Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_717.7162562531500.0
YMR106C (YKU80)62963715740.0
Kwal_26.762460263212401e-164
Sklu_2430.362659111441e-149
CAGL0K03443g61564910451e-134
ABL030W6026359541e-121
KLLA0B12672g6096027822e-95
YJR031C (GEA1)1408137740.76
YMR284W (YKU70)602213740.79
Scas_667.1617353691.3
Scas_704.12753129711.7
Kwal_23.47731030123692.8
CAGL0L08954g45462649.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_717.71
         (625 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_717.71                                                          1217   0.0  
YMR106C (YKU80) [4063] chr13 complement(478300..480189) Componen...   610   0.0  
Kwal_26.7624                                                          482   e-164
Sklu_2430.3 YMR106C, Contig c2430 3786-5666                           445   e-149
CAGL0K03443g complement(316368..318215) similar to sp|Q04437 Sac...   407   e-134
ABL030W [562] [Homologous to ScYMR106C (YKU80) - SH] complement(...   372   e-121
KLLA0B12672g 1105330..1107159 weakly similar to sp|Q04437 Saccha...   305   2e-95
YJR031C (GEA1) [2927] chr10 complement(486500..490726) Component...    33   0.76 
YMR284W (YKU70) [4238] chr13 (838186..839994) Component of DNA e...    33   0.79 
Scas_667.16                                                            31   1.3  
Scas_704.12                                                            32   1.7  
Kwal_23.4773                                                           31   2.8  
CAGL0L08954g 977518..978882 similar to tr|Q12059 Saccharomyces c...    29   9.9  

>Scas_717.71
          Length = 625

 Score = 1217 bits (3150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 597/625 (95%), Positives = 597/625 (95%)

Query: 1   MSAESTTFIVDVSKNMINNDNVSKAMAYIEFTLLEKCKKKRKTDWTSLYAANSIETSNSQ 60
           MSAESTTFIVDVSKNMINNDNVSKAMAYIEFTLLEKCKKKRKTDWTSLYAANSIETSNSQ
Sbjct: 1   MSAESTTFIVDVSKNMINNDNVSKAMAYIEFTLLEKCKKKRKTDWTSLYAANSIETSNSQ 60

Query: 61  EVPNVSQLSPFIAPVTSDDVAATMRRLQKQCEVKNEADDMESSMVQCLLVASLDIREQFG 120
           EVPNVSQLSPFIAPVTSDDVAATMRRLQKQCEVKNEADDMESSMVQCLLVASLDIREQFG
Sbjct: 61  EVPNVSQLSPFIAPVTSDDVAATMRRLQKQCEVKNEADDMESSMVQCLLVASLDIREQFG 120

Query: 121 AKKMLRQIMVFTDDLNGLNFNDEEIDVLVGEIDSRIILVDCQXXXXXXXXXXXXNVDKAW 180
           AKKMLRQIMVFTDDLNGLNFNDEEIDVLVGEIDSRIILVDCQ            NVDKAW
Sbjct: 121 AKKMLRQIMVFTDDLNGLNFNDEEIDVLVGEIDSRIILVDCQEDSEDGEEEGKKNVDKAW 180

Query: 181 LKLIKKLPGSMILPMDDLLLEITSPKPAVVKPVRVFNGELRLGANIDSNAESNADDMNCL 240
           LKLIKKLPGSMILPMDDLLLEITSPKPAVVKPVRVFNGELRLGANIDSNAESNADDMNCL
Sbjct: 181 LKLIKKLPGSMILPMDDLLLEITSPKPAVVKPVRVFNGELRLGANIDSNAESNADDMNCL 240

Query: 241 SMKVEGYPATKSLQSLNRRNTIKTVTGENHSTKYIPVKSVIEYEVINPKESSQDADDKND 300
           SMKVEGYPATKSLQSLNRRNTIKTVTGENHSTKYIPVKSVIEYEVINPKESSQDADDKND
Sbjct: 241 SMKVEGYPATKSLQSLNRRNTIKTVTGENHSTKYIPVKSVIEYEVINPKESSQDADDKND 300

Query: 301 ARPVTVSRDSITKAYRYGADYVVLPSTLQSQLVYETFPGLDIRGFMDMELLPRYYLNSES 360
           ARPVTVSRDSITKAYRYGADYVVLPSTLQSQLVYETFPGLDIRGFMDMELLPRYYLNSES
Sbjct: 301 ARPVTVSRDSITKAYRYGADYVVLPSTLQSQLVYETFPGLDIRGFMDMELLPRYYLNSES 360

Query: 361 TFIIADTRLGGLADSVTFGVLVDVLLNNRKVAVARYVPKANSEVQMCVLVPLFVAHHDQS 420
           TFIIADTRLGGLADSVTFGVLVDVLLNNRKVAVARYVPKANSEVQMCVLVPLFVAHHDQS
Sbjct: 361 TFIIADTRLGGLADSVTFGVLVDVLLNNRKVAVARYVPKANSEVQMCVLVPLFVAHHDQS 420

Query: 421 FSGEGEENFVRTLVLNRLPFAEDERVSDFPRLTNRRSTSGRTLPEDKNEIDELDVLMEEF 480
           FSGEGEENFVRTLVLNRLPFAEDERVSDFPRLTNRRSTSGRTLPEDKNEIDELDVLMEEF
Sbjct: 421 FSGEGEENFVRTLVLNRLPFAEDERVSDFPRLTNRRSTSGRTLPEDKNEIDELDVLMEEF 480

Query: 481 VDSMDTDNLLNVPDPEYYKPISQVTQDTTLRLPTKEVKELENEQDPLRIPAIGVHRQQQV 540
           VDSMDTDNLLNVPDPEYYKPISQVTQDTTLRLPTKEVKELENEQDPLRIPAIGVHRQQQV
Sbjct: 481 VDSMDTDNLLNVPDPEYYKPISQVTQDTTLRLPTKEVKELENEQDPLRIPAIGVHRQQQV 540

Query: 541 LLEWIHQKVIMGSDAFDIPDIPDKLREQIAPHVNXXXXXXXXXXXXXXXXVEKSAEHGKS 600
           LLEWIHQKVIMGSDAFDIPDIPDKLREQIAPHVN                VEKSAEHGKS
Sbjct: 541 LLEWIHQKVIMGSDAFDIPDIPDKLREQIAPHVNKKVDLSKLLDLLQIKKVEKSAEHGKS 600

Query: 601 EHIEEGPVEIPSLAALLEKGKREST 625
           EHIEEGPVEIPSLAALLEKGKREST
Sbjct: 601 EHIEEGPVEIPSLAALLEKGKREST 625

>YMR106C (YKU80) [4063] chr13 complement(478300..480189) Component
           of DNA end-joining repair pathway, involved in
           protecting telomeres from homologous recombination, acts
           in a complex with Yku70p [1890 bp, 629 aa]
          Length = 629

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/637 (50%), Positives = 432/637 (67%), Gaps = 30/637 (4%)

Query: 1   MSAESTTFIVDVSKNMINNDNVSKAMAYIEFTLLEKCKKKRKTDWTSLYAANSIETSNSQ 60
           MS+ESTTFIVDVS +M+ N+NVSK+MAY+E+TLL K KK RKTDW S Y AN   + NSQ
Sbjct: 1   MSSESTTFIVDVSPSMMKNNNVSKSMAYLEYTLLNKSKKSRKTDWISCYLANCPVSENSQ 60

Query: 61  EVPNVSQLSPFIAPVTSDDVAATMRRLQKQCEVKNEADDMES--SMVQCLLVASLDIREQ 118
           E+PNV Q+  F+APVT+      ++RL++ C+  +     E   SM+QCLLV SLDI++Q
Sbjct: 61  EIPNVFQIQSFLAPVTTTATIGFIKRLKQYCDQHSHDSSNEGLQSMIQCLLVVSLDIKQQ 120

Query: 119 FGAKKMLRQIMVFTDDLNGLNFNDEEIDVLVGEIDSRIILVDCQXXXXXXXXXXXXNVDK 178
           F A+K+L+QI+VFTD+L+ L+  DEEID+L  E+ +RIIL+DC                 
Sbjct: 121 FQARKILKQIVVFTDNLDDLDITDEEIDLLTEELSTRIILIDCGKDTQEERKKSN----- 175

Query: 179 AWLKLIKKLPGSMILPMDDLLLEITSPKPAVVKPVRVFNGELRLGANIDSNAESN----A 234
            WLKL++ +P S I  M++LL+EITSP  +VVKPVRVF+GELRLGA+I S   SN     
Sbjct: 176 -WLKLVEAIPNSRIYNMNELLVEITSPATSVVKPVRVFSGELRLGADILSTQTSNPSGSM 234

Query: 235 DDMNCLSMKVEGYPATKSLQSLNRRNTIKTVTGENHSTKYIPVKSVIEYEVIN---PKES 291
            D NCL +KVE +PATK++  LNR+  ++ V       +Y+ VKS+IEYE+ N    K  
Sbjct: 235 QDENCLCIKVEAFPATKAVSGLNRKTAVE-VEDSQKKERYVGVKSIIEYEIHNEGNKKNV 293

Query: 292 SQDADDKNDARPVTVSRDSITKAYRYGADYVVLPSTLQSQLVYETFPGLDIRGFMDMELL 351
           S+D    +   PVT+S+DS+TKAYRYGADYVVLPS L  Q VYE+FPGLD+RGF++ E L
Sbjct: 294 SEDDQSGSSYIPVTISKDSVTKAYRYGADYVVLPSVLVDQTVYESFPGLDLRGFLNREAL 353

Query: 352 PRYYLNSESTFIIADTRLGGLADSVTFGVLVDVLLNNRKVAVARYVPKANSEVQMCVLVP 411
           PRY+L SES+FI ADTRLG  +D + F  LVDV+L NRK+AVARYV K +SEV MC L P
Sbjct: 354 PRYFLTSESSFITADTRLGCQSDLMAFSALVDVMLENRKIAVARYVSKKDSEVNMCALCP 413

Query: 412 LFVAHHDQSFSGEGEENFVRTLVLNRLPFAEDERVSDFPRLTNRRSTSGRTLPE--DKNE 469
           + + H + +     E+ FV++L L RLPFAEDERV+DFP+L +R +TSG  L +  D ++
Sbjct: 414 VLIEHSNIN----SEKKFVKSLTLCRLPFAEDERVTDFPKLLDRTTTSGVPLKKETDGHQ 469

Query: 470 IDELDVLMEEFVDSMDTDNLLNVPDPEYYKPISQVTQDTTLRLPTKEVKELENEQDPLRI 529
           IDE   LME+FVDSMDTD L  +P   YY+PI +VT DTTL LP+    + EN++DPLRI
Sbjct: 470 IDE---LMEQFVDSMDTDELPEIPLGNYYQPIGEVTTDTTLPLPSLNKDQEENKKDPLRI 526

Query: 530 PAIGVHRQQQVLLEWIHQKVIMGSDAFDIPDIPDKLREQIAPHVNXXXXXXXXXXXXXXX 589
           P + V+RQQQVLLEWIHQ +I  S  F+IP++PD L+ +I+P+ +               
Sbjct: 527 PTVFVYRQQQVLLEWIHQLMINDSREFEIPELPDSLKNKISPYTHKKFDSTKLVEVLGIK 586

Query: 590 XVEKSA--EHGKSEHIEEGPVEIPSLAALLEKGKRES 624
            V+K       K+E   E   +IP L  LL++G++ S
Sbjct: 587 KVDKLKLDSELKTELERE---KIPDLETLLKRGEQHS 620

>Kwal_26.7624
          Length = 602

 Score =  482 bits (1240), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 284/632 (44%), Positives = 390/632 (61%), Gaps = 42/632 (6%)

Query: 1   MSAESTTFIVDVSKNMINNDNVSKAMAYIEFTLLEKCKKKRKTDWTSLYAANSIETSNSQ 60
           M +E+TTFI+DVS +MI      +A AY+E+TL  K KK+RKTDW + Y AN   T NS 
Sbjct: 1   MGSEATTFIIDVSPSMIELGYAEQASAYLEYTLFLKSKKQRKTDWVNCYLANCPLTRNSY 60

Query: 61  EVPNVSQLSPFIAPVTSDDVAATMRRLQKQCEVKNEADDMESSMVQCLLVASLDIREQFG 120
           E  NV +L PF AP+++D V  T+R LQ   +    + +  ++M+QCLLV S+++R++F 
Sbjct: 61  ETDNVFELMPFTAPISADRVIETLRELQSVSQKSIASKERINTMIQCLLVTSMNMRDEFK 120

Query: 121 AKKMLRQIMVFTDDLNGLNFNDEEIDVLVGEIDSRIILVDCQXXXXXXXXXXXXNVDKAW 180
            +K+ +QIMVFTDDLNGL+  +EE+  L  E+   +ILV C                  W
Sbjct: 121 KRKIRKQIMVFTDDLNGLDLTEEELTTLEQELGCSLILVKCGPKKDSSEDMKLT----IW 176

Query: 181 LKLIKKLPGSMILPMDDLLLEITSPKPAVVKPVRVFNGELRLGANI--DSNAESNADDMN 238
            K I+ +PGS    M +LL EI+S +PAVVKP+R+F   LRLGA I  +   E+N D ++
Sbjct: 177 EKCIQVIPGSRQTTMTELLKEISSHRPAVVKPIRIFQANLRLGAQIFQEEGQETNYDSLD 236

Query: 239 CLSMKVEGYPATKSLQSLNRRNTIKTVTGENHSTKYIPVKSVIEYEVINPKESSQDADDK 298
              +KVEGYPATK++ SLNRR   K   GE     Y  VKS+IEY       S+ + DD 
Sbjct: 237 ---VKVEGYPATKAVSSLNRRVVAKI--GEQE---YEQVKSIIEY-------SALEEDDS 281

Query: 299 NDARPVTVSRDSITKAYRYGADYVVLPSTLQSQLVYETFPGLDIRGFMDMELLPRYYLNS 358
           + A   +VS+D +TKAYRYG+DYVVLP T++S+ +Y+T PGLD+RGF+D E +PR+YLNS
Sbjct: 282 DSAEAASVSKDFVTKAYRYGSDYVVLPQTIESERIYKTTPGLDLRGFLDKEDIPRHYLNS 341

Query: 359 ESTFIIADTRLGGLADSVTFGVLVDVLLNNRKVAVARYVPKANSEVQMCVLVPLFVAHHD 418
           ESTFI+A T+ G  AD + F  LVD ++   K AVARYV K NSEVQMCVL PL V    
Sbjct: 342 ESTFIVASTKDGSRADFLAFAALVDSMIKLNKFAVARYVQKTNSEVQMCVLCPLLVKKKR 401

Query: 419 QSFSGEGEENFVRTLVLNRLPFAEDERVSDFPRLTNRRSTSGRTLPEDKNEIDELDVLME 478
           +    E  E + R LVLNRLPFAEDERVSD+P+L+    +SG  +PE K  I E D LM+
Sbjct: 402 REL--EDSEPYYRALVLNRLPFAEDERVSDYPKLSR---SSG--MPEAK--IVETDALMD 452

Query: 479 EFVDSMDTDNLLNVPDPEY-----YKPISQVTQDTTLRLPTKEVKELENEQDPLRIPAIG 533
           +F+DSMD   L    D  +     Y+PI   T D +L LP  +    + + DP+++PAIG
Sbjct: 453 DFIDSMD---LGGGGDSSWCYTSRYRPIDSATTDPSLPLPASDSPRDDEKPDPMQLPAIG 509

Query: 534 VHRQQQVLLEWIHQKVIMGSDAFDIPDIPDKLR----EQIAPHVNXXXXXXXXXXXXXXX 589
           V+RQQQ+L+E++HQ+V+MGSD F++P++P  L+        P  N               
Sbjct: 510 VYRQQQLLVEYMHQRVVMGSDTFEVPELPMDLQKSLSSPSKPPSNTLKRLQDLLEIKPNT 569

Query: 590 XVEKSAEHGKSEHIEEGPVEIPSLAALLEKGK 621
              KS      +  E+  +EIPSL +LL +G+
Sbjct: 570 SNTKSNTPTDEQQDEDDLLEIPSLESLLARGR 601

>Sklu_2430.3 YMR106C, Contig c2430 3786-5666
          Length = 626

 Score =  445 bits (1144), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 261/591 (44%), Positives = 370/591 (62%), Gaps = 42/591 (7%)

Query: 1   MSAESTTFIVDVSKNMINNDNVSKAMAYIEFTLLEKCKKKRKTDWTSLYAANSIETSNSQ 60
           MS+E+TTF++DVS +M+   +V KA+AY+E+TL +K KK RKTD+ S    N   T N+Q
Sbjct: 1   MSSEATTFLIDVSHSMVAGGHVDKALAYLEYTLFQKVKKGRKTDYVSCILVNCPLTKNNQ 60

Query: 61  EVPNVSQLSPFIAPVTSDDVAATMRRLQKQCEVKNEADDMES---SMVQCLLVASLDIRE 117
           +   + +     APVTS      ++ ++   +     D   S   SM+Q +LV+S+ +R+
Sbjct: 61  DTDYIYEALEVTAPVTSVTTVKLLKDIRTVLQYIETTDKDHSECLSMIQSVLVSSVILRD 120

Query: 118 QFGAKKMLRQIMVFTDDLNGLNFNDEEIDVLVGEIDSRIILVDCQXXXXXXXXXXXXNVD 177
            F  +K+ + ++VFTDD++GL+ +D+E+ ++  E+D RIILV C+            N D
Sbjct: 121 FFKKRKITKNLVVFTDDMDGLDCDDDELQIMSNELDCRIILVHCEDEKKLKD-----NGD 175

Query: 178 KAWLKLIKKLPGSMILPMDDLLLEITSPKPAVVKPVRVFNGELRLGANIDSNAESNADDM 237
             W K ++ +PGS+   + +LL  IT PKP VVKPVR+F GELRLGA+++ +A S+ DD 
Sbjct: 176 TIWGKCVRSVPGSVKYTILELLRTITIPKPPVVKPVRIFQGELRLGASME-DAGSSMDDF 234

Query: 238 NCLSMKVEGYPATKSLQSLNRRNTIKTVTGENHSTKYIPVKSVIEYEV---INPKESSQD 294
             + ++VEG+PATK++ +LNR+  +K   GEN    Y PVKS+IEYE+   +N + S  D
Sbjct: 235 KSICIQVEGFPATKAVSNLNRKVVVKN--GEND---YSPVKSIIEYEIHNRVNGETSEFD 289

Query: 295 ADDKNDARPVTVSRDSITKAYRYGADYVVLPSTLQSQLVYETFPGLDIRGFMDMELLPRY 354
           A        V VS+ SITKAYRYG+DYVVLP TL+S+ +YET PGLDIRGF+D +  PRY
Sbjct: 290 A--------VAVSKSSITKAYRYGSDYVVLPPTLESERIYETEPGLDIRGFLDRKDFPRY 341

Query: 355 YLNSESTFIIADTRLGGLADSVTFGVLVDVLLNNRKVAVARYVPKANSEVQMCVLVPLFV 414
           YLNSESTFI+ DTR G  AD +    LVD L+   K A+ARYV + NSEVQMC+L P+ +
Sbjct: 342 YLNSESTFIVTDTRQGSRADYMALSALVDSLIKLEKFAIARYVQRKNSEVQMCLLCPILI 401

Query: 415 AHHDQSFSGEG-EENFVRTLVLNRLPFAEDERVSDFPRLTNRRSTSGRTLPEDKNEIDEL 473
              +      G EE   R L+L+RLPFAEDER  DFP+L+ +R+TSG+TL ED      L
Sbjct: 402 DDTNGMKRKLGREEQHTRALILSRLPFAEDERSPDFPKLSYQRTTSGKTLVEDTT---NL 458

Query: 474 DVLMEEFVDSMDTDNLLNVPDPEYYKPISQVTQD------TTLRLPT--KEVKELENEQD 525
           D  M  F+DSMD D+     +  +Y+    VT D      TT+ LP+  ++ KE +   +
Sbjct: 459 DSQMSMFIDSMDLDDNTGSSESSWYRNPCFVTADPTNALSTTIPLPSIEQDGKEPKANGN 518

Query: 526 PLRIPAIGVHRQQQVLLEWIHQKVIMGSDA-----FDIPDIPDKLREQIAP 571
           PL +PAI  HRQQQ LLE++HQK +M +       F +P +PD L  +  P
Sbjct: 519 PLCMPAISAHRQQQALLEYMHQKYVMETKKDDKFEFQVPSMPDLLLSKTRP 569

>CAGL0K03443g complement(316368..318215) similar to sp|Q04437
           Saccharomyces cerevisiae YMR106c, start by similarity
          Length = 615

 Score =  407 bits (1045), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 260/649 (40%), Positives = 378/649 (58%), Gaps = 72/649 (11%)

Query: 3   AESTTFIVDVSKNMINNDNVSKAMAYIEFTLLEKCKKKRKTDWTSLYAANSIETSNSQEV 62
           +E+T+ ++DV    +    ++K  AY+E+ LL+K ++ RKTD+ S Y  N  ET NSQ+V
Sbjct: 2   SEATSVLIDVD---VEPLIIAKVTAYLEYMLLDKARRGRKTDYVSAYLVNHTETQNSQDV 58

Query: 63  PNVSQLSPFIAPVTSDDVAATMRRLQKQCEVKNEADDMESSMVQCLLVASLDIREQFGAK 122
           P+V +L  F+AP T   +A     L++   V+ E      +++Q LL+AS+D R+ FG +
Sbjct: 59  PHVVRLCDFLAPTTEGAIAL----LRQLALVRREYRG--DNILQALLLASIDGRDYFGKR 112

Query: 123 KMLRQIMVFTDDLNGLNFNDEEIDVLVGEIDSRIILVDCQXXXXXXXXXXXXNVDKAWLK 182
           K+ +Q+M+FTD ++ L+ + EE+  L  E+DSRIILVDC                  W  
Sbjct: 113 KVAKQLMIFTDKVSELDLSAEELQTLHEELDSRIILVDCSTHPHQNAQGSQ------WDA 166

Query: 183 LIKKLPGSMILPMDDLLLEITSPKPAVVKPVRVFNGELRLGANIDS-------------- 228
           L++ + GSM   +D+LLL IT   P VVKPV VF+G+LRLGA++++              
Sbjct: 167 LVRTVKGSMSFHIDELLLRITQTVPKVVKPVTVFSGQLRLGASLENIVDLEPHRRDEAAA 226

Query: 229 -------------NAESNADDMNCLSMKVEGYPATKSLQSLNRRNTIKTVTGENHSTKYI 275
                          E+N  D +CL + V+GYPATK   SL +    KTV  +     ++
Sbjct: 227 ADNPKKRQFPFGFRTEANYADDHCLCIGVQGYPATKKTGSLQK----KTVVKDASKPGFV 282

Query: 276 PVKSVIEYEVI-NPKESSQDADDKNDARPVTVSRDSITKAYRYGADYVVLPSTLQSQLVY 334
           PVKSVI+YE+  N  E       + DA P+TV+R+SITKAYRYG DYVVLPS+L+ QLVY
Sbjct: 283 PVKSVIDYELRDNEVEGEGKGKGEGDAPPITVARESITKAYRYGTDYVVLPSSLEDQLVY 342

Query: 335 ETFPGLDIRGFMDMELLPRYYLNSESTFIIADTRLGGLADSVTFGVLVDVLLNNRKVAVA 394
           +T+ GLDIRGFM+M  + R++L SES F+++ +     AD +TF  L+D ++   K+A+ 
Sbjct: 343 QTYAGLDIRGFMNMSDMHRHFLTSESVFVVSSSS---SADQITFSALIDAMIQIDKIAIG 399

Query: 395 RYVPKANSEVQMCVLVPLFVAHHDQSFSGEGEENFVRTLVLNRLPFAEDERVSDFPRLTN 454
           RYVPK NS+VQMC+L P+ +   + +         VRTL+LNRLPF EDER++ FPRLT 
Sbjct: 400 RYVPKNNSDVQMCMLYPMILEKENGT--------HVRTLILNRLPFTEDERIAIFPRLTR 451

Query: 455 RRSTSGRTLPEDKNEIDE-LDVLMEEFVDSMDTDNLLNVPDPEYYKPISQVTQDTTLRLP 513
                     + K+E DE +D LM  FV+S   D+L  V + +YY+      +DTTL LP
Sbjct: 452 E--------DDKKSEKDETIDQLMAGFVESRSMDDLPRVEEKKYYEFYEDSVRDTTLVLP 503

Query: 514 TKEVKELENEQDPLRIPAIGVHRQQQVLLEWIHQKVIMGSDAFDIPDIPDKLREQIAPHV 573
            K  K+   E+DPL +PA+G+HRQ QV+LE++HQ VI  S+ FD P++ D L+ +I PH+
Sbjct: 504 MKS-KDETRERDPLMVPAMGLHRQLQVMLEYLHQVVINKSEKFDPPELQDHLKAKITPHI 562

Query: 574 NXXXXXXXXXXXXXXXXVEKSAEHGKSEHIEEGPVE-IPSLAALLEKGK 621
                              K  E    E     P E +PSL  LL++G+
Sbjct: 563 ---VSDFPELEELVNLLELKKVEPKSKEFKPPAPAEPVPSLEELLKRGE 608

>ABL030W [562] [Homologous to ScYMR106C (YKU80) - SH]
           complement(341669..343477) [1809 bp, 602 aa]
          Length = 602

 Score =  372 bits (954), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 238/635 (37%), Positives = 345/635 (54%), Gaps = 48/635 (7%)

Query: 1   MSAESTTFIVDVSKNMINNDNVSKAMAYIEFTLLEKCKKKRKTDWTSLYAANSIETSNSQ 60
           MS E TTF++D S +M+  ++ +K  AY+E+ L +K ++ RKTD+T +  AN     N  
Sbjct: 1   MSQECTTFLIDYSASML--ESTAKFEAYLEYALFDKAQRSRKTDYTHVVLANCAMEKNPN 58

Query: 61  EVPNVSQLSPFIAPVTSDDVAATMRRLQKQCEVKNEADDMESSMVQCLLVASLDIREQFG 120
            V N+ ++    AP+T   V     RL+   E+ +  D  +S++ + LL   + + ++F 
Sbjct: 59  NVKNMFEVFAPSAPITLSSVVKICERLKAMREL-DPLDTKQSNVFEALLAIGMQVNDKFN 117

Query: 121 AKKMLRQIMVFTDDLNGLNFNDEEIDVLVGEIDSRIILVDCQXXXXXXXXXXXXNVDKA- 179
            +KML+Q+MV TDDL+GLN + E+++V+   +D R+ILV C             N  K  
Sbjct: 118 KRKMLKQVMVVTDDLDGLNVDSEDLEVVQANLDLRLILVYC-------AEQFPDNFSKTK 170

Query: 180 WLKLIKKLPGSMILPMDDLLLEITSPKPAVVKPVRVFNGELRLGANIDSNAESNADDMNC 239
           W +L+    GS +  + ++L  I       VKPVRVF+G+LRLGA++  N      D +C
Sbjct: 171 WGQLLALKDGSRMFTLYEVLGTIERITHQPVKPVRVFHGQLRLGADM-RNLAGCQQDPHC 229

Query: 240 LSMKVEGYPATKSLQSLNRRNTIKTVTGENHSTKYIPVKSVIEYEVINPKESSQDADDKN 299
           L + VEGYPATK++ S++R+   KT  G     KY+P++SVIEYE+  P E     +D  
Sbjct: 230 LCINVEGYPATKAVVSMSRKQVQKTEDG-----KYLPLQSVIEYEIHEPTE-----EDNE 279

Query: 300 DARPVTVSRDSITKAYRYGADYVVLPSTLQSQLVYETFPGLDIRGFMDMELLPRYYLNSE 359
           +   V V ++ +TKAYRYGADYVVLP  L+ + +Y T PGLDIRGF+D   + R++L SE
Sbjct: 280 EYHVVPVPKEHVTKAYRYGADYVVLPELLEHERLYTTTPGLDIRGFIDTGKVLRHHLCSE 339

Query: 360 STFIIADTRLGGLADSVTFGVLVDVLLNNRKVAVARYVPKANSEVQMCVLVPLFVAHHDQ 419
           S +I+AD+R G  AD VTF  LVD ++   K A+ARYV K +SEVQMC+L PL V    +
Sbjct: 340 SVYIMADSREGTAADYVTFAALVDAMIAAEKFAIARYVQKKDSEVQMCLLCPLLVEPSTK 399

Query: 420 SFSGEGEENFV-RTLVLNRLPFAEDERVSDFPRLTNRRSTSGRTLPEDKNEIDELDVLME 478
               + +     R LVL RLPFAEDER SDFP L  +        P D      LD  M 
Sbjct: 400 KRPADDDAAEAKRALVLCRLPFAEDERSSDFPPLVKQE-------PADVM----LDTTMA 448

Query: 479 EFVDSMDTDNLLNVPDPEY-----YKPISQVTQDTTLRLPTKEVKELENEQDPLRIPAIG 533
            F+DSMD D     P   +      +      +D+TL LP  +    E       IPA+ 
Sbjct: 449 AFIDSMDMDA--AAPPASWCSSSNVRSFDSFMKDSTLPLP-DDPSLAEPCSAAACIPAVA 505

Query: 534 VHRQQQVLLEWIHQKVIMG-SDAFDIPDIPDKLREQIAPHVNXXXXXXXXXX--XXXXXX 590
           +H Q+ VLLE+  Q+ I+  S  F + D+ D LR +++P                     
Sbjct: 506 LHHQKHVLLEYFRQRFILRLSGGFSVADLRDSLRSKVSPWATAETSELAARIKDTCAVKL 565

Query: 591 VEKSAEHGKSEHIEE---GPVEIPSLAALLEKGKR 622
           VE+  E     +++E      E+P L ALL  GKR
Sbjct: 566 VERPPEATAGAYVDEEQDEASEVPPLEALLALGKR 600

>KLLA0B12672g 1105330..1107159 weakly similar to sp|Q04437
           Saccharomyces cerevisiae YMR106c HDF2 component of DNA
           end-joining repair pathway singleton, start by
           similarity
          Length = 609

 Score =  305 bits (782), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 212/602 (35%), Positives = 321/602 (53%), Gaps = 75/602 (12%)

Query: 3   AESTTFIVDVSKNMINNDNVSKAMAYIEFTLLEKCKKKRKTDWTSLYAANSIETSNSQEV 62
           +E T F+VDV    ++ D   KA  Y+E+ LL K + +RKTD+  L   N   +  S  V
Sbjct: 2   SELTCFVVDVGS--LSGDQWLKAFTYVEYVLLNKVQSQRKTDYVQLNLVNVSSSDESLPV 59

Query: 63  PNVSQLSPFI--APVTSDDVAATMRRL--QKQCEVKNEADDMESSMVQCLLVASLDIREQ 118
            N++ L P +  AP++  DV + + +   ++     N  DD +  +   LL++ L ++E 
Sbjct: 60  NNMAML-PVLPRAPISISDVRSWLGQWYDERNNTTGNGEDDDDDMLFNGLLISVLKLKEF 118

Query: 119 FGAKKMLRQIMVFTD-DLNGLNFNDEEIDVLVGEIDSRIILVDCQXXXXXXXXXXXXNVD 177
            G +KM  +I+VF+  DL   N  DEE+     +    +++ DC                
Sbjct: 119 VGKRKMKVKIVVFSSQDLQ--NVTDEELSTFADQCPFDLVIADCNDKQGHQESKHGN--- 173

Query: 178 KAWLKLIKKLPGSMILPMDDLLLEITSPKPAVVKPVRVFNGELRLGANIDSNAESNADDM 237
             WLKL   L    +  +D+L+  +  PK  + +P+R F G+LRLG       + NA D+
Sbjct: 174 --WLKLGTPL----VYGIDELIQSVADPKLKLTRPIRTFQGQLRLG-------DVNASDL 220

Query: 238 N--CLSMKVEGYPATKSLQSLNRRNTIKTVTGENHSTKYIPVKSVIEYEV--------IN 287
               L + +EG P TKS+ S++R+   K  + E   T Y  VKSVIEY++         +
Sbjct: 221 GIPSLCINLEGVPGTKSVSSISRKVMRKEGSSEGQPT-YRAVKSVIEYQIEDQSASTSAS 279

Query: 288 PKESSQDADDKNDA------RPVTVSRDSITKAYRYGADYVVLPSTLQSQLVYETFPGLD 341
           PK+ +   DD  D+      R + VS+D I KAYRYGADYV LP  L  +      PGLD
Sbjct: 280 PKKETTRKDDDGDSGNNTGPRMINVSKDFIKKAYRYGADYVDLPMPLDEERKLSEKPGLD 339

Query: 342 IRGFMDMELLPRYYLNSESTFIIADTRLGGLADSVTFGVLVDVLLNNRKVAVARYVPKAN 401
           IRGFMD++ LPR+YL SES +++ D++ G   D + F  LVD L+  +++ +AR+VPK  
Sbjct: 340 IRGFMDIDKLPRHYLCSESMYLVPDSKNGSKGDFLGFVTLVDSLIKMKRLIIARFVPKFG 399

Query: 402 SEVQMCVLVPLFVAHHDQSFSGEGEENFVRTLVLNRLPFAEDERVSDFPRLTNRRSTSGR 461
           +EVQMC L P+ V  HD+      + N VR LVLNRLP +EDER S FP++         
Sbjct: 400 NEVQMCSLFPVRV--HDK------DRNEVRLLVLNRLPMSEDERNSAFPKMC-------- 443

Query: 462 TLPEDKNEIDELDVLMEEFVDSMDTDNLLNVPDPEYYKP--ISQVT----QDTTLRLPTK 515
               +  E++  D  M +FVDSM+ DN  +  D  +Y+   I + T    + ++L LP +
Sbjct: 444 ----ESTELEPEDEAMGQFVDSMNLDN--DAQDLPWYESDQIQKYTDVALEQSSLPLPQR 497

Query: 516 EVKELENEQDPLRIPAIGVHRQQQVLLEWIHQKVIMG---SDAFDIPDIPDKLREQIAPH 572
           E+      ++P  IPAI +HRQQQV+LE +HQK I+G       +IP +   + ++I P 
Sbjct: 498 EMFR-ATARNPSAIPAISLHRQQQVILECVHQKFIVGKRDQQDLNIPPMSKMILKKITPK 556

Query: 573 VN 574
            N
Sbjct: 557 YN 558

>YJR031C (GEA1) [2927] chr10 complement(486500..490726) Component of
           complex with guanine-nucleotide-exchange activity for
           ARF [4227 bp, 1408 aa]
          Length = 1408

 Score = 33.1 bits (74), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 65/137 (47%), Gaps = 20/137 (14%)

Query: 244 VEGYPATKSLQSLNRRNTIKTVTGENHSTKYIPVKSVIEYEVINPKESSQDADDKNDARP 303
           V GY  + +L SL +  T+K +    +  +    ++V+       + S Q +DD    + 
Sbjct: 113 VSGYTTSLALDSLQKVFTLKIINKTFNDIQIAVRETVVALTHCRFEASKQISDDSVLLKV 172

Query: 304 VTVSRDSITKAYR-YGAD---YVVLPSTL-------QSQLVYE----TFPGLDIRGFMDM 348
           VT+ RD IT ++  Y +D   Y VL +TL       +S+++ +    T  G+ ++ F  +
Sbjct: 173 VTLLRDIITSSFGDYLSDTIIYDVLQTTLSLACNTQRSEVLRKTAEVTIAGITVKLFTKL 232

Query: 349 ELL-----PRYYLNSES 360
           +LL        Y+N ES
Sbjct: 233 KLLDPPTKTEKYINDES 249

>YMR284W (YKU70) [4238] chr13 (838186..839994) Component of DNA
           end-joining repair pathway, required for
           telomere-directed transcriptional silencing, involved in
           protecting telomeres from homologous recombination, acts
           in complex with Yku80p [1809 bp, 602 aa]
          Length = 602

 Score = 33.1 bits (74), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 88/213 (41%), Gaps = 29/213 (13%)

Query: 265 VTGENHSTKYIPVKSVIEYEVINPKES-SQDADDKNDA-RPVT---VSRDSITKAYRYGA 319
           + G    T Y   K+ + Y+++   E   Q+A  K     P+T   V+  ++ K Y YG 
Sbjct: 281 IVGVKGYTMYTHEKAGVRYKLVYEHEDIRQEAYSKRKFLNPITGEDVTGKTV-KVYPYG- 338

Query: 320 DYVVLPSTLQSQLVYETFPG----LDIRGFMDMELLPRYYLN-SESTFIIADTRLGGLAD 374
           D  +  S  Q Q+V E +      L I GF        Y+ N  +S+FI+ D        
Sbjct: 339 DLDINLSDSQDQIVMEAYTQKDAFLKIIGFRSSSKSIHYFNNIDKSSFIVPDE--AKYEG 396

Query: 375 SV-TFGVLVDVLLNNRKVAVARYVPKANSEVQMCVLVPLFVAHHDQSFSGEGEENFVRTL 433
           S+ T   L+ +L    K+A+     K+NS   +  L P  V  +++ F            
Sbjct: 397 SIRTLASLLKILRKKDKIAILWGKLKSNSHPSLYTLSPSSVKDYNEGF------------ 444

Query: 434 VLNRLPFAEDERVSDFPRLTNRRSTSGRTLPED 466
            L R+PF ++  +  FP L +    S   L  D
Sbjct: 445 YLYRVPFLDE--IRKFPSLLSYDDGSEHKLDYD 475

>Scas_667.16
          Length = 173

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 310 SITKAYRYGADYVVLPSTLQSQLVYETFPGLDIRGFMDMELLPRYYLNSESTF 362
           +I K    G D ++L + +++++  + + G+   GF+ M+ + RYYLN    F
Sbjct: 104 AINKMIDDGCDEIMLEAEVENKVALQLYEGM---GFIRMKRMFRYYLNEGDAF 153

>Scas_704.12
          Length = 753

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 61/129 (47%), Gaps = 20/129 (15%)

Query: 331 QLVYETFPGLDIRGFMDMELLPRYYLNSESTFIIADTRL-------GG-----LADSVTF 378
           + VY  F G + +  M++   P  Y+   +T+  A+T+L       GG       D   +
Sbjct: 509 KFVYGVF-GFEFK--MELSTRPEKYVGEIATWDAAETKLASALKKWGGNWEINPGDGAFY 565

Query: 379 GVLVDVLLNNRKVAVARYVPKANSEVQMCVLVPLFVAHHDQSFSGEGEENFVRTLVLNRL 438
           G  +D+++++   A+ R+   A   +Q+   +P       +S  G+ EEN+ R ++++R 
Sbjct: 566 GPKIDIMISD---ALRRWHQCAT--IQLDFQLPSRFELEFKSKDGQNEENYERPVMIHRA 620

Query: 439 PFAEDERVS 447
                ER++
Sbjct: 621 ILGSVERMT 629

>Kwal_23.4773
          Length = 1030

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 55/123 (44%), Gaps = 9/123 (7%)

Query: 206 KPAVVKPVRVFNGELRLG--ANIDSNAESNADDM-NCLSMKVEGYPATKSLQSLNRRNTI 262
           KP    P ++ N +L+L     I ++A    D   N +       P+ K+   L  +  I
Sbjct: 245 KPPKNDPYKITNSDLKLALRTAISASALFEEDAFGNLIDKMTASSPSVKNDTLLTIKACI 304

Query: 263 KTVTGENHSTKYIPVKSVIEYEVI-NPKESSQDA-----DDKNDARPVTVSRDSITKAYR 316
           +   GE     ++P+ + +++E++ N ++SS D      D+  D+  V  S  +    Y+
Sbjct: 305 EKFGGEACLKNWLPIWNALKFEIMHNVEDSSADGNALEFDNYEDSLSVLTSLSTQLVGYK 364

Query: 317 YGA 319
            GA
Sbjct: 365 EGA 367

>CAGL0L08954g 977518..978882 similar to tr|Q12059 Saccharomyces
           cerevisiae YPL003w ULA1 involved in protein
           modification, start by similarity
          Length = 454

 Score = 29.3 bits (64), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 8/62 (12%)

Query: 229 NAESNADDM-NCL--SMKVEGYPATKSLQSLNRRNTIKTVTGENHSTKYIPVKSVIEYEV 285
           N E+N D++ N L  S+++E Y  T  L S+  +   K +T +     ++P+K++  Y  
Sbjct: 389 NGETNIDNIDNSLRTSLQLESYSVTTMLGSIASQEIFKLITHQ-----FVPIKNIFIYNA 443

Query: 286 IN 287
            N
Sbjct: 444 TN 445

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,719,342
Number of extensions: 863658
Number of successful extensions: 2267
Number of sequences better than 10.0: 29
Number of HSP's gapped: 2285
Number of HSP's successfully gapped: 29
Length of query: 625
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 517
Effective length of database: 12,857,365
Effective search space: 6647257705
Effective search space used: 6647257705
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)