 565
           +L    GFF   SL   + V +      G  +V +FF +Y+    V+  YL    YYK W
Sbjct: 476 YLTC--GFFFILSLTNGYAVFV-----KGNWNVSDFFASYVTIGFVIFLYLVGSFYYKQW 528

>Scas_84.1
          Length = 213

 Score =  134 bits (338), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 102/206 (49%), Gaps = 5/206 (2%)

Query: 254 MITGFIILSIVIITGGAGKDGYIGAKYWIHPGPF-----AHGFKGVCTVFTYAAFSYGGI 308
           M+TGF IL IV+I GGAG DGYIG K W +PG F        FKGV +    AAF++G  
Sbjct: 1   MLTGFFILGIVVICGGAGNDGYIGTKLWHNPGSFRGDKPVDRFKGVASTLANAAFAFGMT 60

Query: 309 EVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXX 368
           E + ++  EQ +P  A+P+A K                  +LVPYD              
Sbjct: 61  EFLGVTASEQSNPRKAIPSAAKNMLYRIICIYLGSVTIVGYLVPYDSDQLLGTSGAATKA 120

Query: 369 XXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDM 428
             +V+AI  HGV+VVPHFI+AVIL+                          P +LN++D 
Sbjct: 121 SPYVLAISVHGVRVVPHFIHAVILMSVVSVGNSAFYSTSRQLLPLSQLGYAPSFLNYVDR 180

Query: 429 NGRPIRCFIISILFGMIGFVAASDKR 454
           NGRP++ + +S L G+I + A S + 
Sbjct: 181 NGRPMKAYCVSPLAGVIAYCATSPEE 206

>Scas_377.1
          Length = 148

 Score =  132 bits (331), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 62/119 (52%), Positives = 84/119 (70%), Gaps = 1/119 (0%)

Query: 465 SGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFW 524
           SGLSQLF W S+ LSH+R R AM+ QG+S+ E+G+K+Q G +GS  +  +    L+ QFW
Sbjct: 1   SGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFW 60

Query: 525 VAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRRIY 583
            A+ PV + G+ DV  FF+NYLA PI +V Y G KI+ K+WRL+I A+ IDL SHR I+
Sbjct: 61  TALVPVGE-GKPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLFIRAEDIDLVSHREIF 118

>Kwal_8.590
          Length = 629

 Score =  141 bits (355), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 109/537 (20%), Positives = 216/537 (40%), Gaps = 29/537 (5%)

Query: 37  SMVSIEIESTKKREIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKDSDLDSDVEA 96
           ++VS    S KK   E++   +   +T              DF    + +DS     +  
Sbjct: 65  TIVSQMSVSGKKEAFELNVTSLEEGETAT----------IDDFV--LQNRDSPKSQSLSL 112

Query: 97  QDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHA 156
           ++    + +  R + MI +G  I T L V  G  + + GP  L+I + + S+ ++  +  
Sbjct: 113 EERIARRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLIAFCLWSV-VFIGLSK 171

Query: 157 AGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDV 216
              + + Y  + G+F  +    +D S GFA+   Y +     +  ++    + + +WTD 
Sbjct: 172 CMCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEITAVCLVVEYWTDK 231

Query: 217 NPDXXXXXXXXXXX-XXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGY 275
            P               NL+    + E EF+ +  K+++  G II ++V++ GG  +   
Sbjct: 232 IPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNPQHTV 291

Query: 276 IGAKYWIHPGPFAH--------GFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPN 327
           +G K W +PG FA          F G  +   +A + + G++ +  +  E  +P   +P+
Sbjct: 292 LGFKNWSNPGAFAEYISDGSVGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRKVIPS 351

Query: 328 ACKKXXXXXXXXXXXXXXXXCFLVPY---DXXXXXXXXXXXXXXXXFVIAIESHGVKVVP 384
           + +K                  L+PY   +                +V A+++ G++V+P
Sbjct: 352 SFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGIRVLP 411

Query: 385 HFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGM 444
           H +N +IL                           P+        G P+ C I  ++   
Sbjct: 412 HIVNILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVLVICG 471

Query: 445 IGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTG 504
           + +++ S+   +V TW L +   +   +++ + +S+++ R    +Q   L  + Y + + 
Sbjct: 472 LAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYYSSSL 531

Query: 505 YWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIY 561
            + +W ++F     LV    V    V   G  D  +F  +Y   P  LV   GHK+Y
Sbjct: 532 PYLAWHSLFW----LVLMLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLVFLFGHKLY 584

>CAGL0M00154g 22039..23691 similar to sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or sp|P04817 Saccharomyces
           cerevisiae YEL063c CAN1, hypothetical start
          Length = 550

 Score =  135 bits (340), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 118/503 (23%), Positives = 198/503 (39%), Gaps = 24/503 (4%)

Query: 88  SDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSS 147
           SD D +   ++  L++ +  RH+ MIS+   I TGL +   + L   GPA L + YT+  
Sbjct: 34  SDFDPEQNIRE-DLTRALSPRHINMISIAGIIGTGLYLSTAKSLHNGGPASLFMNYTIIG 92

Query: 148 IMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAA 207
            ++Y  +   GE+   +  + G+F  Y       S   A+   Y       +   L    
Sbjct: 93  GVVYLTMLCLGEMS-TFMPISGSFCSYARKFGSESFACALMWNYWFNDAVSVASDLTALQ 151

Query: 208 ITISFWTDVNPDX----XXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSI 263
           + + +W   +                   N+   R Y E E++    K++ I  F I+SI
Sbjct: 152 LVLDYWHTADHHFPYWGASLIFWFFVLFLNVIHVRIYGEAEYWLAMLKVIAIVIFFIMSI 211

Query: 264 VIITGGAGKDGYIGAKYWIH-PGPFAHGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPV 322
           ++  G   +  YIG K W H   PF +GFKG  ++F  A F+YGG E + L+  E  +PV
Sbjct: 212 IVNVGKNPQHEYIGFKNWTHGEAPFVNGFKGFASLFVSACFAYGGTESITLTGGEASNPV 271

Query: 323 SAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKV 382
              P   K                    +PYD                F +  +  G + 
Sbjct: 272 RNTPKIVKTVFWRILIFYVLSTFFIGMNIPYD---YPGLSTKSVMTSPFTLVFQMAGTRG 328

Query: 383 VPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGR---PIRCFIIS 439
              F+NAVIL                           P+    +    R   P    +I+
Sbjct: 329 AGSFMNAVILTSVISACNHALFAGSRIMYNMALDGYLPK--KIVGRTNRYKAPYVAVLIT 386

Query: 440 ILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGY 499
              G +   A+      ++TWL  I G+S    W+ + ++ IR R  ++ QGK+ D + +
Sbjct: 387 WAVGGLCLGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEVQGKT-DLLQF 445

Query: 500 KAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHK 559
           K  T  +G +  V    F ++ Q W A  P        V +FF  YL   +    Y+   
Sbjct: 446 KNWTYPFGPYFLVIFTVFIILIQGWQAFDP------WSVTDFFSVYLELFVFPFVYIIWW 499

Query: 560 IYYKNWRLWIPADKIDLDSHRRI 582
           ++ ++W  ++  + +D  + R I
Sbjct: 500 LWKRDW--FVKYEDMDFVTDRYI 520

>Kwal_26.8097
          Length = 544

 Score =  129 bits (324), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 127/496 (25%), Positives = 201/496 (40%), Gaps = 29/496 (5%)

Query: 84  KRKDSDLDSDVEAQDT-----QLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAG 138
           +   SD+  D E Q+       L++++  RH+ MIS+   I TGL +G G+ LAK GPA 
Sbjct: 18  RTSSSDVQYDSEGQEADHVREHLNRSLTPRHINMISIAGVIGTGLYLGTGKALAKGGPAS 77

Query: 139 LIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTV 198
           L+I Y++  +++Y  +   GE+   +  + G+F  Y       SL F +   Y       
Sbjct: 78  LVINYSIIGLVVYLTMLCLGEMS-TFMPISGSFCSYAKKFGSGSLAFTLMCNYWFNDAVS 136

Query: 199 LPLQLVTAAITISFWTDVNPD----XXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILM 254
           +   L    + + FW   +                   N+   R Y E E++    K++ 
Sbjct: 137 VASDLTALQLILDFWKTSDAHFPYWAASLIFWFVLLLLNVVHVRVYGEAEYWLAMLKVIA 196

Query: 255 ITGFIILSIVIITGGAGKDGYIGAKYW-IHPGPFAHGFKGVCTVFTYAAFSYGGIEVVVL 313
           I  F I+SIV+  G      YIG K W +   PF +GFKG  ++F  ++F+YGG E + L
Sbjct: 197 IIIFFIISIVVNAGHNQDHSYIGFKNWSVGEAPFVNGFKGFASLFVSSSFAYGGTESITL 256

Query: 314 SIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVI 373
           +  E ++P+   P   K                    VPY+                F I
Sbjct: 257 TAGEAKNPIRNTPKIIKTVFWRILIFYVFTTFFIGMNVPYN---YPKLSEKSVMTSPFTI 313

Query: 374 AIESHGVKVVPHFINAVILIXXXXX-XXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRP 432
             +  G K    F+NAVIL                            P  +   +    P
Sbjct: 314 VFQMVGTKAAASFMNAVILTSVISAGNHALFAGSRVLFNLGLEGYFFPSIITKTNRYQIP 373

Query: 433 IRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGK 492
               +I+   G + F ++      ++TWL  I G+S    W+ +S+  IR R  +  QGK
Sbjct: 374 YVAVLITWAAGGLCFGSSFVGAGTLWTWLQNIVGVSNQIAWLCISIVSIRFRRGLAKQGK 433

Query: 493 SLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVL 552
           +  E+ +   T  +G +  V    F ++ Q W + AP       +V +FF  Y+   IV 
Sbjct: 434 T-HELQFSNWTYPYGPYFLVLFVSFIILVQGWSSFAP------WNVTDFFSYYIEL-IVF 485

Query: 553 VAYLGHKIYYKNWRLW 568
           VA       Y  W LW
Sbjct: 486 VA------LYVFWWLW 495

>KLLA0C15873g 1381699..1383405 similar to sp|P38090 Saccharomyces
           cerevisiae YBR132c AGP2 amino-acid permease, start by
           similarity
          Length = 568

 Score =  114 bits (285), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 112/504 (22%), Positives = 191/504 (37%), Gaps = 23/504 (4%)

Query: 91  DSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMI 150
           D +    +   S+ +++RH+ +I +   I T L V  G+ L + GP  LI+G+++  I I
Sbjct: 43  DDNSSYFNNSTSRKLQNRHVQLIGISGVIGTALFVSIGKALYRGGPVSLILGFSLWCIPI 102

Query: 151 YCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITI 210
            CI  +  E+ +CY  +   F R      + SL       +       +P ++V     +
Sbjct: 103 LCITVSTAEM-VCYLPISSPFLRMAKRCCNDSLAVTAGWNFWFLECVQIPFEIVAVNTIL 161

Query: 211 SFWT-DVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGG 269
            +W  D +P              +LF  R Y ETE F    KIL+  G  + + + + GG
Sbjct: 162 HYWRDDFSPAIPLCVQVLLYIGISLFAVRCYGETEAFLASFKILLAIGLFLFTFITMLGG 221

Query: 270 AGKDGYIGAKYWI----------HPGPFAHG-FKGVCTVFTYAAFSYGGIEVVVLSIDEQ 318
             K    G +Y            + G  + G F+G       A+F+  G + V +   E 
Sbjct: 222 NPKHDRYGFRYITDTKFKQYFPNNEGSSSMGYFQGFLACVIQASFTIAGPDYVAMIAGEC 281

Query: 319 EDPVSAVPNACKKXXXXXXXXXX---XXXXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAI 375
           + P   +P A K+                   C     +                +VIA+
Sbjct: 282 KLPRKVLPVAFKQVFIRLTVLFLGGCLCVGIVCSSNDPNLTAVINNPRPGAGSSPYVIAM 341

Query: 376 ESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRC 435
            + G+KV+P  +NA ++                           P+   +   +G PI  
Sbjct: 342 NNLGIKVLPDVVNAALVTAAFSAGNAYTYCSSRTLYGLSLDGYAPKLFQYCTKSGVPINA 401

Query: 436 FIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKS-- 493
            ++S+ +  I  +        V  WL+ +   SQL  +  + + ++  R A   Q  S  
Sbjct: 402 VLVSLAWAFISLLQLGSNSAVVLNWLINLITASQLINFSILCVIYLSFRRAYIKQHPSGE 461

Query: 494 LDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLV 553
           L E+ +K+    WG     + G F++     V    V  HG  +V +F   YL   I L 
Sbjct: 462 LPELPFKS----WGQPYTAYCGLFAVTLMIGVQGYTVFLHGSWEVQSFLFCYLMVFIDLG 517

Query: 554 AYLGHKIYYKNWR-LWIPADKIDL 576
            +L     YK  R  W+  +  DL
Sbjct: 518 IFLLCFFVYKRTRDPWVKPEDADL 541

>Scas_485.4*
          Length = 237

 Score =  107 bits (268), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 95/206 (46%), Gaps = 3/206 (1%)

Query: 86  KDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTV 145
           K+   +  VE +   + + +K RH+ MI+LG  I TGL +G    L  AGP G +I Y  
Sbjct: 2   KEEIREISVEVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLF 61

Query: 146 SSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVT 205
            + + Y +  + GE+   +  +  +FT +    + P+ G A   +Y   W     L+L  
Sbjct: 62  MATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSV 120

Query: 206 AAITISFWTDVNP-DXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIV 264
               I FWT   P               N+F  + Y E EF+    K++ I GF+I    
Sbjct: 121 VGQVIQFWTFAVPLAAWISIFWMLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFC 180

Query: 265 IITGGAGKDGYIGAKYWIHPGPFAHG 290
           ++  GAG  G +G +YW HPG F  G
Sbjct: 181 MVC-GAGVTGPVGFRYWRHPGAFGPG 205

>Scas_476.4
          Length = 237

 Score =  107 bits (268), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 95/206 (46%), Gaps = 3/206 (1%)

Query: 86  KDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTV 145
           K+   +  VE +   + + +K RH+ MI+LG  I TGL +G    L  AGP G +I Y  
Sbjct: 2   KEEIREISVEVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLF 61

Query: 146 SSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVT 205
            + + Y +  + GE+   +  +  +FT +    + P+ G A   +Y   W     L+L  
Sbjct: 62  MATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSV 120

Query: 206 AAITISFWTDVNP-DXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIV 264
               I FWT   P               N+F  + Y E EF+    K++ I GF+I    
Sbjct: 121 VGQVIQFWTFAVPLAAWISIFWMLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFC 180

Query: 265 IITGGAGKDGYIGAKYWIHPGPFAHG 290
           ++  GAG  G +G +YW HPG F  G
Sbjct: 181 MVC-GAGVTGPVGFRYWRHPGAFGPG 205

>Scas_642.22
          Length = 237

 Score =  104 bits (260), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 94/206 (45%), Gaps = 3/206 (1%)

Query: 86  KDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTV 145
           K+   +  VE +   + + +K RH+ MI+LG  I TGL +G    L  AGP G +I Y  
Sbjct: 2   KEEIREISVEVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLF 61

Query: 146 SSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVT 205
            + + Y +  + GE+   +  +  +FT +    + P+ G A   +Y   W     L+L  
Sbjct: 62  MATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSV 120

Query: 206 AAITISFWTDVNP-DXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIV 264
               I FWT   P               N+F  + Y E EF+    K++ I GF+I    
Sbjct: 121 VGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFC 180

Query: 265 IITGGAGKDGYIGAKYWIHPGPFAHG 290
           ++  GAG  G +  +YW HPG F  G
Sbjct: 181 MVC-GAGVTGPMSFRYWRHPGAFGPG 205

>Kwal_23.4026
          Length = 534

 Score =  108 bits (270), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 107/550 (19%), Positives = 206/550 (37%), Gaps = 50/550 (9%)

Query: 56  KPIASADTTVSTSKCNAKTYFQDFCHSFKRKDSDLDSDVEAQDTQLSKTIKSRHLLMISL 115
           K + + DT  S ++ N + Y  DF  +           +      L +  K RH+ M+++
Sbjct: 12  KRVDTLDTGNSDTQQNGEVYELDFQEA-----------IGESSQTLQRGFKQRHVDMLAI 60

Query: 116 GTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYP 175
              I TGL++G G  L + GP  L+I +  +  ++  ++ +  E+   +  +  +F+ Y 
Sbjct: 61  AGAIGTGLVIGTGTALKRGGPGSLLIAFIFTGSLLIGVLMSLAEMA-SFAPMDKSFSGYA 119

Query: 176 SILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFW-TDVNPDXXXXXXXXXXXXXNL 234
           +  +DP+LGFA    Y L++   L  +L    + + +W  D++               N 
Sbjct: 120 TRYVDPALGFATGWNYFLKYAIALASELSAIGLLVQYWREDLSIAIFIVVFLVVLLSLNF 179

Query: 235 FGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAHGFKGV 294
              + Y E EF+    K L++    +  +V+  GG      IG +YW       +  KG 
Sbjct: 180 MNIKFYGEVEFWSALLKFLVLIICFVTGLVLTCGGGPSKETIGFRYWREYAFVPYLVKGT 239

Query: 295 CTVF-------TYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXX 347
              F         + ++Y G E + +   E  +P   +P A +                 
Sbjct: 240 TGRFLGWWACVIQSCYAYIGSETIGVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVLIL 299

Query: 348 CFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXX 407
             ++                   FVIA  + G+K +P FINA++++              
Sbjct: 300 GLIISPHDKTLANAKTSDASGSPFVIAFTNAGIKGLPSFINAMLIMFIASAANTALYVCS 359

Query: 408 XXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGL 467
                       P+     +  G P    +++ L  ++ F+  S+    +F +L +   +
Sbjct: 360 RTAYGLAKDGMAPKIFLAQNRYGVPFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSVTV 419

Query: 468 SQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAI 527
                W+S+ +S+I    A        D I ++     + +++ +F  F SL+       
Sbjct: 420 FGTLNWLSVLISYIGYERARVFHDVPRDRIPFRMWFQPYSAYVCLF--FVSLII------ 471

Query: 528 APVEKHGELDVVNFFQNYLAF------PIVLVAYLGHKIYYKN---WRLWIPADKIDLDS 578
                        FF  Y AF         +V+Y+G  ++  N   W+ W  +     + 
Sbjct: 472 -------------FFNGYSAFIAGFKYKSFIVSYIGIAVFIGNTLFWKFWKKSAATRPED 518

Query: 579 HRRIYSATAV 588
            R I    A+
Sbjct: 519 LRSIMVEEAI 528

>Scas_460.3
          Length = 584

 Score =  105 bits (263), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 118/568 (20%), Positives = 216/568 (38%), Gaps = 69/568 (12%)

Query: 44  ESTKKREIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKRKDSDLDSD---------- 93
           ++T K++  + E+ + S          + +T F D  +   + D+DLDSD          
Sbjct: 5   DTTIKQQTIIDEESLTS----------HRRTPFAD--NKGGKVDTDLDSDDFFIPTTSRG 52

Query: 94  ---VEAQDTQ----------LSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLI 140
              V +QD              + + +RH+ +I++   I T + V  G+ L + GPA L+
Sbjct: 53  TTSVSSQDNDSKTFLVASHTTKRNLVNRHVQLIAISGVIGTAIFVAIGKPLYRGGPAFLL 112

Query: 141 IGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLP 200
           + + +  I I CI  +  E+ +C+  +   F R  +  +D SL    S  +       +P
Sbjct: 113 LAFAIWCIPILCITVSTAEM-VCFMPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIP 171

Query: 201 LQLVTAAITISFWT-DVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFI 259
            ++VT    I +W  D +               +L   + Y E EF+    KI++  G  
Sbjct: 172 YEIVTVNTIIHYWRDDYSAAIPLVIQSLLYLLISLAAVKWYGEMEFWLASFKIVLAMGLF 231

Query: 260 ILSIVIITGGAGKDGYIGAKYWIHPGPF-------------AHGFKGVCTVFTYAAFSYG 306
             + + + GG  K    G +Y+ H  PF             A  F+G       A+F+  
Sbjct: 232 CFTFITMLGGNPKKDRFGFRYF-HDTPFKKYFPDGIDRGSSAGYFQGFFICLIQASFTIA 290

Query: 307 GIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLV-PYDXXXXXXXXXXX 365
           G E + +   E E P   +P A K+                  L  P D           
Sbjct: 291 GGEYISMLAGEIEIPRRVLPRAFKQVFMRLTILFLGSCLCVGILCSPNDSSLTAAINEAR 350

Query: 366 --XXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWL 423
                  +VIA+ + G++++P  +N  ++                           P+  
Sbjct: 351 PGAGSSPYVIAMNNLGIRILPDIVNITLITAAFSSGNAYTYCSSRTLYGMALDGYAPKIF 410

Query: 424 NFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRL 483
              +  G PI    +S+L+  I  +  +     V  WL+ I   SQL  +  + ++++  
Sbjct: 411 TRCNKQGVPIYAVGVSLLWAFISLLQLNSNSAIVLNWLINIITASQLINFAILCITYLFF 470

Query: 484 RDAMKSQGKSLDEIGYKAQTGYWGSWLAVF---IGFFSLVTQFWVAIAPVEKHGELDVVN 540
           R A   Q   L E+ +K+   +W  + A+F        ++ Q +    P   +       
Sbjct: 471 RRAYLLQKDKLPELPFKS---WWQPYTAIFGLVCAMVMMIVQGYTVFFPKNWN------- 520

Query: 541 FFQNYLAFPIVLVAYLGHKIYYKN-WRL 567
             Q++L   +++   +G  I+YK  WRL
Sbjct: 521 -VQDFLFCYLMIFINIGIYIFYKFIWRL 547

>AAR038W [224] [Homologous to ScYBR132C (AGP2) - SH]
           complement(409071..410771) [1701 bp, 566 aa]
          Length = 566

 Score =  105 bits (261), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 108/516 (20%), Positives = 197/516 (38%), Gaps = 24/516 (4%)

Query: 81  HSFKRKDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLI 140
           HS +  D    +    +     + +++RH+ +I +   I T L V  G+ L + G   L+
Sbjct: 33  HSSEVGDEASSAGFAGKYHSTYRKLENRHVQLIGISGVIGTALFVSIGKALYRGGSVSLL 92

Query: 141 IGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLP 200
           +G+ +  + I CI  +  E+ +CY  L   F R  S  ++ SL       +       +P
Sbjct: 93  LGFALWCVPILCITVSTAEM-VCYLPLNSPFLRLASRCVNDSLTVMAGWNFWFLECVQIP 151

Query: 201 LQLVTAAITISFWT-DVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFI 259
            ++V     I +W  D +               +LF  R Y E EF+    K+L+  G  
Sbjct: 152 FEIVAVNSIIHYWRDDYSAAITLVVQVMLYLLISLFAVRYYGEIEFWLASFKVLLAVGLF 211

Query: 260 ILSIVIITGGAGKDGYIGAKYWIHPGPF-------------AHGFKGVCTVFTYAAFSYG 306
             + V + GG  K    G +Y I   PF             A  F+G       A+F+  
Sbjct: 212 CFTFVTMVGGNPKRDRYGFRY-IGEAPFKQYSPTMEPISSSAGYFQGFLACLIQASFTIA 270

Query: 307 GIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXX---XXXXXXCFLVPYDXXXXXXXXX 363
           G + V +   E + P   +P A K+                   C     D         
Sbjct: 271 GPDYVSMIAGETKLPRKVLPVAFKQVFIRLTVLFLGGCLCVGIVCSANDPDLTAAINASR 330

Query: 364 XXXXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWL 423
                  +VIA+   G+K++P  +NA ++                           P   
Sbjct: 331 PGAGSSPYVIAMNHLGIKILPDIVNAALVTAAFSAGNAYTYCSSRSLYGLALDGYAPAIF 390

Query: 424 NFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRL 483
              +  G PI    +S+++ ++  +  +     V  WL+++   SQL  +  + + ++  
Sbjct: 391 KRCNRFGVPIYAVSVSVMWSVLSLLQLNSNSAVVLNWLISLITASQLINFGVLCVVYLYF 450

Query: 484 RDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQ 543
           R A  +Q  +L E+ +K+   +W  + A ++G   ++    V    V      +V +F  
Sbjct: 451 RRAYLAQQDNLPELSFKS---WWQPYTA-YVGLTCVLLIVVVQGYTVFYSALWNVKDFLF 506

Query: 544 NYLAFPIVLVAYLGHK-IYYKNWRLWIPADKIDLDS 578
            YL   I +  YLG++ I+ +     IP  ++DL +
Sbjct: 507 CYLMVFIDIAIYLGYRYIWRRGKDAVIPPTEVDLTT 542

>Kwal_23.3847
          Length = 579

 Score =  104 bits (259), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 114/521 (21%), Positives = 196/521 (37%), Gaps = 28/521 (5%)

Query: 83  FKRKDSDLDSDVEAQ---DTQLS-KTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAG 138
           F  +  DL   +E +   DT  + + +  RH+++I +   I T L V  G+ L   G A 
Sbjct: 41  FAFESLDLSPPLEGKQSLDTDATHRKLHERHVMLIGISGVIGTALFVSIGKALYHGGSAF 100

Query: 139 LIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTV 198
           L++G  V  I + CI  +  E+ +CY  L   F R  +  +D S+  A    +       
Sbjct: 101 LLLGMAVWCIPMLCITVSTAEM-VCYLPLDSPFLRLTARCVDDSVAVAAGWNFWFLECVQ 159

Query: 199 LPLQLVTAAITISFWTD-VNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITG 257
           +P ++V     I +W D  +               ++F  R Y E EF+    KI++  G
Sbjct: 160 IPFEIVAVNTIIHYWRDDYSAAIPLVVQVVLYFGISVFAVRYYGEMEFWLASFKIILALG 219

Query: 258 FIILSIVIITGGAGKDGYIG--------AKYWIHPG----PFAHGFKGVCTVFTYAAFSY 305
               ++V + GG       G         K +   G    P A  F+G       A+F+ 
Sbjct: 220 LFTFTLVAMLGGNPHKDRFGFRNFGDAPFKQYFPSGVVGTPSAGYFQGFLACLIQASFTI 279

Query: 306 GGIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXX---XXCFLVPYDXXXXXXXX 362
            G + V +   E   P   +P A K                    C     D        
Sbjct: 280 AGPDYVSMIAGETHLPRKVLPVAFKHVFNRLTVLFLGSSLCVGILCSANDPDLTAAINEA 339

Query: 363 XXXXXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQW 422
                   +VIA+++ G++ +P  +NA ++                           P+ 
Sbjct: 340 RPGAGSSPYVIAMKNLGIRALPDVVNAALITAAFSAGNAYTFCSSRTLHGMALDGNAPRI 399

Query: 423 LNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIR 482
               + +G PI    +S+ + ++  +  +     V  WL+ +   SQL  +  + L+++ 
Sbjct: 400 FRRCNRHGVPIYAVAVSLTWALLSLLQLNKNSAVVLNWLINLITASQLINFACLCLTYLY 459

Query: 483 LRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFF 542
            R A  SQ  +L  + +K+    WG      +G F+ +    V    V ++   +V +F 
Sbjct: 460 FRRAYLSQQHNLPSLPFKS----WGQPYTALLGLFASLLMALVQGYSVFQNSLWNVKDFL 515

Query: 543 QNYLAFPIVLVAYLGHKIYYKNWRLWIPADK--IDLDSHRR 581
             YL   + +  YL HK      R   PAD   +DL S  R
Sbjct: 516 FCYLMVFVDIAIYLFHKFVISRGRKG-PADPPAVDLVSGLR 555

>YBR132C (AGP2) [319] chr2 complement(499608..501398) Plasma
           membrane carnitine transporter, required for the
           carnitine-dependent pathway for transport of acetyl-CoA
           from peroxisomes to mitochondria, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1791 bp, 596 aa]
          Length = 596

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 93/481 (19%), Positives = 183/481 (38%), Gaps = 21/481 (4%)

Query: 99  TQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAG 158
           T+  + +++RH+ +I++   I T L V  G+ L + GPA L++ + +  + I CI  +  
Sbjct: 82  TETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTA 141

Query: 159 ELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWT-DVN 217
           E+ +C+  +   F R  +  +D SL    S  +       +P ++V+    I +W  D +
Sbjct: 142 EM-VCFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYWRDDYS 200

Query: 218 PDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGK-DGYI 276
                          ++   + Y E EF+    KI++  G    + + + GG  + D Y 
Sbjct: 201 AGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFTFTFITMLGGNPEHDRYG 260

Query: 277 GAKYWIHP-----------GPFAHGFKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAV 325
              Y   P           G  +  F+G       A+F+  G E + +   E + P   +
Sbjct: 261 FRNYGESPFKKYFPDGNDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVL 320

Query: 326 PNACKKXXXXXXXXXXXX---XXXXCFLVPYDXXXXXXXXXXXXXXXXFVIAIESHGVKV 382
           P A K+                   C     D                +VIA+ +  +++
Sbjct: 321 PKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRI 380

Query: 383 VPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILF 442
           +P  +N  ++                           P+     + +G PI    IS+++
Sbjct: 381 LPDIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKIFTRCNRHGVPIYSVAISLVW 440

Query: 443 GMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQ 502
            ++  +  +     V  WL+ +   SQL  ++ + + ++  R A   Q  SL ++ +++ 
Sbjct: 441 ALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIVYLFFRRAYHVQQDSLPKLPFRS- 499

Query: 503 TGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYY 562
              WG      IG  S      +    V      +  +F  +YL   I +  Y+G+K  +
Sbjct: 500 ---WGQPYTAIIGLVSCSAMILIQGYTVFFPKLWNTQDFLFSYLMVFINIGIYVGYKFIW 556

Query: 563 K 563
           K
Sbjct: 557 K 557

>Sklu_2365.9 YDR160W, Contig c2365 13522-15939
          Length = 805

 Score = 93.6 bits (231), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 118/268 (44%), Gaps = 39/268 (14%)

Query: 101 LSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGEL 160
           + + +K RHL MISLG  I  GL + +G+  + AGP G  +GY   ++ I   + +  E+
Sbjct: 229 IQRKLKVRHLQMISLGATIGVGLFLNSGKAFSIAGPLGTFLGYLFGALTILATLLSFAEI 288

Query: 161 GICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDVNP-- 218
            +    L+   +   S  I  + GF++   +   +    P +L+  AI +S++T++    
Sbjct: 289 -VALIPLITGISGLCSRFIGDAFGFSVGWCHWASYAFGFPSELIATAIMLSYYTNLQSIS 347

Query: 219 ------DXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGK 272
                               NL   R Y E E+F +  K++++   IIL IV+  GG   
Sbjct: 348 TNQGSMASAIVIMIAALTVLNLMDVRVYGELEYFASTIKLIVVALLIILMIVVNCGGL-N 406

Query: 273 DGYIGAKYW---------IHPGPFA----------------HGFKGV---CTVFTY-AAF 303
           +GYIG +YW         I  G F                  GF GV   C   T  A F
Sbjct: 407 NGYIGFRYWDKNKSKSEHITFGAFRPTFDLKDTGDGARNGIGGFGGVLLSCIASTLVAVF 466

Query: 304 SYGGIEVVVLSIDEQEDPVSAVPNACKK 331
           SY G E+  ++  E ++P  AVP+  K+
Sbjct: 467 SYVGSEIGFIAAGEAQNPRKAVPSVTKR 494

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 83/211 (39%), Gaps = 6/211 (2%)

Query: 372 VIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGR 431
           VIA++S     +   +N V +                           P    + + +G 
Sbjct: 572 VIALKSFKQCTLSSIVNGVFVAIGFSAASSQLYASSRTLYSMATQQKAPSVFTWCNRHGV 631

Query: 432 PIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQG 491
           P    I     G +  +  + K  DVF   + I  +  + +W SM+LS +R   A+K   
Sbjct: 632 PYMSVIFCAFLGFLSLLCLNMKSTDVFIMFINIGAMGSVIMWFSMNLSFLRFYYALK--- 688

Query: 492 KSLDEIGYKAQTGYWGSWLAVFIGFFSLV-TQFWVAIAPVEKHGELDVVNFFQNYLAFPI 550
           +  D I   ++   + S L  ++  F +V T   V     +     +  NF  +Y    +
Sbjct: 689 RRPDIISRDSKEYPYKSPLQPYLSIFGMVSTAILVLFNGFQNFFYWNTKNFISSYCTVVL 748

Query: 551 VLVAYLGHKIYYKNWRLWIPADKIDLDSHRR 581
            +V Y G+  ++K+ ++    + IDLDS RR
Sbjct: 749 FVVLYFGYN-WFKHSQI-NKLENIDLDSGRR 777

>CAGL0C00539g 57784..59502 highly similar to sp|P38090 Saccharomyces
           cerevisiae YBR132c AGP2 amino-acid permease,
           hypothetical start
          Length = 572

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 93/459 (20%), Positives = 175/459 (38%), Gaps = 33/459 (7%)

Query: 84  KRKDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGY 143
           +R  +D  + +  + T   + + +RH+  I++   I T L V  G+ L + GPA L++ +
Sbjct: 41  ERSSNDSRTQL-IESTSTHRKLLNRHVQFIAISGVIGTALFVAIGKPLYRGGPANLLLAF 99

Query: 144 TVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQL 203
            +  I I CI  +  E+ + +  +   F R     +D SLG   S  +       +P ++
Sbjct: 100 ALWCIPILCITVSTAEM-VSFMPVSSPFLRLAKKCVDESLGVTASWNFWFLECVQIPYEI 158

Query: 204 VTAAITISFWT-DVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILS 262
           V+    I +W  D +P              ++   + Y E EF+    KI++  G    +
Sbjct: 159 VSVNTIIHYWRDDYSPAIPLVIQVVLYVLISVCAVKYYGEMEFWLASFKIILAVGLFCFT 218

Query: 263 IVIITGGAGKDGYIGAKYWIHPGPF--------------AHGFKGVCTVFTYAAFSYGGI 308
            + + GG  K    G +Y+    PF              A  F+G  T    AAF+  G 
Sbjct: 219 FITMLGGNPKHDRYGFRYY-GESPFKKYFPDGNEGAGKSAGYFQGFLTCLIQAAFTIAGG 277

Query: 309 EVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXXXCFLV-----PYDXXXXXXXXX 363
           E + +   E + P   +P A K+                C  V     P D         
Sbjct: 278 EYISMLAGEVKLPRKVLPKAFKQ----VFVRLTVIFLGSCLCVGIVCSPNDSALTAAINE 333

Query: 364 XX--XXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQ 421
                    +VIA+ +  ++V+P  +N  ++                           P+
Sbjct: 334 ARPGAGSSPYVIAMNNLQIRVLPDIVNIALITAAFSAGNAYTYCSSRTLYGMALDGYAPK 393

Query: 422 WLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHI 481
                +  G PI    +S+ + ++  +  +     V  WL+ +   SQL  ++ + + ++
Sbjct: 394 IFTKCNKYGVPIYAVGVSLCWALLSLLQLNSNSAVVLNWLINLITASQLINFVFLCVIYL 453

Query: 482 RLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLV 520
             R A  +Q + L E+ +K+    W     V +G  S++
Sbjct: 454 FFRRAYMTQKERLPELPFKS----WWQPYTVIVGLVSVL 488

>Kwal_27.11900
          Length = 726

 Score = 87.8 bits (216), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 68/272 (25%), Positives = 118/272 (43%), Gaps = 39/272 (14%)

Query: 97  QDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHA 156
           Q + + + ++ RHL MISLG  I  GL + +G+  + AGP G +IG+T+   +I   + +
Sbjct: 228 QQSTIQRKLRVRHLQMISLGATIGVGLFLNSGKAFSIAGPMGALIGFTIGGTLILATLFS 287

Query: 157 AGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDV 216
             E+ +    L+   +   S  +  + GF++   + L +    P +++ + I +S++ ++
Sbjct: 288 FAEM-VALIPLITGISGLCSRFVGDAFGFSVGWCHWLSYAVGFPSEVIASTIMLSYYKNL 346

Query: 217 NPDXXXXXXXXXX--------XXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITG 268
                                   NL   R Y E E+  +  K+ ++   IIL IV+  G
Sbjct: 347 EQIATNRYYTALTITGIVVGLTLINLMDVRIYGELEYCSSVFKLAIVVFLIILMIVMNVG 406

Query: 269 GAGKDGYIGAKYW-IHPGPFAH------------------------GFKGV---CTVFTY 300
           G   D YIG +YW  H  P                           GF GV   C   T 
Sbjct: 407 GLHND-YIGFRYWNRHKSPLEETTFGLFRPTFDMEDGGHGSRGGVPGFGGVLLSCIASTL 465

Query: 301 -AAFSYGGIEVVVLSIDEQEDPVSAVPNACKK 331
            + F+Y G E+  ++  E ++P  AVP+  K+
Sbjct: 466 VSVFAYVGSEIGFIAAGEAKNPRKAVPSVTKR 497

>KLLA0B09922g complement(867748..870141) weakly similar to sp|Q03770
           Saccharomyces cerevisiae YDR160w SSY1 transcriptional
           regulator of several transporter genes P23.1.f18.1,
           hypothetical start
          Length = 797

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/272 (27%), Positives = 122/272 (44%), Gaps = 39/272 (14%)

Query: 97  QDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHA 156
            +T L + +K RHL MISLG  I  GL + +G+  + AGP G  IG+   +++I   + +
Sbjct: 218 HNTSLQRKLKIRHLQMISLGATIGVGLFLNSGRAFSIAGPMGAFIGFLYGALVILATLFS 277

Query: 157 AGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWT-- 214
             E+ + +  L+   +   S  +  S GF +   + L +    P +L+ +AI IS++T  
Sbjct: 278 FAEM-VAFIPLITGISGLCSRFVGDSFGFTVGWCHWLSYAVAFPSELIASAIMISYYTPF 336

Query: 215 -DVNPDX-----XXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITG 268
             V  D                  NL   R YAE E+  +  K+ ++   ++L +++  G
Sbjct: 337 EKVATDNLYLGLTVTILIIVLTGINLLDVRIYAELEYIMSVFKLAVVLFLLVLVLILNCG 396

Query: 269 GAGKDGYIGAKYWIHP---------GPFAH----------------GFKGVC----TVFT 299
           G  ++GY+G K+W            GPF                  GF GV     T   
Sbjct: 397 GF-RNGYLGFKFWTKDRSPSPDVTFGPFRPTFDLNDYGSGSKQGIGGFGGVLLSCITCSV 455

Query: 300 YAAFSYGGIEVVVLSIDEQEDPVSAVPNACKK 331
            + FSY G E+  ++  E E+P  AVP+  K+
Sbjct: 456 SSIFSYIGSEIGFIAAPEAENPRKAVPSVTKR 487

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 72/154 (46%), Gaps = 20/154 (12%)

Query: 438 ISILF-GMIGFVAA---SDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKS 493
           +SILF G +GF++      +  +     ++I     + +W  M+LS +R   A+K +   
Sbjct: 626 VSILFCGSLGFLSLLCFDLRSTEALLLFISIGITGSVVMWFGMNLSFLRFYMALKRRPDI 685

Query: 494 LD----EIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFP 549
           +D    E  YK+    +  +L +F G  S  T F + +  ++        NF  +YL   
Sbjct: 686 IDRNSKEYPYKSP---FQPYLCIF-GMAS--TTFLLLMNGIQNFFVWKTANFISSYLIIV 739

Query: 550 IVLVAYLGHKIYYKNW--RLWIPADKIDLDSHRR 581
           I +V Y G+ +   +   RL    ++IDLDS RR
Sbjct: 740 IFIVLYSGYNVVRTSTINRL----EQIDLDSGRR 769

>Scas_619.2*
          Length = 471

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 98/422 (23%), Positives = 160/422 (37%), Gaps = 37/422 (8%)

Query: 179 IDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWT---DVNPDXXXXXXXXXXXXXNLF 235
           +D SLGFA S  Y   ++ ++  +   AA  + +W     V                N+ 
Sbjct: 30  VDRSLGFASSWNYYYCFVILVATECTAAAGVVEYWAWALKVPKGAWITIFLFCVVALNML 89

Query: 236 GARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAH------ 289
               Y E+EF+    KIL I G IILS ++  GG      +G +YW  PG FA       
Sbjct: 90  PVNFYGESEFWFASIKILCILGLIILSFILFWGGGPSHDRLGFRYWQRPGAFADHITDGT 149

Query: 290 --GFKGVCTVFTYAAFSYG-GIEVVVLSIDEQEDPVSAVPNACKKXXXXXXXXXXXXXXX 346
              F  V T      F++  G E+V L+  E  D    +  A ++               
Sbjct: 150 GGNFLDVYTGVIKGGFAFVLGPELVSLTSSECHDQRRNIAKASRRFVWRLMIFYVLGSLS 209

Query: 347 XCFLVPYDXXXXXXXXXXX---XXXXXFVIAIESHGVKVVPHFINAVILIXXXXXXXXXX 403
              +V Y+                   FVI I++ G+KV+PH IN  I+           
Sbjct: 210 ISVIVAYNDPNLQNALAQSKPGAGSSPFVIGIQNAGIKVLPHIINVCIMTSAWSAGNAYM 269

Query: 404 XXXXXXXXXXXXXXXXPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLA 463
                           P++ + I+     IR   + +L  +   +         F  +  
Sbjct: 270 FASSRSLLTMASHGHAPKFFSKINRLRCSIRGSWLFLLILLFSLLKRLLIDSKRFQLVFK 329

Query: 464 ISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFI--------G 515
            S +S    W+   +++IR R A+       D + YK     +  W ++F+        G
Sbjct: 330 HSTISGFIGWICACVAYIRFRKAIIFN-DLYDRLPYKGFAQKYLIWYSLFMVSLITLTNG 388

Query: 516 FFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLW-IPADKI 574
           +   + +FW            D  +F   Y+  P+ +V ++GHK+  ++WR W IP DKI
Sbjct: 389 YQIFIPRFW------------DYKDFIAAYITLPVFIVLWIGHKLVTRSWRQWYIPVDKI 436

Query: 575 DL 576
           D+
Sbjct: 437 DV 438

>AGL171W [4141] [Homologous to ScYDR160W (SSY1) - SH]
           complement(377256..379811) [2556 bp, 851 aa]
          Length = 851

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/328 (22%), Positives = 133/328 (40%), Gaps = 51/328 (15%)

Query: 44  ESTKKREI-EVSEKPIASADTTVSTSK-C--NAKTYF--QDFCHSFKRKDSDLDSDVEAQ 97
           ES+ K  I E   K +        TS+ C  NA  Y      C S ++ D          
Sbjct: 226 ESSNKSNIYESHRKELLPNGIHHPTSRGCLRNALIYLINNPLCESLRKPDR--------- 276

Query: 98  DTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAA 157
              + + +K RHL MI++G  I  GL + +G   A AGP G ++G+++   +    + + 
Sbjct: 277 -YHIQRKLKVRHLQMIAIGASIGVGLFLTSGNAFAVAGPFGTLLGFSICGTVCLATMLSF 335

Query: 158 GELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFW---- 213
            EL      +   F+   S  ++ + GFA+   Y L +    P Q++ +   +S++    
Sbjct: 336 TELSTLI-PISSGFSGLASRFVEDAFGFALGWSYWLSFTVTFPSQIIASVFMLSYYEKVV 394

Query: 214 -TDVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILM-ITGFIILSIVIITGGAG 271
            T ++               NL   R +AE  +     K+L+ I   I++  + + G  G
Sbjct: 395 ATRISTAGLVTVFWLYATAANLLDVRLFAEVNYISAFVKVLITILAMILMLFLNVRGVDG 454

Query: 272 KDGYIGAKYW--------IHPGPF-------------------AHG-FKGVCTVFTYAAF 303
           K G IG ++W        +  G F                   A G F  +  V   + +
Sbjct: 455 KSGAIGFRFWNSSSSETELTYGLFRPTFDLHDTGQGSLNGIGGARGRFLAIILVVLISTY 514

Query: 304 SYGGIEVVVLSIDEQEDPVSAVPNACKK 331
           S+ G+E+  ++  E  +P   +P+A K+
Sbjct: 515 SFNGVEMAFVASGEAINPRKTLPSATKR 542

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 45/222 (20%), Positives = 90/222 (40%), Gaps = 26/222 (11%)

Query: 372 VIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGR 431
           ++A++S G+  +    N V++                           P+        G 
Sbjct: 615 ILALQSFGLCSLASAFNGVLVFFGISAASSSLFASSRTLYSMATQQKAPKLFQTCTSYGV 674

Query: 432 PIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQG 491
           P    + S  FG+I +++ ++     F  L +I+  +   IW+ +++S +R   A+K + 
Sbjct: 675 PWIAILFSGSFGIIAYISVAESSMANFQTLSSIASGTNAIIWLGLNVSFLRFYYALKRRP 734

Query: 492 K--SLDEIGYKAQT---------GYWGSWLAV-FIGFFSLVTQFWVAIAPVEKHGELDVV 539
              S D+  Y  ++         G  GS L V F+GF + +  FW   + +  +G L  +
Sbjct: 735 DIISRDDPTYPYRSPMQPFLSFYGLIGSGLVVIFMGFTNFLHGFWSTRSFLSSYGGL--I 792

Query: 540 NFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRR 581
            F  +Y A+ +    +   KI           +++D+D+ RR
Sbjct: 793 FFITSYFAYKL----FGASKIQ--------SLEQLDMDTGRR 822

>KLLA0D16830g 1426856..1429354 similar to sp|Q03770 Saccharomyces
           cerevisiae YDR160w SSY1 transcriptional regulator of
           several transporter genes, start by similarity
          Length = 832

 Score = 75.5 bits (184), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 71/308 (23%), Positives = 128/308 (41%), Gaps = 47/308 (15%)

Query: 62  DTTVSTSKCNAKTYFQDFCHSFKRKDSDLDSDVEA---QDTQLSKTIKSRHLLMISLGTG 118
           ++ +S SKC+         +S  RK S       A       + + +++RH+ MI+ G+ 
Sbjct: 222 ESWISVSKCSNN-------NSGSRKQSKFIKKYNALKGSHHSVQRKLEARHIQMIASGSS 274

Query: 119 IATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSIL 178
           +  GL + +G+    AGP G ++GY +   ++     +  EL      L   F+   S  
Sbjct: 275 LGVGLFLTSGKAFTIAGPFGALLGYVLCGSIVMASTLSFTEL-CALIPLTSGFSGLASRF 333

Query: 179 IDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDVNPDXXXXXXXXX-----XXXXN 233
           ++ + GFA+  LY   ++  +P Q+V + + ++++  +N                    N
Sbjct: 334 VEDAFGFALGWLYWFSFIIAVPSQVVASTMLLNYYQSLNLSSGKIAGFVTLFLVFAIFIN 393

Query: 234 LFGARGYAETEFFCNCCKILMITGFIILSIVIITGGA--GKDGYIGAKYW----IHPGPF 287
           L   R +    +F    KI+     I + IV+ +GGA  G D  +G ++W      PG F
Sbjct: 394 LCDVRIFGNFVYFVTIIKIIFTIVMIFVMIVLNSGGAALGHD-RVGFRFWDAGKSAPGLF 452

Query: 288 AHGFK------------------------GVCTVFTYAAFSYGGIEVVVLSIDEQEDPVS 323
              F+                         +      AAF+Y GIE+  ++  E  +P  
Sbjct: 453 YGLFRPTFNLKDEGSEIISGISGAKGRLLAIFLSMLIAAFTYSGIEMTFVASCEVRNPKK 512

Query: 324 AVPNACKK 331
           A+P+A KK
Sbjct: 513 ALPSAMKK 520

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 76/161 (47%), Gaps = 22/161 (13%)

Query: 430 GRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKS 489
           G P    ++S +FG+I ++A      + F  L  IS  +   IW  M++S +R   A+K 
Sbjct: 654 GVPWIAVLVSGIFGVISYMAVDQSSLNNFQILANISSATICIIWAGMNVSFLRFFYALKI 713

Query: 490 QGK--SLDEIGYKAQT------GYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNF 541
           +    S D+  +  ++       Y+G + ++ + FF+  T F+        HG  ++  F
Sbjct: 714 RPDIMSRDDPMFPYRSPFQPYLSYYGLFGSLVMIFFAGFTSFF--------HGFWNIKIF 765

Query: 542 FQNYLAFPIVLVAYLGHKIY--YKNWRLWIPADKIDLDSHR 580
           F  Y      +V Y+G+K++   K  RL    D+ID+D  R
Sbjct: 766 FSCYGGLVFFIVLYIGYKLFGTSKLQRL----DQIDMDIGR 802

>CAGL0E01089g complement(96582..99143) similar to sp|Q03770
           Saccharomyces cerevisiae YDR160w SSY1 transcriptional
           regulator of several transporter genes, start by
           similarity
          Length = 853

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 59/276 (21%), Positives = 115/276 (41%), Gaps = 39/276 (14%)

Query: 93  DVEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYC 152
           D   +  QL + +K RH+ M+++   ++ G+ + +G+  + AGP G ++G+ ++  ++  
Sbjct: 267 DSTRRRNQLQRNLKVRHIQMLAISACLSAGIFMTSGKAFSIAGPFGCLLGFIITGTVVIA 326

Query: 153 IIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISF 212
            + +  EL        G F+   S  ++ + GFA+   Y    +  LP Q+V++    S 
Sbjct: 327 TMMSFAELATLIPVSSG-FSGLASRFVEDAFGFALGWTYWFSSMVALPAQVVSSTFYFSH 385

Query: 213 W-----TDVNPDXXXXXXXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIIT 267
           +     T                  NLF  R   E  +     K+L IT  I++ ++++ 
Sbjct: 386 YDHLKLTRGGTAGFVTLFSLFPLVLNLFDVRFLGEFVYIVGLSKVL-ITIMIVIVMLVLN 444

Query: 268 GGAGKD--GYIGAKYW----------IHPGPFAHGFK--------------------GVC 295
            G G D  G +  +YW          I  G F   F                      V 
Sbjct: 445 AGHGFDVHGRVSFRYWDAEKSRNLKDITYGLFRPTFDLSDAGLGSINGIGGNRGRFIAVV 504

Query: 296 TVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKK 331
           +V   + F++ G+E+  ++  E ++P   +P+A K+
Sbjct: 505 SVMLVSTFAFSGVEMTFVASGEAKNPRKTIPSAMKR 540

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 89/224 (39%), Gaps = 30/224 (13%)

Query: 372 VIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGR 431
           V+A+E+ G        NAV++                           P      D  G 
Sbjct: 617 VLALENFGFCSFAAGFNAVLIFFTSSATASSLYASSRTLYAMSIQRKAPAVFRLCDRRGV 676

Query: 432 PIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQG 491
           P      S LF ++ ++A  D     F  L+ IS  +   IW+ ++++ +R   A+K + 
Sbjct: 677 PYVAIGFSSLFAIVAYLAVDDAAISNFDVLMNISSAATSIIWLGLNVAFLRFYYALKKRR 736

Query: 492 K--SLDEIGYKAQT---------GYWG-SWLAVFIGFFSLVTQFWVAIAPVEKHGELDVV 539
              S D++ Y  ++         G  G S   +F+GF + +  +W            +  
Sbjct: 737 DIISRDDVFYPYRSPFQPYLSMFGLLGCSIFVLFMGFINFIHGYW------------NTK 784

Query: 540 NFFQNYLAFPIVLVAYLGHKI--YYKNWRLWIPADKIDLDSHRR 581
           +FF +Y    +  V YLG+K+    K  RL    D++DLD+ RR
Sbjct: 785 SFFSSYGGLILFGVCYLGYKLISTSKIQRL----DQLDLDTGRR 824

>YDR160W (SSY1) [1002] chr4 (776157..778715) Component of an
           extracellular amino acid sensor comprised of Ptr3p,
           Ssy1p, and Ssy5p, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [2559 bp, 852 aa]
          Length = 852

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 55/268 (20%), Positives = 112/268 (41%), Gaps = 39/268 (14%)

Query: 100 QLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGE 159
            + + +K RH+ M+S+G   + GL + +G+  + AGP G ++G+ ++  +I   + +  E
Sbjct: 276 HIQRKLKVRHIQMLSIGACFSVGLFLTSGKAFSIAGPFGTLLGFGLTGSIILATMLSFTE 335

Query: 160 LGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDVNPD 219
           L      +   F+   S  ++ + GFA+   Y +  +  LP Q+ ++   +S++ +VN  
Sbjct: 336 LSTLI-PVSSGFSGLASRFVEDAFGFALGWTYWISCMLALPAQVSSSTFYLSYYNNVNIS 394

Query: 220 XXXXX-----XXXXXXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDG 274
                             NL       E  +     K++ I   ++ +++I+  G G D 
Sbjct: 395 KGVTAGFITLFSAFSIVVNLLDVSIMGEIVYVAGISKVI-IAILMVFTMIILNAGHGNDI 453

Query: 275 Y--IGAKYW-------------IHP----------------GPFAHGFKGVCTVFTYAAF 303
           +  +G +YW               P                GP    F    +V   + F
Sbjct: 454 HEGVGFRYWDSSKSVRNLTYGLYRPTFDLADAGEGSKKGISGPKGR-FLATASVMLISTF 512

Query: 304 SYGGIEVVVLSIDEQEDPVSAVPNACKK 331
           ++ G+E+  L+  E  +P   +P+A K+
Sbjct: 513 AFSGVEMTFLASGEAINPRKTIPSATKR 540

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 89/222 (40%), Gaps = 26/222 (11%)

Query: 372 VIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGR 431
           V+A+++ G+       NA+++                           P         G 
Sbjct: 616 VVALQNFGLCTFASAFNAILIFFTATAGISSLFSCSRTLYAMSVQRKAPPVFEICSKRGV 675

Query: 432 PIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQG 491
           P    I S LF +I ++A      + F  L  +S  S   IWM ++LS +R   A+K + 
Sbjct: 676 PYVSVIFSSLFSVIAYIAVDQTAIENFDVLANVSSASTSIIWMGLNLSFLRFYYALKQRK 735

Query: 492 K--SLDEIGYKAQTGY------WG----SWLAVFIGFFSLVTQFWVAIAPVEKHGELDVV 539
              S ++  Y  ++ +      +G    S   +F+G+ + +  FW   A    +G L  +
Sbjct: 736 DIISRNDSSYPYKSPFQPYLAIYGLVGCSLFVIFMGYPNFIHHFWSTKAFFSAYGGL--M 793

Query: 540 NFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRR 581
            FF +Y A+ ++  +        K  RL    D++D+DS RR
Sbjct: 794 FFFISYTAYKVLGTS--------KIQRL----DQLDMDSGRR 823

>Scas_682.30
          Length = 845

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 75/368 (20%), Positives = 149/368 (40%), Gaps = 55/368 (14%)

Query: 5   RTPFCRKAHSLTLRLFGKGCAELDMSSIQGEPSMVSIEIESTKKREIEVSEKPIASADTT 64
           R+PF R+  +       +   EL+ SS     SM  I I++     IE+ E+   S+ + 
Sbjct: 179 RSPFRRRHDN------KQKIKELENSS--RASSMTEI-IDNASYGNIEIDEEREISSKSH 229

Query: 65  VSTSKCNAKTYFQDFCHSFKRKDSDLDSDVEAQ-----DTQ--LSKTIKSRHLLMISLGT 117
           +      + T F D     +R+ S L  D+E       +T+  + + ++ RH+ M+S+GT
Sbjct: 230 IIEESPGSMTSFTDR----ERRKSILPFDLEKMFNDPGNTKYYVQRKLRVRHIQMLSIGT 285

Query: 118 GIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSI 177
             + G  + +G+  + AGP G ++G+ ++  ++   + +  EL      +   F+   S 
Sbjct: 286 CFSVGFFLTSGRAFSIAGPFGTLLGFALAGSIVLATLLSFTELSTLI-PVSSGFSGLASR 344

Query: 178 LIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDVNPDXXX-----XXXXXXXXXX 232
            ++ + GF +   Y    +   P ++ ++   +S++  +N                    
Sbjct: 345 FVEDAFGFGLGWTYWFSCMIAFPSEVASSTFYLSYYQHLNLTRGAIAGFVTLFSSYSIII 404

Query: 233 NLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGK-DGYIGAKYW---------- 281
           NL   R   E  +     KIL+    I + ++I  G   K    +G ++W          
Sbjct: 405 NLLDVRILGEATYIIGLSKILITIVIIFVMVIINAGHGYKIHNQVGFRFWDSSKSVGDLT 464

Query: 282 ---IHPG--------------PFAHG-FKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVS 323
                P               P A G F  V  V   + F++ G+E+  ++  E  +P  
Sbjct: 465 YGLFRPTFDLGDVGRGSTNGIPGATGRFLAVILVMLISTFAFSGVEMTFMASGEAINPRK 524

Query: 324 AVPNACKK 331
            +P++ K+
Sbjct: 525 TIPSSIKR 532

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 82/215 (38%), Gaps = 12/215 (5%)

Query: 372 VIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGR 431
           V+A++S G+      +N +++                           P      +  G 
Sbjct: 609 VLALQSFGLCTFASALNGILIFFTSTAGVSSLYNSSRTIYAMSVQRKAPLIFQRCNKRGV 668

Query: 432 PIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQG 491
           P    I S +F +I ++A +      F  L+ IS  S   IW  +++S IR   A+K + 
Sbjct: 669 PYVAVIFSGVFYIIAYLAVNVGSSRNFDVLVNISSASTSIIWSGLNISFIRFYFALKQRK 728

Query: 492 KSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAI---APVEKHGELDVVNFFQNYLAF 548
              D I    +T  + S    ++ F+ L       I    P    G+    +FF  Y   
Sbjct: 729 ---DLISRNDKTYPYKSPFQPYLSFYGLFGCLIFVIFMGFPNFIKGQWSTRSFFSAYGGL 785

Query: 549 PIVLVAYLGHKI--YYKNWRLWIPADKIDLDSHRR 581
            +  + Y G KI    K  RL    D+ID+D+ RR
Sbjct: 786 FLFAILYAGFKIIGTSKIQRL----DQIDMDTGRR 816

>Kwal_53.19461
          Length = 565

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/258 (22%), Positives = 109/258 (42%), Gaps = 43/258 (16%)

Query: 112 MISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICY---RGLV 168
           MI+ G  +  GL + +G+ L+  GP G ++G+++   ++   + +  E+        G+ 
Sbjct: 1   MIATGAAMGVGLFLNSGKALSIGGPFGFLLGFSICGSIVLATMLSFTEIATLIPLSSGIS 60

Query: 169 GNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDVNPDXXXXXXXXX 228
           G  +R+    ++ + GFA+   Y L +   L  Q+V +   +S++  +            
Sbjct: 61  GLASRF----VEDAFGFALGWSYWLTYAITLANQIVASNFMLSYYGTMPARTGSTVGFVT 116

Query: 229 -----XXXXNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGY--IGAKYW 281
                    NL      AE  +     KI+ IT  +I ++VI+  GAG+  +  +G ++W
Sbjct: 117 FFLVFAIAGNLLDVNILAELAYGFTFFKIV-ITATMIFAMVILNAGAGRHKHPRVGFRFW 175

Query: 282 -------------IHPG--------------PFAHG-FKGVCTVFTYAAFSYGGIEVVVL 313
                          P               P A G F  V  V   ++FS+ G+EV  +
Sbjct: 176 DASKSPENLTYGLFRPTFDLQDVGDGAKNGIPGAKGRFLSVLVVIIVSSFSFSGVEVGFV 235

Query: 314 SIDEQEDPVSAVPNACKK 331
           +  E  +P  ++P+A K+
Sbjct: 236 ACGEAANPRRSLPSATKR 253

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 89/224 (39%), Gaps = 30/224 (13%)

Query: 372 VIAIESHGVKVVPHFINAVILIXXXXXXXXXXXXXXXXXXXXXXXXXXPQWLNFIDMNGR 431
           V+A+ES G+       NA+++I                          P         G 
Sbjct: 329 VLALESFGLCTFSSVFNAMLVIFGVTSELSSLYASSRTLYSMSIQGKAPPIFKICSRKGV 388

Query: 432 PIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQ- 490
           P    I S LFG + ++  + K  ++F  L  ISG +   IW   +LS +R   A+K + 
Sbjct: 389 PYVAVIFSGLFGALAYLTVNAKALEIFQALANISGATISIIWFGFNLSFLRFYYALKRRP 448

Query: 491 ---GKSLDEIGYK-------AQTGYWGSWL-AVFIGFFSLVTQFWVAIAPVEKHGELDVV 539
               +      Y+       A  G +GS+L  V +GF + +  FW            +  
Sbjct: 449 DIISREDPSFPYRSPLQPFLACYGLFGSFLIVVLMGFSNFLDGFW------------NTK 496

Query: 540 NFFQNYLAFPIVLVAYLGHKIY--YKNWRLWIPADKIDLDSHRR 581
            FF +Y    + ++ Y G+++    K  RL    D++DLDS RR
Sbjct: 497 MFFSSYGGLIVFILCYAGYRLLGTSKIQRL----DQLDLDSGRR 536

>Scas_233.1
          Length = 141

 Score = 33.5 bits (75), Expect = 0.19,   Method: Composition-based stats.
 Identities = 31/103 (30%), Positives = 48/103 (46%), Gaps = 18/103 (17%)

Query: 32  IQGEPSMVSIEIESTKKREIEVSEKPIASADTTVSTSKCNAKTYFQDFCHSFKR-KDSDL 90
           I G   +    I+S+    I     P  ++ T  ST++      +Q F  SFK+ +D +L
Sbjct: 48  IVGSSDLTQENIQSSITHTIS---NPSFTSTTQPSTTR------WQKFKDSFKKAEDVEL 98

Query: 91  DSDVE-----AQDTQ---LSKTIKSRHLLMISLGTGIATGLLV 125
           D ++      AQ T    L  T+K R   MI++G  I +GL V
Sbjct: 99  DPNLTEAERIAQATAKAPLQHTLKGRQQTMIAIGGAIGSGLFV 141

>Sklu_2346.4 YOL065C, Contig c2346 7444-8354 reverse complement
          Length = 304

 Score = 33.5 bits (75), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 9/76 (11%)

Query: 94  VEAQDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCI 153
           VEA+  +LSK + +R L  +S G G     LVG+  V    G  GL++ Y  S I    +
Sbjct: 62  VEARLLELSKAVLTR-LEAVSHGRGYQ---LVGSNSV----GAVGLLV-YAASDIAASNV 112

Query: 154 IHAAGELGICYRGLVG 169
           + A  +LG+ Y GL G
Sbjct: 113 LKAGVKLGMFYSGLKG 128

>Kwal_47.17837
          Length = 454

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 239 GYAETEFFCNCCKILMITGFIILSIVIITGG 269
           G+   E F +CCK L+ TGF++ S  +I  G
Sbjct: 116 GFGAIEEFESCCKALITTGFVVKSASVIRTG 146

>CAGL0M08272g complement(823019..824884) highly similar to sp|P36029
           Saccharomyces cerevisiae YKL174c, start by similarity
          Length = 621

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 44/87 (50%), Gaps = 8/87 (9%)

Query: 81  HSFKRKDSDLDSDVEAQ----DTQLSKTIKSRHLLMISLGTGIAT---GLLVGNGQVLAK 133
           H + ++D   D   E +      +L K++ SR+ + I LG G+ +   G+    G  +  
Sbjct: 33  HHYVQEDEVTDEPEEVEHFNYKQELDKSLLSRNSV-IGLGFGLMSPVLGMCTSMGIGMLN 91

Query: 134 AGPAGLIIGYTVSSIMIYCIIHAAGEL 160
            GP  +++G+ +S I+I+    + GE+
Sbjct: 92  GGPLSIMLGFFISGILIWFSSLSLGEI 118

>Scas_689.19
          Length = 612

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 49/96 (51%), Gaps = 16/96 (16%)

Query: 76  FQDFCHSFKRKDSDLDSDVEA-----QDTQLSKTIKSRHLL------MISLGTGIATGLL 124
           F D  H+   ++SD D +VE+      + +L K++ SR  +      ++S   G++T + 
Sbjct: 23  FFDNIHTIIHEESDTD-EVESVEHFKYNQELDKSLLSRSSVVGLGFGLMSPVLGMSTSMA 81

Query: 125 VGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGEL 160
           +G    L   GPA ++ G+ +S I I+    + GE+
Sbjct: 82  IG----LINGGPATILWGFIISGICIWFCSLSLGEV 113

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.141    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,921,614
Number of extensions: 596171
Number of successful extensions: 2572
Number of sequences better than 10.0: 116
Number of HSP's gapped: 2095
Number of HSP's successfully gapped: 144
Length of query: 614
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 506
Effective length of database: 12,857,365
Effective search space: 6505826690
Effective search space used: 6505826690
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 65 (29.6 bits)