Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_717.6967467435050.0
Scas_721.12468465926050.0
CAGL0K03399g70370624540.0
ABL028W72265023780.0
Kwal_26.763569165923490.0
KLLA0B12716g71657022830.0
CAGL0K07458g70459020110.0
Kwal_47.167617444509221e-114
ADL389W7113569101e-112
Scas_703.57493578991e-110
YHR205W (SCH9)8243698981e-109
KLLA0B03586g7343568811e-108
CAGL0F09075g7463568741e-107
YJL164C (TPK1)3972967054e-86
KLLA0B07205g4552977052e-85
Scas_651.183712976912e-84
Scas_689.25*4092976933e-84
Kwal_33.138463753226894e-84
CAGL0M08404g4623696896e-83
CAGL0G09020g3612976674e-81
Kwal_56.240593532976666e-81
CAGL0M09361g11443336941e-78
ACR191C11493356923e-78
AFL090W3462976446e-78
Kwal_27.1058111543326898e-78
Scas_715.3411503336862e-77
AEL115C3862976425e-77
Scas_690.133542976395e-77
KLLA0E06413g11613286835e-77
KLLA0D03190g3722976406e-77
YBL105C (PKC1)11513356731e-75
YCR091W (KIN82)7203025666e-63
CAGL0J06072g7733505652e-62
CAGL0C03509g8953025674e-62
Kwal_23.64588683025665e-62
Scas_629.169183065622e-61
Kwal_56.227885153915405e-61
ADR167W8733055472e-59
KLLA0F24618g5563515332e-59
AEL083W5363925312e-59
YBR028C5253635284e-59
KLLA0C18568g7743025406e-59
Scas_720.1038043575391e-58
CAGL0B04301g5423645162e-57
Scas_593.14d4952924871e-53
CAGL0E05720g3582804472e-49
KLLA0B02332g3612764315e-47
AFL101C3672684281e-46
Kwal_23.39925713504313e-45
YDR490C (PKH1)7662984348e-45
CAGL0B04147g5663514224e-44
KLLA0E03487g6472864254e-44
Scas_705.235533964189e-44
YGR092W (DBF2)5723524145e-43
Kwal_56.240913812694019e-43
CAGL0G03047g5393514091e-42
Kwal_56.226939842904146e-42
KLLA0C12485g9252914136e-42
KLLA0D14905g5673544003e-41
AFR377C7262954044e-41
Scas_627.73492703831e-40
ADR033W5773503952e-40
CAGL0G04609g9653104003e-40
CAGL0I07513g10763153961e-39
Scas_660.209572823961e-39
YDR466W (PKH3)8983033852e-38
AFR335C10332923853e-38
Scas_716.335733533783e-38
KLLA0F13552g12672653811e-37
Kwal_26.778812672793739e-37
KLLA0D07810g7181583709e-37
Scas_502.211162903693e-36
ABL034W14252723694e-36
KLLA0F11319g8432613665e-36
Kwal_33.145547141563646e-36
Scas_654.127371563638e-36
Kwal_47.183076212733618e-36
AFR035W7191563638e-36
CAGL0K06479g9913043594e-35
Scas_616.1014613173543e-34
CAGL0J03872g6612973493e-34
CAGL0J11638g7462783487e-34
Kwal_26.87098292743462e-33
AAR009W4532513344e-33
AFR696C11423173391e-32
CAGL0K08514g14893123402e-32
Kwal_0.964272593272e-32
ACL006W7082463352e-32
YDL101C (DUN1)5132903303e-32
CAGL0M02519g7563163343e-32
CAGL0M08910g6123093306e-32
Kwal_47.182335983183299e-32
AEL230W6082883272e-31
KLLA0E01584g4152923192e-31
CAGL0L07326g5062913222e-31
Scas_618.84272903193e-31
Kwal_33.131125052673213e-31
KLLA0C06138g7082463254e-31
YDR477W (SNF1)6332613235e-31
AFR724C4402723176e-31
ACR133C8512613256e-31
CAGL0K05709g11033173257e-31
Scas_693.1710492923249e-31
Scas_644.157262463221e-30
Scas_660.286232473201e-30
Scas_700.348643153212e-30
KLLA0F23155g4272523122e-30
KLLA0A03806g6022613173e-30
CAGL0M02233g7672893184e-30
ACR142W8372843167e-30
KLLA0C01650g11123293151e-29
CAGL0F04741g4422493062e-29
ACR119W9312903132e-29
Kwal_26.87967962683113e-29
Kwal_56.224766972463094e-29
KLLA0F11143g8132683104e-29
YDR507C (GIN4)11422833114e-29
Scas_564.712102983114e-29
CAGL0K10604g4462613017e-29
Scas_613.55172993037e-29
YFR014C (CMK1)4462472991e-28
Scas_493.211173273043e-28
Scas_640.14*7282893023e-28
AGR058W10713203034e-28
KLLA0D07348g9092643024e-28
Scas_700.288962613024e-28
Scas_700.546982753006e-28
Kwal_23.35904992992966e-28
CAGL0M02299g8932613016e-28
CAGL0L11550g10722492991e-27
Scas_201.1*2742182811e-27
CAGL0B01925g9442762972e-27
KLLA0F19536g11042822962e-27
CAGL0M11396g11922922953e-27
Scas_713.79832692936e-27
CAGL0K12562g16821552946e-27
Kwal_26.87518483092918e-27
Kwal_47.172528723462901e-26
KLLA0F09020g9281552892e-26
AFL188C4722762822e-26
KLLA0F09031g6331492853e-26
CAGL0I09504g5282862824e-26
YCL024W (KCC4)10372752864e-26
YFL033C (RIM15)17701552874e-26
ACR218W15691602874e-26
YDR523C (SPS1)4902462805e-26
ACL104C9472522855e-26
Kwal_14.115915211552865e-26
KLLA0C17160g8313962821e-25
Scas_573.105693162772e-25
YDR122W (KIN1)10642802812e-25
YJL128C (PBS2)6682852773e-25
CAGL0L05632g6773002773e-25
YHR102W (KIC1)10802502793e-25
AER223C9022802783e-25
Scas_707.315981802785e-25
KLLA0E21780g10162472775e-25
KLLA0C00979g4832682716e-25
YGL158W (RCK1)5123082727e-25
CAGL0L06006g9422892732e-24
Scas_580.610152492722e-24
Scas_685.245152672673e-24
CAGL0C05005g10762412713e-24
Scas_707.369153262703e-24
Kwal_56.237178582332686e-24
Kwal_55.215458652472661e-23
Scas_582.16382862631e-23
YAR019C (CDC15)9742422652e-23
ACL054W9722892633e-23
Kwal_27.97638682412623e-23
KLLA0C04191g7972592613e-23
Scas_673.20*7582482614e-23
CAGL0K02673g9152662615e-23
Scas_675.25272792567e-23
Kwal_23.632515422752607e-23
CAGL0J00539g4883122558e-23
CAGL0F00649g5143212559e-23
Kwal_0.1555873082569e-23
KLLA0C08525g15512732591e-22
CAGL0K02167g11623352571e-22
KLLA0E15378g7242822542e-22
Kwal_26.735514462812562e-22
AFL217C6912822524e-22
CAGL0H01639g5212562496e-22
Scas_711.2515152862527e-22
YGL180W (ATG1)8973092491e-21
CAGL0D02244g4873272451e-21
AER264C14832482482e-21
KLLA0F23507g4872272423e-21
CAGL0B03509g5972242434e-21
Kwal_33.140815802822425e-21
YJL095W (BCK1)14782922455e-21
Kwal_56.238414323352386e-21
Scas_619.5*5102972407e-21
CAGL0M10153g8672422437e-21
YHL007C (STE20)9392492428e-21
Scas_668.228932452411e-20
ADR379C4923102371e-20
KLLA0F01276g5192642371e-20
CAGL0M11748g4473352352e-20
Scas_713.384323352332e-20
Scas_618.156203322372e-20
AGR048C4533352343e-20
Kwal_27.97734062852323e-20
CAGL0L03520g14472722383e-20
KLLA0F14190g13382302383e-20
YBR274W (CHK1)5272172344e-20
CAGL0M03729g8612042364e-20
KLLA0B11902g4953662334e-20
Kwal_47.1726311273302364e-20
KLLA0D07304g4652072325e-20
Kwal_26.78619552592355e-20
KLLA0F12188g5462132327e-20
KLLA0A07403g8792042347e-20
Scas_707.349053202347e-20
AEL205W7932032339e-20
AEL185C5152772291e-19
YGL179C (TOS3)5603072292e-19
AFR092W14232892312e-19
Kwal_23.55765042372282e-19
CAGL0I04422g4222772252e-19
KLLA0B13607g9891342302e-19
ABR014W9711332293e-19
KLLA0F20053g4443352244e-19
AEL284C4792372254e-19
Kwal_14.24974181862226e-19
Kwal_27.125594143622216e-19
AAL029W5343082246e-19
ACR117W5242072247e-19
Kwal_23.52908192032258e-19
YHR030C (SLT2)4843132211e-18
Kwal_55.203267502712231e-18
Scas_713.216412932222e-18
Scas_598.67902032222e-18
AER222C4233082182e-18
ADL315C4342812172e-18
Kwal_55.220013633222152e-18
AER232C5693102193e-18
Scas_602.1111863952213e-18
Scas_688.144793192164e-18
YCR073C (SSK22)13312632205e-18
Scas_683.63773072136e-18
Kwal_26.87034442052156e-18
KLLA0D09328g10463352187e-18
Scas_720.9416832712189e-18
CAGL0J03828g4672012131e-17
CAGL0B02739g6762242151e-17
KLLA0E11979g6142032151e-17
Kwal_27.118032462002032e-17
Kwal_33.132221481121962e-17
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_717.69
         (674 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_717.69                                                          1354   0.0  
Scas_721.124                                                         1008   0.0  
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...   949   0.0  
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...   920   0.0  
Kwal_26.7635                                                          909   0.0  
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...   884   0.0  
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...   779   0.0  
Kwal_47.16761                                                         359   e-114
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...   355   e-112
Scas_703.5                                                            350   e-110
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...   350   e-109
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...   343   e-108
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...   341   e-107
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...   276   4e-86
KLLA0B07205g complement(624606..625973) some similarities with s...   276   2e-85
Scas_651.18                                                           270   2e-84
Scas_689.25*                                                          271   3e-84
Kwal_33.13846                                                         270   4e-84
CAGL0M08404g complement(836791..838179) some similarities with s...   270   6e-83
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...   261   4e-81
Kwal_56.24059                                                         261   6e-81
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...   271   1e-78
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...   271   3e-78
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...   252   6e-78
Kwal_27.10581                                                         270   8e-78
Scas_715.34                                                           268   2e-77
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...   251   5e-77
Scas_690.13                                                           250   5e-77
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....   267   5e-77
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...   251   6e-77
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...   263   1e-75
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...   222   6e-63
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...   222   2e-62
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...   223   4e-62
Kwal_23.6458                                                          222   5e-62
Scas_629.16                                                           221   2e-61
Kwal_56.22788                                                         212   5e-61
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...   215   2e-59
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...   209   2e-59
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....   209   2e-59
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...   207   4e-59
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...   212   6e-59
Scas_720.103                                                          212   1e-58
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...   203   2e-57
Scas_593.14d                                                          192   1e-53
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...   176   2e-49
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...   170   5e-47
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...   169   1e-46
Kwal_23.3992                                                          170   3e-45
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...   171   8e-45
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...   167   4e-44
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...   168   4e-44
Scas_705.23                                                           165   9e-44
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...   164   5e-43
Kwal_56.24091                                                         159   9e-43
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...   162   1e-42
Kwal_56.22693                                                         164   6e-42
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...   163   6e-42
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...   158   3e-41
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...   160   4e-41
Scas_627.7                                                            152   1e-40
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...   156   2e-40
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...   158   3e-40
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...   157   1e-39
Scas_660.20                                                           157   1e-39
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...   152   2e-38
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...   152   3e-38
Scas_716.33                                                           150   3e-38
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...   151   1e-37
Kwal_26.7788                                                          148   9e-37
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...   147   9e-37
Scas_502.2                                                            146   3e-36
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...   146   4e-36
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...   145   5e-36
Kwal_33.14554                                                         144   6e-36
Scas_654.12                                                           144   8e-36
Kwal_47.18307                                                         143   8e-36
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...   144   8e-36
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...   142   4e-35
Scas_616.10                                                           140   3e-34
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...   139   3e-34
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...   138   7e-34
Kwal_26.8709                                                          137   2e-33
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...   133   4e-33
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...   135   1e-32
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...   135   2e-32
Kwal_0.96                                                             130   2e-32
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...   133   2e-32
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...   131   3e-32
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...   133   3e-32
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...   131   6e-32
Kwal_47.18233                                                         131   9e-32
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...   130   2e-31
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...   127   2e-31
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...   128   2e-31
Scas_618.8                                                            127   3e-31
Kwal_33.13112                                                         128   3e-31
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...   129   4e-31
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...   129   5e-31
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...   126   6e-31
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...   129   6e-31
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...   129   7e-31
Scas_693.17                                                           129   9e-31
Scas_644.15                                                           128   1e-30
Scas_660.28                                                           127   1e-30
Scas_700.34                                                           128   2e-30
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...   124   2e-30
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....   126   3e-30
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...   127   4e-30
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...   126   7e-30
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...   125   1e-29
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...   122   2e-29
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...   125   2e-29
Kwal_26.8796                                                          124   3e-29
Kwal_56.22476                                                         123   4e-29
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...   124   4e-29
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...   124   4e-29
Scas_564.7                                                            124   4e-29
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...   120   7e-29
Scas_613.5                                                            121   7e-29
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...   119   1e-28
Scas_493.2                                                            121   3e-28
Scas_640.14*                                                          120   3e-28
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...   121   4e-28
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...   120   4e-28
Scas_700.28                                                           120   4e-28
Scas_700.54                                                           120   6e-28
Kwal_23.3590                                                          118   6e-28
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...   120   6e-28
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...   119   1e-27
Scas_201.1*                                                           112   1e-27
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...   119   2e-27
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...   118   2e-27
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...   118   3e-27
Scas_713.7                                                            117   6e-27
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...   117   6e-27
Kwal_26.8751                                                          116   8e-27
Kwal_47.17252                                                         116   1e-26
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...   115   2e-26
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...   113   2e-26
KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces c...   114   3e-26
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...   113   4e-26
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...   114   4e-26
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...   115   4e-26
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...   115   4e-26
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...   112   5e-26
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...   114   5e-26
Kwal_14.1159                                                          114   5e-26
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...   113   1e-25
Scas_573.10                                                           111   2e-25
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...   112   2e-25
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...   111   3e-25
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...   111   3e-25
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...   112   3e-25
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....   111   3e-25
Scas_707.3                                                            111   5e-25
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...   111   5e-25
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...   108   6e-25
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...   109   7e-25
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...   109   2e-24
Scas_580.6                                                            109   2e-24
Scas_685.24                                                           107   3e-24
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...   108   3e-24
Scas_707.36                                                           108   3e-24
Kwal_56.23717                                                         107   6e-24
Kwal_55.21545                                                         107   1e-23
Scas_582.1                                                            105   1e-23
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...   106   2e-23
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...   105   3e-23
Kwal_27.9763                                                          105   3e-23
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...   105   3e-23
Scas_673.20*                                                          105   4e-23
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...   105   5e-23
Scas_675.2                                                            103   7e-23
Kwal_23.6325                                                          104   7e-23
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...   102   8e-23
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...   102   9e-23
Kwal_0.155                                                            103   9e-23
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...   104   1e-22
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...   103   1e-22
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...   102   2e-22
Kwal_26.7355                                                          103   2e-22
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...   101   4e-22
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...   100   6e-22
Scas_711.25                                                           101   7e-22
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...   100   1e-21
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    99   1e-21
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...   100   2e-21
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    98   3e-21
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    98   4e-21
Kwal_33.14081                                                          98   5e-21
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    99   5e-21
Kwal_56.23841                                                          96   6e-21
Scas_619.5*                                                            97   7e-21
CAGL0M10153g complement(1010688..1013291) some similarities with...    98   7e-21
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    98   8e-21
Scas_668.22                                                            97   1e-20
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    96   1e-20
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    96   1e-20
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    95   2e-20
Scas_713.38                                                            94   2e-20
Scas_618.15                                                            96   2e-20
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    95   3e-20
Kwal_27.9773                                                           94   3e-20
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    96   3e-20
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    96   3e-20
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    95   4e-20
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    96   4e-20
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    94   4e-20
Kwal_47.17263                                                          96   4e-20
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    94   5e-20
Kwal_26.7861                                                           95   5e-20
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    94   7e-20
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    95   7e-20
Scas_707.34                                                            95   7e-20
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    94   9e-20
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    93   1e-19
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    93   2e-19
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    94   2e-19
Kwal_23.5576                                                           92   2e-19
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    91   2e-19
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    93   2e-19
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    93   3e-19
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    91   4e-19
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    91   4e-19
Kwal_14.2497                                                           90   6e-19
Kwal_27.12559                                                          90   6e-19
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    91   6e-19
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    91   7e-19
Kwal_23.5290                                                           91   8e-19
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    90   1e-18
Kwal_55.20326                                                          91   1e-18
Scas_713.21                                                            90   2e-18
Scas_598.6                                                             90   2e-18
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    89   2e-18
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    88   2e-18
Kwal_55.22001                                                          87   2e-18
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    89   3e-18
Scas_602.11                                                            90   3e-18
Scas_688.14                                                            88   4e-18
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    89   5e-18
Scas_683.6                                                             87   6e-18
Kwal_26.8703                                                           87   6e-18
KLLA0D09328g complement(788565..791705) some similarities with s...    89   7e-18
Scas_720.94                                                            89   9e-18
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    87   1e-17
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    87   1e-17
KLLA0E11979g complement(1060048..1061892) some similarities with...    87   1e-17
Kwal_27.11803                                                          83   2e-17
Kwal_33.13222                                                          80   2e-17
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    87   2e-17
Scas_568.9*                                                            84   3e-17
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    84   3e-17
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    86   4e-17
Scas_643.20                                                            86   4e-17
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    84   5e-17
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    86   5e-17
Kwal_23.4276                                                           85   6e-17
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    83   6e-17
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    85   7e-17
Kwal_0.307                                                             84   7e-17
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    84   8e-17
Scas_477.5                                                             85   9e-17
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    84   1e-16
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    84   2e-16
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    82   2e-16
Scas_628.9                                                             84   2e-16
Scas_623.11                                                            82   2e-16
Scas_633.29                                                            84   2e-16
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    82   2e-16
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    83   2e-16
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    82   3e-16
Scas_635.1                                                             82   3e-16
Scas_716.73                                                            82   3e-16
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    81   3e-16
Scas_710.28                                                            81   3e-16
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    81   3e-16
Scas_640.16                                                            82   4e-16
Kwal_26.7154                                                           83   4e-16
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    83   4e-16
Kwal_14.1416                                                           81   4e-16
Scas_548.6                                                             83   4e-16
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    80   4e-16
Kwal_33.14167                                                          82   5e-16
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    82   6e-16
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    80   8e-16
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    79   1e-15
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    80   1e-15
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    80   1e-15
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    81   1e-15
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    80   2e-15
Scas_634.5                                                             80   2e-15
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    79   2e-15
Scas_700.35                                                            79   2e-15
Scas_651.3                                                             80   3e-15
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    80   3e-15
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    79   3e-15
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    79   4e-15
Scas_544.6                                                             78   6e-15
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    79   7e-15
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    79   7e-15
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    79   7e-15
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    79   1e-14
Scas_680.20                                                            77   1e-14
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    78   1e-14
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    78   1e-14
Scas_667.18                                                            77   1e-14
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    77   1e-14
Scas_678.13                                                            77   2e-14
Kwal_56.24584                                                          76   3e-14
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    74   3e-14
Kwal_33.13984                                                          76   4e-14
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    76   4e-14
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    76   5e-14
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    75   7e-14
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    73   8e-14
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    74   1e-13
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    74   1e-13
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    74   1e-13
Kwal_26.8347                                                           74   2e-13
Kwal_23.5668                                                           75   2e-13
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    74   2e-13
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    73   2e-13
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    74   2e-13
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    72   4e-13
Scas_721.110                                                           72   6e-13
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    72   7e-13
Kwal_14.1273                                                           71   8e-13
Scas_336.1                                                             72   8e-13
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    71   8e-13
Kwal_26.7552                                                           71   1e-12
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    71   1e-12
Kwal_47.17868                                                          70   1e-12
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    72   1e-12
Scas_721.132                                                           71   1e-12
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    70   2e-12
Kwal_17.2687                                                           70   2e-12
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    70   3e-12
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    70   3e-12
Scas_721.46                                                            68   4e-12
Kwal_33.13831                                                          70   4e-12
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    70   5e-12
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    69   5e-12
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    69   6e-12
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    69   7e-12
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    67   1e-11
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    69   1e-11
Kwal_27.10004                                                          68   1e-11
KLLA0C16577g complement(1451181..1452695) some similarities with...    68   1e-11
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    67   1e-11
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    67   1e-11
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    67   2e-11
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    65   2e-11
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    67   3e-11
Scas_678.24                                                            67   3e-11
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    65   3e-11
Kwal_26.7682                                                           66   4e-11
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    65   5e-11
Scas_684.28                                                            65   1e-10
Scas_649.30                                                            65   1e-10
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    64   1e-10
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    63   1e-10
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    64   2e-10
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    64   2e-10
Scas_613.13*                                                           62   2e-10
Kwal_33.13681                                                          64   3e-10
Kwal_27.11919                                                          60   4e-10
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    63   4e-10
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    63   4e-10
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    62   5e-10
Kwal_26.7276                                                           63   5e-10
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    62   5e-10
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...    62   8e-10
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    62   8e-10
Kwal_23.3471                                                           60   1e-09
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    60   1e-09
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    62   1e-09
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    60   2e-09
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    61   2e-09
Scas_695.33                                                            60   3e-09
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    60   3e-09
Scas_673.34*                                                           60   3e-09
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...    60   5e-09
KLLA0A06820g complement(615686..618004) some similarities with s...    60   6e-09
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    59   6e-09
Scas_653.25                                                            59   7e-09
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    58   8e-09
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    59   9e-09
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    59   9e-09
Kwal_33.14192                                                          59   9e-09
Kwal_27.11830                                                          59   1e-08
Scas_648.17                                                            58   1e-08
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    58   1e-08
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    58   1e-08
Scas_683.12                                                            57   1e-08
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    57   2e-08
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    57   2e-08
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...    58   3e-08
Kwal_47.18098                                                          57   3e-08
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    57   3e-08
Scas_704.50                                                            57   3e-08
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    57   3e-08
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    56   3e-08
Scas_698.37                                                            56   3e-08
Scas_711.15                                                            57   3e-08
KLLA0C03938g complement(358851..360632) some similarities with s...    57   3e-08
YJL165C (HAL5) [2756] chr10 complement(106887..109454) Serine/th...    57   4e-08
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    55   4e-08
KLLA0F22297g complement(2083448..2085547) some similarities with...    57   4e-08
Scas_677.18                                                            57   5e-08
Scas_568.13                                                            56   5e-08
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    56   5e-08
Scas_718.90                                                            56   5e-08
CAGL0H09152g complement(895722..898055) similar to sp|P47116 Sac...    57   5e-08
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...    56   6e-08
Kwal_55.21709                                                          55   6e-08
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    56   6e-08
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    56   7e-08
Scas_689.24                                                            56   8e-08
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    56   8e-08
KLLA0F08877g 825217..826182 gi|27526975|emb|CAD36965.1 Kluyverom...    55   8e-08
Scas_610.7                                                             56   8e-08
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    55   9e-08
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    55   1e-07
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    55   1e-07
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    55   1e-07
Scas_22.1                                                              54   1e-07
KLLA0B06501g complement(576636..579089) some similarities with s...    55   1e-07
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    55   1e-07
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    55   1e-07
Scas_651.19                                                            55   1e-07
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    55   2e-07
Kwal_55.20189                                                          55   2e-07
Scas_654.17                                                            54   2e-07
Kwal_27.11777                                                          54   2e-07
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    54   3e-07
CAGL0M08360g complement(833220..835520) some similarities with s...    54   3e-07
CAGL0K11990g complement(1155395..1158370) some similarities with...    54   3e-07
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    54   3e-07
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    54   3e-07
Scas_671.16                                                            54   4e-07
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    54   4e-07
Scas_655.2                                                             54   4e-07
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...    54   4e-07
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    52   7e-07
Kwal_33.14434                                                          53   7e-07
Kwal_27.11542                                                          53   7e-07
Kwal_14.1249                                                           52   9e-07
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    52   1e-06
Scas_584.11                                                            52   1e-06
Scas_697.12                                                            52   1e-06
Scas_601.6                                                             52   2e-06
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    52   2e-06
Kwal_27.10945                                                          52   2e-06
CAGL0J05082g 481179..483140 similar to sp|P47042 Saccharomyces c...    52   2e-06
Kwal_47.17345                                                          52   2e-06
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    51   2e-06
CAGL0K01661g complement(146952..148400) some similarities with t...    51   2e-06
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...    51   2e-06
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    50   3e-06
Scas_703.47                                                            50   3e-06
KLLA0D11044g complement(942458..944068) gi|730472|sp|P40230|RAG8...    50   4e-06
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    50   4e-06
YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...    50   4e-06
Kwal_26.8941                                                           50   5e-06
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...    50   5e-06
Kwal_55.21900                                                          50   5e-06
CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...    50   6e-06
Kwal_33.14596                                                          49   7e-06
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    49   8e-06
Kwal_33.13225                                                          50   8e-06
Scas_661.27                                                            50   8e-06
AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C (...    49   8e-06
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    49   1e-05
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...    49   1e-05
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...    49   1e-05
ABR088C [679] [Homologous to ScYKL048C (ELM1) - SH] (546324..547...    49   1e-05
AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH] complement(...    48   2e-05
Scas_458.1                                                             48   2e-05
CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces c...    48   2e-05
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    48   2e-05
Kwal_55.20221                                                          48   2e-05
CAGL0K12496g 1218391..1219473 similar to sp|P43568 Saccharomyces...    47   3e-05
Scas_721.61                                                            47   3e-05
YBR097W (VPS15) [288] chr2 (436908..441272) Serine/threonine pro...    48   3e-05
Scas_689.22                                                            47   5e-05
Scas_584.8                                                             47   6e-05
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    46   6e-05
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...    47   6e-05
Scas_707.7                                                             46   7e-05
Kwal_14.2554                                                           46   7e-05
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    46   7e-05
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    45   8e-05
Scas_692.24                                                            45   2e-04
Scas_718.12                                                            45   2e-04
KLLA0D12100g complement(1031728..1033161) some similarities with...    45   2e-04
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    45   2e-04
Kwal_56.24274                                                          44   2e-04
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    45   3e-04
CAGL0H08437g complement(825191..829423) similar to sp|P22219 Sac...    44   4e-04

>Scas_717.69
          Length = 674

 Score = 1354 bits (3505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 657/674 (97%), Positives = 657/674 (97%)

Query: 1   MNTLKKFGFGRWKTEKXXXXXXXXSGGLFHFHHEKRHSRGDLNESDDTFSDRKKTIVRSP 60
           MNTLKKFGFGRWKTEK        SGGLFHFHHEKRHSRGDLNESDDTFSDRKKTIVRSP
Sbjct: 1   MNTLKKFGFGRWKTEKEPEPNNNNSGGLFHFHHEKRHSRGDLNESDDTFSDRKKTIVRSP 60

Query: 61  SSVAPVRLXXXXXXXXXTFLNGDDDVSTGRDVHSRTMSTTSATEMSNKDIDGTAGIMTIK 120
           SSVAPVRL         TFLNGDDDVSTGRDVHSRTMSTTSATEMSNKDIDGTAGIMTIK
Sbjct: 61  SSVAPVRLSSEAASSSSTFLNGDDDVSTGRDVHSRTMSTTSATEMSNKDIDGTAGIMTIK 120

Query: 121 VYNGEGFILPVSITSNETILSRLLSSGINSAHVNLSNEVDALISRLSRMQLETSRNIQEE 180
           VYNGEGFILPVSITSNETILSRLLSSGINSAHVNLSNEVDALISRLSRMQLETSRNIQEE
Sbjct: 121 VYNGEGFILPVSITSNETILSRLLSSGINSAHVNLSNEVDALISRLSRMQLETSRNIQEE 180

Query: 181 KLINGETCTKYIPATVKLPGSNRLNPLLYFTIEFDNTVATIEPEYGLMADPVFNKISTFD 240
           KLINGETCTKYIPATVKLPGSNRLNPLLYFTIEFDNTVATIEPEYGLMADPVFNKISTFD
Sbjct: 181 KLINGETCTKYIPATVKLPGSNRLNPLLYFTIEFDNTVATIEPEYGLMADPVFNKISTFD 240

Query: 241 VTRKLPYLKIDVFARIPSILLPSKLWQQTQSEHDSRMKVILDKINSNQDVHLDSLQIPIN 300
           VTRKLPYLKIDVFARIPSILLPSKLWQQTQSEHDSRMKVILDKINSNQDVHLDSLQIPIN
Sbjct: 241 VTRKLPYLKIDVFARIPSILLPSKLWQQTQSEHDSRMKVILDKINSNQDVHLDSLQIPIN 300

Query: 301 LKFDSAANIRLYNHHWVTLENTLGRINISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVM 360
           LKFDSAANIRLYNHHWVTLENTLGRINISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVM
Sbjct: 301 LKFDSAANIRLYNHHWVTLENTLGRINISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVM 360

Query: 361 QVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYL 420
           QVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYL
Sbjct: 361 QVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYL 420

Query: 421 VLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQG 480
           VLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQG
Sbjct: 421 VLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQG 480

Query: 481 HIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGL 540
           HIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGL
Sbjct: 481 HIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGL 540

Query: 541 PPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFF 600
           PPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFF
Sbjct: 541 PPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFF 600

Query: 601 SQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVVDEYLSESVQKQFGGWT 660
           SQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVVDEYLSESVQKQFGGWT
Sbjct: 601 SQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVVDEYLSESVQKQFGGWT 660

Query: 661 YVGSEQLGTSMEPN 674
           YVGSEQLGTSMEPN
Sbjct: 661 YVGSEQLGTSMEPN 674

>Scas_721.124
          Length = 684

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/659 (74%), Positives = 555/659 (84%), Gaps = 18/659 (2%)

Query: 26  GGLFHFHHEKRHSR--GDLNESDDTFSDRKKTIVRSPSSVAPVRLXXXXXXXXXTFLNGD 83
           GG F+    K+ S        S D  SDRK+TI+ SP+++AP+R          TF NG 
Sbjct: 24  GGFFNSGDSKKESSPTSKTQSSGDYSSDRKETIINSPNTMAPMRSSYEASSSTSTFDNGS 83

Query: 84  DDVSTGRDVHSRTMSTTSATEMSNKDIDG-----------TAGIMTIKVYNGEGFILPVS 132
               T  D +S  +S  S+    ++D              ++GIMTIK+YNG+ F LP  
Sbjct: 84  ---HTSSDENSNNISHESSVSQISQDTASNDPHPQNTHISSSGIMTIKIYNGDAFTLPFP 140

Query: 133 ITSNETILSRLLSSGINSAHVNLSNEVDALISRLSRMQLETSRNIQEEKLINGETCTKYI 192
           ITSN+ ILS+LL SGI S     + +VD L+S+LSR+QL+ ++   EE L+  +  +K+I
Sbjct: 141 ITSNQQILSKLLGSGI-SPPSTATPDVDTLVSQLSRVQLQ-NQGPAEENLLASDVSSKFI 198

Query: 193 PATVKLPGSNRLNPLLYFTIEFDNTVATIEPEYGLMADPVFNKISTFDVTRKLPYLKIDV 252
           PAT+KLPGS+ LNPLLYFTIEFDNTVATIEPEYG M  PVFNKISTFDVTRKLP+LKIDV
Sbjct: 199 PATIKLPGSSVLNPLLYFTIEFDNTVATIEPEYGTMTKPVFNKISTFDVTRKLPFLKIDV 258

Query: 253 FARIPSILLPSKLWQQTQSEHDSRMKVILDKINSNQDVHLDSLQIPINLKFDSAANIRLY 312
           FARIPSILLPSK+WQQ  S +D ++K +L+KINSNQDVHLDS Q+PINLKFD+A+NIRLY
Sbjct: 259 FARIPSILLPSKMWQQEMSANDEKLKEMLEKINSNQDVHLDSFQLPINLKFDTASNIRLY 318

Query: 313 NHHWVTLENTLGRINISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYA 372
           NHHWV+LEN LGRINIS+DYKPS+NK L+IDDFDLLKVIGKGSFGKVMQVRK+DTQKIYA
Sbjct: 319 NHHWVSLENGLGRINISIDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYA 378

Query: 373 LKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFY 432
           LKAIRK+YIVSKSEVTHTLAERTVLAR++CPFIVPLKFSFQSP+KLYLVLACINGGELFY
Sbjct: 379 LKAIRKAYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSPDKLYLVLACINGGELFY 438

Query: 433 HLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKL 492
           HLQKEGRF+LSR+RFY AELLCALETLHNL+VIYRDLKPENILLDYQGHIALCDFGLCKL
Sbjct: 439 HLQKEGRFDLSRSRFYAAELLCALETLHNLNVIYRDLKPENILLDYQGHIALCDFGLCKL 498

Query: 493 NMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMY 552
           NMKD DKTDTFCGTPEYLAPELLL QGY+KVVDWWTLG+LLYEMLTGLPPYYDEDVPKMY
Sbjct: 499 NMKDDDKTDTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMY 558

Query: 553 RKILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRLWNKG 612
           +KILQDPLRFP+GFDRDAKDLLIGLLSRDP RRLGCNGA EIKNHPFFSQLSWKRL  KG
Sbjct: 559 KKILQDPLRFPDGFDRDAKDLLIGLLSRDPTRRLGCNGADEIKNHPFFSQLSWKRLLMKG 618

Query: 613 YIPPYKPPVSDAADTRNFDQEFTKEKPIDSVVDEYLSESVQKQFGGWTYVGSEQLGTSM 671
           YIPPYKPPV+ A DT NFDQEFT+EKP+DSVVDE+LSESVQKQFGGWTYVGSEQLG+SM
Sbjct: 619 YIPPYKPPVTSAIDTSNFDQEFTREKPVDSVVDEFLSESVQKQFGGWTYVGSEQLGSSM 677

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score =  949 bits (2454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/706 (68%), Positives = 545/706 (77%), Gaps = 45/706 (6%)

Query: 1   MNTLKKFGFGRWKTEKXXXXXXXXSGGLFHFHHEKRHSRGDLNESDDTFSDRKKTIVRSP 60
           M + KKF FG     K           LFHFHH  +H+  D++++    +D++K++   P
Sbjct: 1   MYSWKKFKFG-----KSKDEKEQKKDKLFHFHH--KHTGSDVSDNFGNGNDKEKSVDSLP 53

Query: 61  SSVA----PVRLXXXXXXXXXTFLNG--------------------DDDVSTGRDV---- 92
           SS      P  L         +  N                         ST +DV    
Sbjct: 54  SSSEITPYPSDLPSQNTNGNNSSRNDTMVNSNSSNRISSASSAKGPGSSSSTIKDVPLGG 113

Query: 93  -------HSRTMSTTSATEMSNKDIDGTAGIMTIKVYNGEGFILPVSITSNETILSRLLS 145
                  H   +S  SAT  + K    + G+MTIKVYNG+GF LP  ITSN+ ILSRLL 
Sbjct: 114 ENERSSSHIDQVSQKSATS-TKKTSTPSTGVMTIKVYNGDGFRLPFPITSNKKILSRLLE 172

Query: 146 SGINSAHVNLSNEVDALISRLSRMQLETSRNIQEEKLINGETCTKYIPATVKLPGSNRLN 205
           SGI S + + S EV+A++ R+SR++L  S +   E L+ G+  T+ IP+T+KLP S  LN
Sbjct: 173 SGIASDNHDTSLEVEAILQRISRLELTNSNS--NENLLPGDIATQSIPSTIKLPNSVPLN 230

Query: 206 PLLYFTIEFDNTVATIEPEYGLMADPVFNKISTFDVTRKLPYLKIDVFARIPSILLPSKL 265
           PLLYFTIEFDNTVATIEPE G MA P+FNKISTFDVTRKLP L IDVF RIPSILLP K 
Sbjct: 231 PLLYFTIEFDNTVATIEPESGTMAQPIFNKISTFDVTRKLPQLNIDVFVRIPSILLPPKQ 290

Query: 266 WQQTQSEHDSRMKVILDKINSNQDVHLDSLQIPINLKFDSAANIRLYNHHWVTLENTLGR 325
           WQQ     D +++ +LDKIN+NQDVHLDS Q+P+NL  DSAA IRLYNHHWV L + LG+
Sbjct: 291 WQQEMGAQDEKLQALLDKINTNQDVHLDSFQLPVNLLIDSAATIRLYNHHWVELRDGLGK 350

Query: 326 INISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKS 385
           INISVDYKPS+NK L+IDDFDLLKVIGKGSFGKVMQVRK+DT+KIYALKAIRKSYIVSKS
Sbjct: 351 INISVDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKS 410

Query: 386 EVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRA 445
           EVTHTLAERTVLAR++CPFIVPLKFSFQS EKLYLVLACINGGELFYHLQ+EGRF+LSR+
Sbjct: 411 EVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRS 470

Query: 446 RFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCG 505
           RFY AELLCAL+TLH +DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD+DKTDTFCG
Sbjct: 471 RFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCG 530

Query: 506 TPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEG 565
           TPEYLAPELLL QGYSKVVDWWTLG+LLYEMLTGLPPYYDE+VPKMY+KILQDPL FP+G
Sbjct: 531 TPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDG 590

Query: 566 FDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDAA 625
           FDRDAKDLLIGLLSRDP RRLG NGA EIKNHPFFSQLSWKRL  KGYIPPYKPPV+ A 
Sbjct: 591 FDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSAT 650

Query: 626 DTRNFDQEFTKEKPIDSVVDEYLSESVQKQFGGWTYVGSEQLGTSM 671
           DT NFDQEFT+EKPIDSVVDEYLSESVQKQFGGWTYVGSEQLG S+
Sbjct: 651 DTSNFDQEFTREKPIDSVVDEYLSESVQKQFGGWTYVGSEQLGNSL 696

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score =  920 bits (2378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/650 (69%), Positives = 520/650 (80%), Gaps = 28/650 (4%)

Query: 48  TFSDRKKTIVRSPSSVAPVRLXX-----------XXXXXXXTFLN-GDDDVSTGRDVHSR 95
           T  DRK+TIV + +S+APVRL                    +F + G +    G +  + 
Sbjct: 72  TSKDRKETIVATANSIAPVRLSTDVAAPGWPNEGVQSSVPSSFRDAGSETTDVGDEERAG 131

Query: 96  TMSTTSATEMSN------------KDIDGTAGIMTIKVYNGEGFILPVSITSNETILSRL 143
           T S +   E +N              +  + GIMTIKVYNG  F LP ++TSN  IL +L
Sbjct: 132 TSSGSVVPEQANHSSASVSEERGEASMVNSTGIMTIKVYNGNSFKLPFALTSNPQILGKL 191

Query: 144 LSSGINSAHVNLSNEVDALISRLSRMQLETSRNIQEEKLINGETCTKYIPATVKLPGSNR 203
           LSSG+N+      + VD LIS + ++ L       E+KL+ G+  T YIPAT+KLP S  
Sbjct: 192 LSSGVNAISRTGRSSVDELISSVEQVTLSE----DEDKLLPGDAATNYIPATIKLPDSED 247

Query: 204 LNPLLYFTIEFDNTVATIEPEYGLMADPVFNKISTFDVTRKLPYLKIDVFARIPSILLPS 263
           LNPL+Y TIEFDNTVATIEPE G +  PVFNKISTFDVTRKLPYLK++VF RIPSILLPS
Sbjct: 248 LNPLIYLTIEFDNTVATIEPECGNLKSPVFNKISTFDVTRKLPYLKVNVFVRIPSILLPS 307

Query: 264 KLWQQTQSEHDSRMKVILDKINSNQDVHLDSLQIPINLKFDSAANIRLYNHHWVTLENTL 323
           K WQQ  +  D  ++ +L K+NSN DV LDS Q+P+NL+F+SA +IRLYNH W+ +E  L
Sbjct: 308 KAWQQVYAAQDPELQDLLKKVNSNMDVQLDSFQLPLNLQFNSATSIRLYNHQWLNMEKGL 367

Query: 324 GRINISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVS 383
           GR+NI++DYKPSKNK L+IDDFDLLKVIGKGSFGKVMQV+K+DT KIYALKAIRKSYIVS
Sbjct: 368 GRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVS 427

Query: 384 KSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELS 443
           KSEVTHTLAERTVLARV+ PFIVPLKFSFQSPEKLYLVLA INGGELF+HLQKEGRF+LS
Sbjct: 428 KSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLS 487

Query: 444 RARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTF 503
           RARFYTAELLCALETLH+L+VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKT+TF
Sbjct: 488 RARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTF 547

Query: 504 CGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFP 563
           CGTPEYLAPELLL QGYSKVVDWWTLG+LLYEMLTGLPPYYDEDVPKMY+KILQ+PLRFP
Sbjct: 548 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFP 607

Query: 564 EGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSD 623
           +GFDR+AK+LLI LL RDP RRLG NGA EIK HPFFSQLSWKRLW KGYIPPYKPPV  
Sbjct: 608 DGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMS 667

Query: 624 AADTRNFDQEFTKEKPIDSVVDEYLSESVQKQFGGWTYVGSEQLGTSMEP 673
           A DT NFDQEFT+EKP+DSVV+++LSESVQ+QFGGWTYVGSEQLG+S+ P
Sbjct: 668 ALDTSNFDQEFTREKPVDSVVNDFLSESVQQQFGGWTYVGSEQLGSSIIP 717

>Kwal_26.7635
          Length = 691

 Score =  909 bits (2349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/659 (69%), Positives = 516/659 (78%), Gaps = 23/659 (3%)

Query: 31  FHHEKRHSRGDLNESDDTFSDRKKTIVRSPSSVAPVRLXXXXXXXXXTFLNGDDDVSTGR 90
           FHH+   S     E      DRK+TIV S SS+APVRL         T    D  VST R
Sbjct: 37  FHHKSHKSDSSYMEPPRESVDRKETIVASSSSIAPVRLSSEVNKFPAT----DSSVSTVR 92

Query: 91  DV---------------HSRTMSTTSATEMSNKDIDGTAGIMTIKVYNGEGFILPVSITS 135
           D                 S  M     +  S  D    +GIMTIKVY GE   LP  ITS
Sbjct: 93  DSVSTSGEYDGMYDGNGSSSVMDEAFDSNNSTTDEPNFSGIMTIKVYGGEVLRLPFPITS 152

Query: 136 NETILSRLLSSGINSAHVNLSNEVDALISRLSRMQLETSRNIQEEKLINGETCTKYIPAT 195
           N  IL +LL SG+ +   + ++  D L+S LS  QL  S    EE LI+G T T+YIPAT
Sbjct: 153 NVQILKKLLHSGVINQDTDEAS-ADELVSSLS--QLHLSDGGDEENLIDGNTATRYIPAT 209

Query: 196 VKLPGSNRLNPLLYFTIEFDNTVATIEPEYGLMADPVFNKISTFDVTRKLPYLKIDVFAR 255
           + LP S  LNPLLYFT+EFDNTVATIEPE G +++  FNKISTFDVTRKL +LKIDVFAR
Sbjct: 210 ITLPNSTDLNPLLYFTLEFDNTVATIEPESGTISNLTFNKISTFDVTRKLNFLKIDVFAR 269

Query: 256 IPSILLPSKLWQQTQSEHDSRMKVILDKINSNQDVHLDSLQIPINLKFDSAANIRLYNHH 315
           IPSILLPSK WQQ  S  D  +K ILD+IN NQD+H+DS  +P+ L FD+A++ RLYNH 
Sbjct: 270 IPSILLPSKSWQQLNSS-DPSLKDILDRINDNQDIHIDSYNLPLTLDFDTASSFRLYNHQ 328

Query: 316 WVTLENTLGRINISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKA 375
           W+ L    G++N+SVDYKP+ N+ L++DDF+LLKVIGKGSFGKVMQVRK+DT K+YALKA
Sbjct: 329 WIGLAQGNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKA 388

Query: 376 IRKSYIVSKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQ 435
           IRKSYIVSKSEV HTLAERTVLARV  PFIVPLKF+FQSP+KLY+VLA INGGELFYHLQ
Sbjct: 389 IRKSYIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQ 448

Query: 436 KEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMK 495
           +EGRF LSRAR YTAELLCALETLHNLDVIYRDLKPENILLD+QGHIALCDFGLCKLNMK
Sbjct: 449 REGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMK 508

Query: 496 DQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKI 555
            QDKT+TFCGTPEYLAPELLL QGYSKVVDWWTLG+LLYEM+TGLPPYYDEDVPKMY+KI
Sbjct: 509 GQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKI 568

Query: 556 LQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRLWNKGYIP 615
           LQ+PLRFP+GFD+DAKDLLIGLLSRDP RRLG NGA EIK+HPFFSQLSWKRLW KGYIP
Sbjct: 569 LQEPLRFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIP 628

Query: 616 PYKPPVSDAADTRNFDQEFTKEKPIDSVVDEYLSESVQKQFGGWTYVGSEQLGTSMEPN 674
           PYKPPV ++ DT NFDQEFTKE P+DSVV+++LSESVQ+QFGGWTYVGSEQLG+SM PN
Sbjct: 629 PYKPPVMNSLDTSNFDQEFTKELPVDSVVNDFLSESVQQQFGGWTYVGSEQLGSSMAPN 687

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score =  884 bits (2283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/570 (73%), Positives = 490/570 (85%), Gaps = 4/570 (0%)

Query: 105 MSNKDIDGTAGIMTIKVYNGEGFILPVSITSNETILSRLLSSGINSAHVNLSNEVDALIS 164
           + N++   + GI+T+KVY+G+ F LP+ IT NE +LS+LLSSG++       + ++ LI 
Sbjct: 146 VENENTHSSNGILTVKVYSGDSFKLPLPITYNEQVLSKLLSSGVDVTSTTQQDSLEELIQ 205

Query: 165 RLSRMQLETSRNIQEEKLINGETCTKYIPATVKLPGSNRLNPLLYFTIEFDNTVATIEPE 224
            +  + L      +E+KL++GE  + +IPA+V LPGS  LN LLYFTIEFDNT+ATIEPE
Sbjct: 206 SMHGLSLLR----EEDKLLSGEDASHFIPASVILPGSKNLNSLLYFTIEFDNTIATIEPE 261

Query: 225 YGLMADPVFNKISTFDVTRKLPYLKIDVFARIPSILLPSKLWQQTQSEHDSRMKVILDKI 284
            G +  P+FNKISTFDVTR+LP+LKIDVFARIPSILLPS+ WQ+TQ  ++  +   + KI
Sbjct: 262 SGTLNRPIFNKISTFDVTRRLPFLKIDVFARIPSILLPSQNWQETQISNNDILGDYVKKI 321

Query: 285 NSNQDVHLDSLQIPINLKFDSAANIRLYNHHWVTLENTLGRINISVDYKPSKNKRLTIDD 344
            +N D+HLDS  +P+NLK DSA+NIRLYNHHW+ LE+ +G++N+SVDYKPS +K L+IDD
Sbjct: 322 RNNSDIHLDSFHLPLNLKIDSASNIRLYNHHWIELESKMGKLNLSVDYKPSTHKHLSIDD 381

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPF 404
           FDLLKVIGKGSFGKVMQVRKRDT KIYALKAIRKSYIVSKSEVTHTLAERTVLARV+ PF
Sbjct: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 441

Query: 405 IVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDV 464
           IVPLKFSFQS EKLYLVLA INGGELFYHLQ+EGRF+LSR+RFYTAELLCALE LH+ D+
Sbjct: 442 IVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDI 501

Query: 465 IYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVV 524
           IYRDLKPENILLDYQGHIALCDFGLCKLNMKDQ+KT TFCGTPEYLAPELLL QGY+KVV
Sbjct: 502 IYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVV 561

Query: 525 DWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDR 584
           DWWTLG+LLYEMLTGLPPYYDEDVPKMY+KILQDPLRFP+ FD+DAKDLLIGLL RDP R
Sbjct: 562 DWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPKR 621

Query: 585 RLGCNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVV 644
           RLG +G+ EIK+HPFF+QLSWKRL  KGYIPPYKPPV  A DT NFDQEFT+E+P+DSVV
Sbjct: 622 RLGYHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDSVV 681

Query: 645 DEYLSESVQKQFGGWTYVGSEQLGTSMEPN 674
           +++LSESVQ+QFGGWTYVGSEQLG SM P+
Sbjct: 682 NDFLSESVQQQFGGWTYVGSEQLGQSMLPD 711

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/590 (63%), Positives = 467/590 (79%), Gaps = 16/590 (2%)

Query: 95  RTMSTTSATEMSNK-----------DIDGTAGIMTIKVYNGEGFILPVSITSNETILSRL 143
           R  S T  TE+ N            D +  +G++T+KVY+G  F +PV ITS++ IL  L
Sbjct: 117 RDSSMTDVTELLNDTAFKSTPFDRIDENMHSGLLTVKVYSGSNFTMPVPITSDQGILHNL 176

Query: 144 LSSGINS--AHVNLSNEVDALISRLSRMQLETSRNIQEEKLINGETCTKYIPATVKLPGS 201
           L+S I+S     N   E++ LI++LS++ L  +    EE+LI+    + +IPA +K+PG 
Sbjct: 177 LNSSISSLEGDNNTYAEMEQLITQLSQVHL--ANQTSEEQLISNAFSSTFIPAVIKVPGH 234

Query: 202 NRLNPLLYFTIEFDNTVATIEPEYGLMADPVFNKISTFDVTRKLPYLKIDVFARIPSILL 261
           +   PL+Y T+E+DNT+ATI PE G ++ PVFNKISTFDVTRKLP+LK  VF +IPS LL
Sbjct: 235 DDY-PLIYMTVEYDNTMATIYPEGGTISKPVFNKISTFDVTRKLPFLKCSVFIKIPSALL 293

Query: 262 PSKLWQQTQSEHDSRMKVILDKINSNQDVHLDSLQIPINLKFDSAANIRLYNHHWVTLEN 321
           PS  WQQ  +  D  M+ IL+ I++ +++ LDS  +P+ L  +SA+N RL+NH W+ L+ 
Sbjct: 294 PSMRWQQEAALADPNMRSILETIHAGKEIFLDSFTLPVVLDMNSASNFRLFNHQWINLKQ 353

Query: 322 TLGRINISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYI 381
            LG IN++VD+KPS +K + IDDF+LL V+GKGS+GKVMQVRK+DTQKIYALKAIRKSYI
Sbjct: 354 GLGTINLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYI 413

Query: 382 VSKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFE 441
           V+KSEV HTLAERT+LARV CPFIVPLKF+FQ+PEKLYLVLACINGGELF+HLQ+EG F+
Sbjct: 414 VAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFD 473

Query: 442 LSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTD 501
           +SRARFY +ELL AL++LH +DV+YRDLKPENILLD QGHIALCDFGLCKLNMKD +KT 
Sbjct: 474 ISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTS 533

Query: 502 TFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLR 561
           TFCGTPEYLAPE+LL +GY+KVVDWWTLG+LLYEMLTGLPPYYDE+V +MY+KIL+ PL 
Sbjct: 534 TFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLI 593

Query: 562 FPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPV 621
           FP+G D DAKDLL  LL+RDP+RRLG NGA EIKNH FF+ L W  +WNK Y+PP++P V
Sbjct: 594 FPDGMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDV 653

Query: 622 SDAADTRNFDQEFTKEKPIDSVVDEYLSESVQKQFGGWTYVGSEQLGTSM 671
            +A DT NFD EFTK+KP+DSV+DEYLSESVQ QF GW+Y+GSEQLG+SM
Sbjct: 654 QNANDTSNFDNEFTKQKPVDSVIDEYLSESVQNQFKGWSYLGSEQLGSSM 703

>Kwal_47.16761
          Length = 744

 Score =  359 bits (922), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/450 (43%), Positives = 278/450 (61%), Gaps = 52/450 (11%)

Query: 229 ADPVFNKISTFDVTRKLPYLKIDVFARIPSILLPSKLWQQTQSEHDSRMKVILDKINSNQ 288
           A+PV++  +TFDV      L I V+                 + HD              
Sbjct: 246 ANPVWHHQTTFDVLGAHSELDISVY----------------DAAHD-------------- 275

Query: 289 DVHLDSLQIPINLKFDSAANIRLYNHHWVTL------ENTLGRINISVDYKPSKNKRLTI 342
           D+ L  +++  NL+  S +N    +  W  L      E+  G I++  D+K +  +    
Sbjct: 276 DMFLGQVRLRPNLESFSHSN----HEQWYKLQSRIVGESVTGHISVKWDFKATMKQHYGP 331

Query: 343 DDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARV-- 400
            DF++L+++GKG+FG+V QVRK+DT++IYA+K + K  IV K+E+ HT+ ER +L R   
Sbjct: 332 QDFEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTAS 391

Query: 401 -NCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETL 459
            +CPFIV LKFSFQ+P  LYLV   ++GGELF+HLQKEGRF   RARFY AEL+ ALE L
Sbjct: 392 KSCPFIVGLKFSFQTPADLYLVTDFMSGGELFWHLQKEGRFAEDRARFYIAELVLALEYL 451

Query: 460 HNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQ- 518
           H  D++YRDLKPENILLD  G+IALCDFGL K ++K  D+T+TFCGT EYLAPELLL++ 
Sbjct: 452 HENDIVYRDLKPENILLDANGNIALCDFGLSKADLK--DRTNTFCGTTEYLAPELLLDES 509

Query: 519 GYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEG-FDRDAKDLLIGL 577
           GY+K+VD+W+LG+L++EM  G  P++ ED  KMY+KI    ++FP      + +  + GL
Sbjct: 510 GYTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGL 569

Query: 578 LSRDPDRRLGC-NGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTK 636
           L+R+P  RLG  +   E++ HPFF+++ W+ L  K   PP+KP ++   DT NFD EFT+
Sbjct: 570 LNRNPRHRLGAIDDGRELRAHPFFAEIDWEALRQKKIPPPFKPHLTGETDTSNFDPEFTQ 629

Query: 637 EKPI----DSVVDEYLSESVQKQFGGWTYV 662
                     +    LS ++Q +F G+T+V
Sbjct: 630 TSTSFMNKQGIAATPLSPAMQAKFVGFTFV 659

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score =  355 bits (910), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 176/356 (49%), Positives = 248/356 (69%), Gaps = 18/356 (5%)

Query: 320 ENTLGRINISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKS 379
           E+  G I +  +Y  ++ +     DF++L+++GKG+FG+V QVRK+DT++IYA+K + K 
Sbjct: 279 ESVSGEILVRWEYWHTEKRHYGPQDFEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKK 338

Query: 380 YIVSKSEVTHTLAERTVLARV---NCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQK 436
            IV K+E+ HT+ ER +L R    +CPFIV LKFSFQ+P  LYLV   ++GGELF+HLQK
Sbjct: 339 VIVKKNEIAHTIGERNILVRTASKSCPFIVGLKFSFQTPTDLYLVTDFLSGGELFWHLQK 398

Query: 437 EGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD 496
           EGRF   RA+FY AEL+ ALE LH+ D++YRDLKPENILLD  G+IALCDFGL K ++K 
Sbjct: 399 EGRFTEERAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK- 457

Query: 497 QDKTDTFCGTPEYLAPELLLNQ-GYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKI 555
            D+T+TFCGT EYLAPELLL++ GY+K+VD+W+LG+L++EM  G  P++ ED  KMY+KI
Sbjct: 458 -DRTNTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKI 516

Query: 556 LQDPLRFPEG-FDRDAKDLLIGLLSRDPDRRLGC-NGAHEIKNHPFFSQLSWKRLWNKGY 613
               ++FP      + +  + GLL+R+P  RLG  N   E++ HPF S + W+ L NK  
Sbjct: 517 AFGKVKFPRDVLSPEGRSFVKGLLNRNPKHRLGAVNDGAEVRAHPFLSDIDWEALRNKQI 576

Query: 614 IPPYKPPVSDAADTRNFDQEFTK-------EKPIDSVVDEYLSESVQKQFGGWTYV 662
            PP+KP ++   DT NFD EFT+       ++PI +     LS ++Q +F G+T+V
Sbjct: 577 PPPFKPHLTSETDTSNFDPEFTQTSTSFMNKQPIAATP---LSPAMQAKFAGFTFV 629

>Scas_703.5
          Length = 749

 Score =  350 bits (899), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 177/357 (49%), Positives = 244/357 (68%), Gaps = 19/357 (5%)

Query: 320 ENTLGRINISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKS 379
           EN  G I I  +Y  +K +    +DF++L+++GKG+FG+V QV+K+DT++IYA+K + K 
Sbjct: 319 ENVTGDILIKWEYSSTKKRHYGPNDFEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKK 378

Query: 380 YIVSKSEVTHTLAERTVL---ARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQK 436
            IV K+EV HT+ ER +L   A    PFIV LKFSFQ+P  LYLV   ++GGELF+HLQK
Sbjct: 379 VIVKKNEVAHTIGERNILVTTATKASPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQK 438

Query: 437 EGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD 496
           EGRF   RA+FY AEL+ ALE LH+ D++YRDLKPENILLD  G+IALCDFGL K ++K 
Sbjct: 439 EGRFTEERAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK- 497

Query: 497 QDKTDTFCGTPEYLAPELLLNQ-GYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKI 555
            D+T+TFCGT EYLAPELLL++ GY+K+VD+W+LG+L++EM  G  P++ ED  KMY+KI
Sbjct: 498 -DRTNTFCGTTEYLAPELLLDEAGYTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKI 556

Query: 556 LQDPLRFPEG-FDRDAKDLLIGLLSRDPDRRLGC-NGAHEIKNHPFFSQLSWKRLWNKGY 613
               ++FP      + +  + GLL+R+P  RLG  +   E++ HPFF+ + W  L  K  
Sbjct: 557 AFGKVKFPRDVLSPEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFADIDWDALREKKI 616

Query: 614 IPPYKPPVSDAADTRNFDQEFT--------KEKPIDSVVDEYLSESVQKQFGGWTYV 662
            PP+KP +    DT NFD EFT        K +PI +     LS ++Q +F G+T+V
Sbjct: 617 PPPFKPHLVSETDTSNFDPEFTQTSTSYMNKHQPIAATP---LSPAMQAKFAGFTFV 670

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score =  350 bits (898), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 178/369 (48%), Positives = 249/369 (67%), Gaps = 24/369 (6%)

Query: 314 HHWVTL------ENTLGRINISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDT 367
           H W +L      E   G I I   YK +K +     DF++L+++GKG+FG+V QV+K+DT
Sbjct: 375 HQWHSLKPRVIDEVVSGDILIKWTYKQTKKRHYGPQDFEVLRLLGKGTFGQVYQVKKKDT 434

Query: 368 QKIYALKAIRKSYIVSKSEVTHTLAERTVL---ARVNCPFIVPLKFSFQSPEKLYLVLAC 424
           Q+IYA+K + K  IV K+E+ HT+ ER +L   A  + PFIV LKFSFQ+P  LYLV   
Sbjct: 435 QRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTASKSSPFIVGLKFSFQTPTDLYLVTDY 494

Query: 425 INGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIAL 484
           ++GGELF+HLQKEGRF   RA+FY AEL+ ALE LH+ D++YRDLKPENILLD  G+IAL
Sbjct: 495 MSGGELFWHLQKEGRFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIAL 554

Query: 485 CDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQ-GYSKVVDWWTLGILLYEMLTGLPPY 543
           CDFGL K ++K  D+T+TFCGT EYLAPELLL++ GY+K+VD+W+LG+L++EM  G  P+
Sbjct: 555 CDFGLSKADLK--DRTNTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPF 612

Query: 544 YDEDVPKMYRKILQDPLRFPEG-FDRDAKDLLIGLLSRDPDRRLGC-NGAHEIKNHPFFS 601
           + E+  KMY+KI    ++FP     ++ +  + GLL+R+P  RLG  +   E++ HPFF+
Sbjct: 613 FAENNQKMYQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFA 672

Query: 602 QLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFT--------KEKPIDSVVDEYLSESVQ 653
            + W+ L  K   PP+KP +    DT NFD EFT        K +P+ +     LS ++Q
Sbjct: 673 DIDWEALKQKKIPPPFKPHLVSETDTSNFDPEFTTASTSYMNKHQPMMTATP--LSPAMQ 730

Query: 654 KQFGGWTYV 662
            +F G+T+V
Sbjct: 731 AKFAGFTFV 739

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score =  343 bits (881), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 172/356 (48%), Positives = 245/356 (68%), Gaps = 18/356 (5%)

Query: 320 ENTLGRINISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKS 379
           E+  G I I  +Y  +K ++    DF++L+++GKG+FG+V QVRK+DT +IYA+K + K 
Sbjct: 300 EHVTGDILIHWEYTSTKKRQYGPQDFEVLRLLGKGTFGQVYQVRKKDTMRIYAMKVLSKK 359

Query: 380 YIVSKSEVTHTLAERTVLARV---NCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQK 436
            IV K+E+ HT+ ER +L R    + PFIV LKFSFQ+P  LYLV   ++GGELF+HLQK
Sbjct: 360 VIVKKNEIAHTIGERNILVRTASKSSPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQK 419

Query: 437 EGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD 496
           EGRF   RA+FY AEL+ ALE LH+ D++YRDLKPENILLD  G+IALCDFGL K ++K 
Sbjct: 420 EGRFTEDRAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK- 478

Query: 497 QDKTDTFCGTPEYLAPELLLNQ-GYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKI 555
            D+T+TFCGT EYLAPELL+++ GY+K+VD+W+LG+L++EM  G  P++  D  KMY+KI
Sbjct: 479 -DRTNTFCGTTEYLAPELLMDETGYTKMVDFWSLGVLIFEMCCGWSPFFASDNQKMYQKI 537

Query: 556 LQDPLRFPEG-FDRDAKDLLIGLLSRDPDRRLGC-NGAHEIKNHPFFSQLSWKRLWNKGY 613
               ++FP      + +  + GLL+R+P  RLG  +   E++ HPFF+ + W+ +  K  
Sbjct: 538 AFGKVKFPRDVLSPEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFNDIDWEAVRQKKI 597

Query: 614 IPPYKPPVSDAADTRNFDQEFTK-------EKPIDSVVDEYLSESVQKQFGGWTYV 662
            PP+KP +    DT NFD EFT+       ++PI +     LS ++Q +F G+T+V
Sbjct: 598 PPPFKPHLISETDTSNFDPEFTQTSTSFMNKQPIAATP---LSPAMQAKFVGFTFV 650

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score =  341 bits (874), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 171/356 (48%), Positives = 242/356 (67%), Gaps = 17/356 (4%)

Query: 320 ENTLGRINISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKS 379
           E   G I +   Y  +K +     DF++L+++GKG+FG+V QV+K+DT++IYA+K + K 
Sbjct: 315 EKITGEILVKWHYTLTKKRHYGPQDFEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKK 374

Query: 380 YIVSKSEVTHTLAERTVLARVNC---PFIVPLKFSFQSPEKLYLVLACINGGELFYHLQK 436
            IV K+E+ HT+ ER +L   +    PFIV LKFSFQ+P  LYLV   ++GGELF+HLQ+
Sbjct: 375 VIVKKNEIAHTIGERNILVTTSSKASPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQR 434

Query: 437 EGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD 496
           EGRF   RA+FY AEL+ ALE LH+ D++YRDLKPENILLD  G+IALCDFGL K ++K 
Sbjct: 435 EGRFTEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK- 493

Query: 497 QDKTDTFCGTPEYLAPELLLNQ-GYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKI 555
            D+T+TFCGT EYLAPELLL++ GY+K+VD+W+LG+L++EM  G  P+Y ED  KMY+KI
Sbjct: 494 -DRTNTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCGWSPFYAEDNQKMYQKI 552

Query: 556 LQDPLRFPEG-FDRDAKDLLIGLLSRDPDRRLGC-NGAHEIKNHPFFSQLSWKRLWNKGY 613
               ++FP      + +  + GLL+R+P  RLG  +   E++ HPFF+ + W+ L  K  
Sbjct: 553 AFGKVKFPRDILSPEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFADIDWELLKQKKI 612

Query: 614 IPPYKPPVSDAADTRNFDQEFTKEKPIDSVVDEY-------LSESVQKQFGGWTYV 662
            PP+KP +    DT NFD EFT+     S ++++       LS  +Q +F G+T+V
Sbjct: 613 PPPFKPHLVSETDTSNFDPEFTQTS--TSYMNKHHQMAATPLSPGMQAKFAGFTFV 666

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score =  276 bits (705), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 133/296 (44%), Positives = 191/296 (64%), Gaps = 6/296 (2%)

Query: 340 LTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLAR 399
           +   +F +L+ +G GSFG+V  +R R   + YA+K ++K  +V   +V HT  ER +L+ 
Sbjct: 82  IVYKNFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSI 141

Query: 400 VNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETL 459
           V  PFI+ +  +FQ  +++++++  I GGELF  L+K  RF    A+FY AE+  ALE L
Sbjct: 142 VTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYL 201

Query: 460 HNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQG 519
           H+ D+IYRDLKPENILLD  GHI + DFG  K      D T T CGTP+Y+APE++  + 
Sbjct: 202 HSKDIIYRDLKPENILLDKNGHIKITDFGFAKYV---PDVTYTLCGTPDYIAPEVVSTKP 258

Query: 520 YSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLS 579
           Y+K +DWW+ GIL+YEML G  P+YD +  K Y KIL   LRFP  F+ D KDLL  L++
Sbjct: 259 YNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFNEDVKDLLSRLIT 318

Query: 580 RDPDRRLG--CNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDA-ADTRNFDQ 632
           RD  +RLG   NG  ++KNHP+F ++ W++L ++    PY+PP+     DT  FD+
Sbjct: 319 RDLSQRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFDK 374

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score =  276 bits (705), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 134/297 (45%), Positives = 194/297 (65%), Gaps = 6/297 (2%)

Query: 339 RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLA 398
           +  + DF +L+ +G GSFG+V  VR     + YA+K ++K+ +V   +V HT  ER +L+
Sbjct: 139 KYALYDFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQVEHTNDERNMLS 198

Query: 399 RVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALET 458
            V+ PFI+ +  +FQ  ++L++++  I GGELF  L+K  RF    A+FY AE+  ALE 
Sbjct: 199 IVSHPFIIRMWGTFQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEY 258

Query: 459 LHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQ 518
           LH+  +IYRDLKPENILLD  GHI L DFG  K      D T T CGTP+Y+APE++  +
Sbjct: 259 LHSKGIIYRDLKPENILLDKNGHIKLTDFGFAKY---VPDVTYTLCGTPDYIAPEVVSTK 315

Query: 519 GYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLL 578
            Y+K VDWW+ G+L+YEML G  P+YD +  K Y  IL  P+RFP  F  DA+DL+  L+
Sbjct: 316 PYNKSVDWWSFGVLIYEMLAGYTPFYDSNTIKTYENILNAPVRFPPFFHSDAQDLISKLI 375

Query: 579 SRDPDRRLGC--NGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPV-SDAADTRNFDQ 632
           +RD  +RLG   NG+ ++KNHP+FS++ W++L  K    PY+PP+ +   DT  +D+
Sbjct: 376 TRDLSQRLGNLQNGSEDVKNHPWFSEVVWEKLLCKNIETPYEPPIQAGQGDTSQYDR 432

>Scas_651.18
          Length = 371

 Score =  270 bits (691), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 134/297 (45%), Positives = 193/297 (64%), Gaps = 6/297 (2%)

Query: 339 RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLA 398
           + T++DF +L+ +G GSFG+V  +R     + YALK ++K  IV   +V HT  ER +L+
Sbjct: 53  KYTLNDFQILRTLGTGSFGRVHLIRSNHNGRFYALKVLKKHTIVKLKQVEHTNDERLMLS 112

Query: 399 RVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALET 458
            V+ PF+V +  +FQ  E++++++  I GGELF  L+K  RF    A+FY AE+  ALE 
Sbjct: 113 VVSHPFLVRMWGTFQDFEQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEY 172

Query: 459 LHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQ 518
           LH++D+IYRDLKPENILLD  GHI + DFG  K      D T T CGTP+Y+APE++  +
Sbjct: 173 LHSMDIIYRDLKPENILLDKNGHIKITDFGFAKYV---PDITYTLCGTPDYIAPEVVSTK 229

Query: 519 GYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLL 578
            Y+K VDWW+ GIL+YEML G  P+YD +  K Y  IL   L+FP  F  D KDLL  L+
Sbjct: 230 PYNKSVDWWSFGILIYEMLAGYTPFYDSNTMKTYENILNCKLKFPNFFHDDVKDLLSKLI 289

Query: 579 SRDPDRRLGC--NGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDA-ADTRNFDQ 632
           +++   RLG   NG+ ++K HP+FS++ W++L ++    PY+PP+     DT  FD+
Sbjct: 290 TKNLTERLGNLQNGSEDVKRHPWFSEVIWEKLLSRNIETPYEPPIQQGQGDTSQFDR 346

>Scas_689.25*
          Length = 409

 Score =  271 bits (693), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 138/297 (46%), Positives = 190/297 (63%), Gaps = 6/297 (2%)

Query: 339 RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLA 398
           + TIDDF++L+  G GSFG+V  VR     + YALK ++K  +V   +V HT  ER +L+
Sbjct: 93  KYTIDDFNILRTSGTGSFGRVHLVRSVHNGRFYALKVLKKQTVVRLKQVEHTNDERRMLS 152

Query: 399 RVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALET 458
                FIV L  +FQ  E L++++  + GGELF  L++  RF    A+FY AE+  AL+ 
Sbjct: 153 VSVHAFIVRLWGTFQDSEHLFMIMDYVEGGELFSLLRRSQRFPNPVAKFYAAEVCLALDY 212

Query: 459 LHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQ 518
           LH+LD+IYRDLKPEN+LLD  GHI + DFG  K      D T T CGTP+Y+APE++  +
Sbjct: 213 LHSLDIIYRDLKPENLLLDRNGHIKVTDFGFAKYV---PDVTYTLCGTPDYIAPEVISAK 269

Query: 519 GYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLL 578
            Y+K VDWW+ GIL+YEML+G  P+YD    K Y  IL  PL+FP+ F  DA+DLL  L+
Sbjct: 270 PYNKSVDWWSFGILIYEMLSGHTPFYDSSTMKTYENILNAPLKFPKYFTPDAQDLLSRLI 329

Query: 579 SRDPDRRLGC--NGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDA-ADTRNFDQ 632
           +RD   RLG   NG  +IKNH +FS++ W +L ++    PY+PP+     DT  FD+
Sbjct: 330 TRDLTERLGNLQNGTEDIKNHAWFSEVIWDKLLDRCIETPYEPPIQQGQGDTSQFDR 386

>Kwal_33.13846
          Length = 375

 Score =  270 bits (689), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 136/322 (42%), Positives = 200/322 (62%), Gaps = 13/322 (4%)

Query: 321 NTLGRINISVDYKPSK-------NKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYAL 373
           N+LG+  +   +  S        + + T++DF +L+ +G GSFG+V  VR     + YA+
Sbjct: 34  NSLGQQAVEAKHVQSAALHSRQTSGKYTLNDFHILRTLGTGSFGRVHLVRSNHNGRFYAM 93

Query: 374 KAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYH 433
           K ++K  IV   +V HT  ER +L+ V+ PFI+ +  +FQ  E +++++  I GGELF  
Sbjct: 94  KVLKKRTIVKLKQVEHTNDERRMLSVVSHPFIIRMWGTFQDAEHVFMIMDYIEGGELFSL 153

Query: 434 LQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLN 493
           L+K  RF    A+FY AE+  ALE LH  D+IYRDLKPEN+LLD  GH+ + DFG  K  
Sbjct: 154 LRKSQRFPNPVAKFYAAEVCLALEYLHAQDIIYRDLKPENVLLDKNGHVKITDFGFAKFV 213

Query: 494 MKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYR 553
               D T T CGTP+Y+APE++  + Y+K VDWW+ GIL++EML G  P+YD +  K Y 
Sbjct: 214 ---PDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIFEMLAGYTPFYDSNTMKTYE 270

Query: 554 KILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLGC--NGAHEIKNHPFFSQLSWKRLWNK 611
            IL   L+FP  F  D +DLL  L++RD  +RLG   NG+ ++KNH +FS++ W++L  +
Sbjct: 271 NILNAELQFPPFFHSDVQDLLSQLITRDLSKRLGNLKNGSEDVKNHAWFSEVVWEKLLCR 330

Query: 612 GYIPPYKPPV-SDAADTRNFDQ 632
               PY+PPV +   DT  +D+
Sbjct: 331 NIETPYEPPVQAGQGDTSQYDR 352

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score =  270 bits (689), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 146/369 (39%), Positives = 216/369 (58%), Gaps = 37/369 (10%)

Query: 267 QQTQSEHDSRMKVILDKINSNQDVHLDSLQIPINLKFDSAANIRLYNHHWVTLENTLGRI 326
           QQT+S H+ + +  L +   +Q   +++++ P+                 +   NT G  
Sbjct: 105 QQTESNHEQQQQQRLQQTEQHQQHQMETVKKPL-----------------IYGANTSG-- 145

Query: 327 NISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSE 386
                       + T+ DF +L+ +G GSFG+V  +R     + YALKA++K  +V   +
Sbjct: 146 ------------KYTLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKALKKHTVVKLKQ 193

Query: 387 VTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRAR 446
           V HT  ER +L+ V+ PFI+ +  +FQ  + +++V+  I GGELF  L+K  RF    A+
Sbjct: 194 VEHTNDERRMLSIVSHPFIIRMWGTFQDSQHVFMVMDYIEGGELFSLLRKSQRFPNPVAK 253

Query: 447 FYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGT 506
           FY AE+  ALE LH+ ++IYRDLKPENILLD  GHI + DFG  K      D T T CGT
Sbjct: 254 FYAAEVCLALEYLHSKEIIYRDLKPENILLDKNGHIKITDFGFAKYV---PDVTYTLCGT 310

Query: 507 PEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGF 566
           P+Y+APE++  + Y+K VDWW+ GIL+YEML G  P+YD +  K Y  IL   L+FP  F
Sbjct: 311 PDYIAPEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYDANTMKTYEHILNSELKFPSFF 370

Query: 567 DRDAKDLLIGLLSRDPDRRLGC--NGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDA 624
             D +DLL  L++RD  +RLG   NG+ ++KNHP+FS++ W++L  +    PY+PP+   
Sbjct: 371 HPDVQDLLSKLITRDLSKRLGNLQNGSEDVKNHPWFSEVVWEKLLARYIETPYEPPIQQG 430

Query: 625 -ADTRNFDQ 632
             DT  FD+
Sbjct: 431 QGDTSQFDR 439

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score =  261 bits (667), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 130/297 (43%), Positives = 189/297 (63%), Gaps = 6/297 (2%)

Query: 339 RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLA 398
           + ++ DF +++ +G GSFG+V  VR     + YA+K ++K+ +V   ++ HT  ER +L 
Sbjct: 45  KYSLQDFHIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQVVKMKQIEHTNDERRMLK 104

Query: 399 RVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALET 458
            V  PF++ +  +FQ    L++V+  I GGELF  L+K  RF    A+FY AE+  ALE 
Sbjct: 105 LVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTLALEY 164

Query: 459 LHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQ 518
           LH  ++IYRDLKPENILLD  GHI + DFG  K   + +  T T CGTP+Y+APE++  +
Sbjct: 165 LHFHNIIYRDLKPENILLDRNGHIKITDFGFAK---EVETVTWTLCGTPDYIAPEVIATK 221

Query: 519 GYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLL 578
            Y+K VDWW+LG+L+YEML G  P+YD    K Y KIL   + +P+ F+ D  DLL  LL
Sbjct: 222 PYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILHGKVVYPQFFNSDVIDLLSKLL 281

Query: 579 SRDPDRRLG--CNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPV-SDAADTRNFDQ 632
           + D  RR+G    GA +IK+HP+F+++ W++L  K    PY+PP+ +   DT  FDQ
Sbjct: 282 TADLTRRIGNLQKGAQDIKSHPWFAEVVWEKLLAKDIETPYEPPITAGVGDTSLFDQ 338

>Kwal_56.24059
          Length = 353

 Score =  261 bits (666), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 131/297 (44%), Positives = 190/297 (63%), Gaps = 6/297 (2%)

Query: 339 RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLA 398
           + +++DF +L+ +G GSFG+V  VR     + YA+K ++K  ++   ++ HT  ER +L 
Sbjct: 37  KYSLNDFQILRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTNDERRMLK 96

Query: 399 RVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALET 458
            V+ PF++ +  +FQ    L++V+  I GGELF  L+K  RF    A+FY AE++ ALE 
Sbjct: 97  LVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEY 156

Query: 459 LHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQ 518
           LH+ D+IYRDLKPENILLD  GHI + DFG  K   +    T T CGTP+Y+APE++  +
Sbjct: 157 LHSHDIIYRDLKPENILLDRNGHIKITDFGFAK---EVDTVTWTLCGTPDYIAPEVIATK 213

Query: 519 GYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLL 578
            Y+K VDWW+LGIL++EML G  P+YD    K Y KILQ  + +P  F  D  DLL  L+
Sbjct: 214 PYNKSVDWWSLGILIFEMLAGYTPFYDATPMKTYEKILQGKVAYPPFFHPDVVDLLCKLI 273

Query: 579 SRDPDRRLG--CNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPV-SDAADTRNFDQ 632
           + D  RRLG   +G  ++K+HP+FS++ W++L  K    PY+PP+ +   DT  FDQ
Sbjct: 274 TSDLTRRLGNLQSGPQDVKSHPWFSEVVWEKLLAKDIETPYEPPITAGVGDTSLFDQ 330

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score =  271 bits (694), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 138/333 (41%), Positives = 205/333 (61%), Gaps = 6/333 (1%)

Query: 335  SKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAER 394
            SK  ++++D+F LLKV+GKG+FGKV+  R ++T ++ A+K ++K  I+   ++    AE+
Sbjct: 807  SKRPKVSLDNFVLLKVLGKGNFGKVILSRSKNTNRLCAIKVLKKDNIIQNHDIESARAEK 866

Query: 395  TVL---ARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAE 451
             V     +   PF+  L  SFQ+  ++Y  +  I GG+L +H+Q + R  + RA+FY AE
Sbjct: 867  KVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYAAE 925

Query: 452  LLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLA 511
            +L AL+  H+  VIYRDLK ENILL  +GHI + D+GLCK  M   +KT TFCGTPE++A
Sbjct: 926  VLLALKFFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDGMWYGNKTSTFCGTPEFMA 985

Query: 512  PELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAK 571
            PELL  Q Y+K VDWW  G+LLY+ML    P+  +D  +++  IL D   +P     D  
Sbjct: 986  PELLREQDYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGDIV 1045

Query: 572  DLLIGLLSRDPDRRLGCN--GAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRN 629
             +  GLL++DP++RLG     A EI   PFF  +++  L N    PPY P +  A DT  
Sbjct: 1046 QIFQGLLTKDPEKRLGAGPRDALEIMEEPFFRNINFDDLLNLRIKPPYIPEIKSAEDTSY 1105

Query: 630  FDQEFTKEKPIDSVVDEYLSESVQKQFGGWTYV 662
            F+QEFT   P  + +   LS + Q++F G++Y+
Sbjct: 1106 FEQEFTSAPPSLTPLPSVLSTTQQEEFRGFSYM 1138

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score =  271 bits (692), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 132/335 (39%), Positives = 208/335 (62%), Gaps = 6/335 (1%)

Query: 333  KPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLA 392
            K  K +++++DDF LLKV+GKG+FGKV+  R ++T ++ A+K ++K +I+   ++    A
Sbjct: 810  KTPKRRKVSLDDFILLKVLGKGNFGKVLLARSKNTDRLCAIKVLKKDHIIQNHDIESARA 869

Query: 393  ERTVL---ARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYT 449
            E+ V     +   PF+  L  SFQ+  ++Y  +  I GG+L +H+Q + R  + RA+FY 
Sbjct: 870  EKKVFLLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYA 928

Query: 450  AELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEY 509
            AE+L AL+  H+  +IYRDLK ENILL  +GHI + D+GLCK  M   ++T TFCGTPE+
Sbjct: 929  AEVLLALKYFHDNGIIYRDLKLENILLTLEGHIKIADYGLCKDEMWFGNRTSTFCGTPEF 988

Query: 510  LAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRD 569
            +APE+L  Q Y+K VDWW  G+LLY+ML    P+  +D  +++  IL D   +P     D
Sbjct: 989  MAPEILREQAYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGD 1048

Query: 570  AKDLLIGLLSRDPDRRLGCNG--AHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADT 627
               +  GLL++DP++RLG     A E+   PFF  +++  + N    PPY P +  A DT
Sbjct: 1049 IVQIFQGLLTKDPEKRLGAGSRDALEVMEEPFFRNINFDDILNLRVEPPYIPTIKAADDT 1108

Query: 628  RNFDQEFTKEKPIDSVVDEYLSESVQKQFGGWTYV 662
              F++EFT   P  + +   LS ++Q++F G++++
Sbjct: 1109 SYFEKEFTAAPPTLTPLPSILSSNLQEEFRGFSFM 1143

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score =  252 bits (644), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 187/297 (62%), Gaps = 6/297 (2%)

Query: 339 RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLA 398
           + ++ DF +++ +G GSFG+V  VR     + YA+K ++K  ++   ++ HT  ER +L 
Sbjct: 30  KYSLQDFQIMRTLGTGSFGRVHLVRSIHNGRYYAIKVLKKQQVIRMKQIEHTNDERRMLK 89

Query: 399 RVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALET 458
            V  PF++ +  +FQ    L++V+  I GGELF  L+K  RF    A+FY AE+  ALE 
Sbjct: 90  VVEHPFLIRMWGTFQDARNLFIVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEY 149

Query: 459 LHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQ 518
           LH  ++IYRDLKPENILLD  GHI + DFG  K   +    T T CGTP+Y+APE++  +
Sbjct: 150 LHAHNIIYRDLKPENILLDRNGHIKITDFGFAK---EVDTVTWTLCGTPDYIAPEVITTK 206

Query: 519 GYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLL 578
            Y+K +DWW+LGIL++EML G  P+YD    K Y KIL   + FP  F  DA DLL  L+
Sbjct: 207 PYNKSIDWWSLGILIFEMLAGYTPFYDVTPIKTYEKILAGKVVFPPFFHPDAIDLLGKLI 266

Query: 579 SRDPDRRLG--CNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPV-SDAADTRNFDQ 632
           + D  RRLG   +G+ +IK+HP+FS++ W++L  K    PY+PP+ +   D+  FDQ
Sbjct: 267 TDDLTRRLGNLQSGSQDIKSHPWFSEVIWEKLLAKDIETPYEPPITAGVGDSSLFDQ 323

>Kwal_27.10581
          Length = 1154

 Score =  270 bits (689), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 133/332 (40%), Positives = 205/332 (61%), Gaps = 6/332 (1%)

Query: 336  KNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERT 395
            K +++++DDF LLKV+GKG+FGKV+    ++ +++ A+K ++K +I+   ++    AE+ 
Sbjct: 818  KRRKISLDDFVLLKVLGKGNFGKVLLAESKNNERLCAIKVLKKDHIIKNHDIESARAEKK 877

Query: 396  VL---ARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAEL 452
            V     +   PF+  L  SFQ+  ++Y  +  I GG+L +H+Q + R  + RA+FY AE+
Sbjct: 878  VFLLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYAAEV 936

Query: 453  LCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAP 512
            L AL+  H+  VIYRDLK ENILL  +GHI + D+GLCK  M   +KT TFCGTPE++AP
Sbjct: 937  LLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNKTSTFCGTPEFMAP 996

Query: 513  ELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKD 572
            E+L  Q Y+K VDWW  G+LLY+ML    P+  ED  +++  IL D   +P     D   
Sbjct: 997  EILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGEDEDEVFNAILTDEPLYPIDMAGDIVQ 1056

Query: 573  LLIGLLSRDPDRRLGCN--GAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNF 630
            +  GLL++DP+RRLG     A E+   PFF  + +  + N    PPY P +  A DT  F
Sbjct: 1057 IFQGLLTKDPERRLGAGPRDAAEVMAEPFFRNIVFDDILNLRVQPPYIPEIKAADDTSYF 1116

Query: 631  DQEFTKEKPIDSVVDEYLSESVQKQFGGWTYV 662
            ++EFT   P  + +   LS ++Q++F G++++
Sbjct: 1117 EKEFTSAPPTLTPLPSVLSSNLQEEFRGFSFM 1148

>Scas_715.34
          Length = 1150

 Score =  268 bits (686), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 132/333 (39%), Positives = 205/333 (61%), Gaps = 6/333 (1%)

Query: 335  SKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAER 394
            SK +++++D+F LLKV+GKG+FGKV+  R ++T ++ A+K ++K  I+   ++    AE+
Sbjct: 813  SKRRKVSLDNFILLKVLGKGNFGKVILSRSKNTGRLCAIKVLKKDNIIQNHDIESARAEK 872

Query: 395  TVL---ARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAE 451
             V     +   PF+  L  SFQ+  ++Y  +  I GG+L +H+Q + R  + RA+FY AE
Sbjct: 873  KVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYAAE 931

Query: 452  LLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLA 511
            +L AL+  H+  VIYRDLK ENILL  QGHI + D+GLCK  M   +KT TFCGTPE++A
Sbjct: 932  VLLALKYFHDNGVIYRDLKLENILLTPQGHIKIADYGLCKDEMWYNNKTSTFCGTPEFMA 991

Query: 512  PELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAK 571
            PE+L  QGY++ VDWW  G+LLY+ML    P+  +D  +++  IL D   +P     D  
Sbjct: 992  PEILKEQGYTRAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGDIV 1051

Query: 572  DLLIGLLSRDPDRRLGCN--GAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRN 629
             +  GLL++DP+ RLG     A E+   PFF  ++++ + N    PPY P +    DT  
Sbjct: 1052 QIFQGLLTKDPENRLGAGQRDALEVMEEPFFRNINFEDILNLRVQPPYVPEIKSPEDTSY 1111

Query: 630  FDQEFTKEKPIDSVVDEYLSESVQKQFGGWTYV 662
            F+ EFT   P  + +   L+ + Q++F G++++
Sbjct: 1112 FEHEFTSAPPTLTPLPSILTTTQQEEFRGFSFM 1144

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score =  251 bits (642), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 130/297 (43%), Positives = 190/297 (63%), Gaps = 6/297 (2%)

Query: 339 RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLA 398
           + T+ DF +L+ +G GSFG+V  VR     + YA+K ++K  +V   +V HT  ER +L+
Sbjct: 70  KYTLYDFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKHVVVKLKQVEHTNDERKMLS 129

Query: 399 RVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALET 458
            V+ PFI+ +  +FQ   ++++++  I GGELF  L+K  RF    A+FY AE+  ALE 
Sbjct: 130 VVSHPFIIRMWGTFQDAHQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEY 189

Query: 459 LHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQ 518
           LH+ D+IYRDLKPENILLD  GHI L DFG  K      D T T CGTP+Y+APE++  +
Sbjct: 190 LHSKDIIYRDLKPENILLDKNGHIKLTDFGFAKYV---PDVTYTLCGTPDYIAPEVVSTK 246

Query: 519 GYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLL 578
            Y+K VDWW+ GIL+YEML G  P+YD++    Y  IL   ++FP  F+   +DLL  L+
Sbjct: 247 PYNKSVDWWSFGILIYEMLAGYTPFYDQNTMGTYENILNAEVKFPPFFNAKVRDLLSQLI 306

Query: 579 SRDPDRRLGC--NGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPV-SDAADTRNFDQ 632
           +RD  +RLG   NG+ ++K HP+FS++ W +L  +    PY+PP+ +   DT  +D+
Sbjct: 307 TRDLSKRLGNLQNGSQDVKAHPWFSEVIWDKLLCRNIETPYEPPIHAGQGDTSQYDR 363

>Scas_690.13
          Length = 354

 Score =  250 bits (639), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 128/297 (43%), Positives = 185/297 (62%), Gaps = 6/297 (2%)

Query: 339 RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLA 398
           + T+ DF +++ +G GSFG+V  VR     + YA+K ++K  +V   ++ HT  ER +L 
Sbjct: 38  KYTLHDFQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVRMKQIEHTNDERRMLK 97

Query: 399 RVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALET 458
            V  PF++ +  +FQ    L++V+  I GGELF  L+K  RF    A+FY AE+   LE 
Sbjct: 98  LVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLGLEY 157

Query: 459 LHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQ 518
           LH+ ++IYRDLKPENILLD  GHI + DFG  K   +    T T CG P+Y+APE++  +
Sbjct: 158 LHSHNIIYRDLKPENILLDRNGHIKITDFGFAK---EVDTVTWTLCGPPDYIAPEVIATK 214

Query: 519 GYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLL 578
            Y+K VDWW+LG+L++EML G  P+YD    K Y KILQ  + +P  F  D  DLL  L+
Sbjct: 215 PYNKSVDWWSLGVLIFEMLAGYTPFYDTTPMKTYEKILQGKVVYPTFFHPDVVDLLGKLI 274

Query: 579 SRDPDRRLG--CNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDA-ADTRNFDQ 632
           + D  RR+G   +G+ +IK HP+FS++ W++L  K    PY+PP++    DT  FDQ
Sbjct: 275 TADLTRRIGNLQSGSKDIKCHPWFSEVVWEKLLAKDIETPYEPPITTGIGDTSLFDQ 331

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score =  267 bits (683), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 135/328 (41%), Positives = 202/328 (61%), Gaps = 6/328 (1%)

Query: 340  LTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVL-- 397
            +++DDF LLKV+GKG+FGKV+  R ++T  + A+K ++K  I+   ++    AE+ V   
Sbjct: 829  VSLDDFILLKVLGKGNFGKVLLARSKNTSNLCAIKVLKKDNIIKNHDIESARAEKKVFLL 888

Query: 398  -ARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCAL 456
                  PF+  L  SFQ+  ++Y  +  I GG+L +H+Q   R  + RA+FY AE+L +L
Sbjct: 889  ATETKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNR-RLSVRRAKFYAAEVLLSL 947

Query: 457  ETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLL 516
            +  H+  VIYRDLK ENILL  +GHI + D+GLCK NM   +KT TFCGTPE++APE+L 
Sbjct: 948  KYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDNMWYGNKTSTFCGTPEFMAPEILK 1007

Query: 517  NQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIG 576
             Q Y+K VDWWT G+LLY+ML    P+  ED  +++  IL D   +P     D   +  G
Sbjct: 1008 GQAYTKAVDWWTFGVLLYQMLLCQSPFSGEDEDEVFNAILTDEPLYPIDMAGDIVQIFQG 1067

Query: 577  LLSRDPDRRLGCN--GAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEF 634
            LL++DP++RLG     A EI   PFFS +++  + N    PP+ P +  A DT  F++EF
Sbjct: 1068 LLTKDPEKRLGAGPKDALEIMAEPFFSNINFDDILNLRVEPPFVPEIKAADDTSYFEKEF 1127

Query: 635  TKEKPIDSVVDEYLSESVQKQFGGWTYV 662
            T   P  + +   LS  +Q++F G++++
Sbjct: 1128 TSAPPTLTPLPSVLSSVLQEEFRGFSFM 1155

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score =  251 bits (640), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 186/297 (62%), Gaps = 6/297 (2%)

Query: 339 RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLA 398
           + T+ DF +++ +G GSFG+V  VR     + YA+K ++K  I+   ++ HT  ER +L 
Sbjct: 56  KYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIIRMKQIEHTNDERRMLK 115

Query: 399 RVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALET 458
            V  PF++ +  +FQ    L++V+  I GGELF  L+K  RF    A+FY AE+  ALE 
Sbjct: 116 LVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEY 175

Query: 459 LHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQ 518
           LH+ ++IYRDLKPENILLD  GHI + DFG  K  +     T T CGTP+Y+APE++  +
Sbjct: 176 LHSHNIIYRDLKPENILLDRNGHIKITDFGFAKEVIT---VTWTLCGTPDYIAPEVITTK 232

Query: 519 GYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLL 578
            Y+K VDWW+LGIL++EML G  P+YD    K Y KIL   + +P  F  D  DLL  L+
Sbjct: 233 PYNKSVDWWSLGILIFEMLAGYTPFYDVTPMKTYEKILAGEVVYPPFFHPDVVDLLGKLI 292

Query: 579 SRDPDRRLG--CNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVS-DAADTRNFDQ 632
           + D  RRLG   +G  +IK+HP+F+++ W++L  K    PY+PP++    D+  FDQ
Sbjct: 293 TADLTRRLGNLQSGPDDIKSHPWFAEVIWEKLVAKDIETPYEPPIAVGVGDSSLFDQ 349

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score =  263 bits (673), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 129/335 (38%), Positives = 206/335 (61%), Gaps = 6/335 (1%)

Query: 333  KPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLA 392
            + +K +++++D+F LLKV+GKG+FGKV+  + ++T ++ A+K ++K  I+   ++    A
Sbjct: 812  RAAKRRKVSLDNFVLLKVLGKGNFGKVILSKSKNTDRLCAIKVLKKDNIIQNHDIESARA 871

Query: 393  ERTVL---ARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYT 449
            E+ V     +   PF+  L  SFQ+  ++Y  +  I GG+L +H+Q + R  + RA+FY 
Sbjct: 872  EKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYA 930

Query: 450  AELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEY 509
            AE+L AL+  H+  VIYRDLK ENILL  +GHI + D+GLCK  M   ++T TFCGTPE+
Sbjct: 931  AEVLLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNRTSTFCGTPEF 990

Query: 510  LAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRD 569
            +APE+L  Q Y+K VDWW  G+LLY+ML    P+  +D  +++  IL D   +P     +
Sbjct: 991  MAPEILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGE 1050

Query: 570  AKDLLIGLLSRDPDRRLGCN--GAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADT 627
               +  GLL++DP++RLG     A E+   PFF  +++  + N    PPY P +    DT
Sbjct: 1051 IVQIFQGLLTKDPEKRLGAGPRDADEVMEEPFFRNINFDDILNLRVKPPYIPEIKSPEDT 1110

Query: 628  RNFDQEFTKEKPIDSVVDEYLSESVQKQFGGWTYV 662
              F+QEFT   P  + +   L+ S Q++F G++++
Sbjct: 1111 SYFEQEFTSAPPTLTPLPSVLTTSQQEEFRGFSFM 1145

>YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine
           protein kinase with unknown role [2163 bp, 720 aa]
          Length = 720

 Score =  222 bits (566), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 179/302 (59%), Gaps = 25/302 (8%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPF 404
           F+ ++++G+G  GKV  +R+RDT +I+ALK + K  ++ + ++   L E+ +LA  + PF
Sbjct: 324 FEKIRLLGQGDVGKVYLMRERDTNQIFALKVLNKHEMIKRKKIKRVLTEQEILATSDHPF 383

Query: 405 IVPLKFSFQSPEKLYLVLACINGGELFYHLQ--KEGRFELSRARFYTAELLCALETLHNL 462
           IV L  SFQ+ + LYL +    GGE F  LQ  K        A+FY +E++ ALE LH L
Sbjct: 384 IVTLYHSFQTKDYLYLCMEYCMGGEFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLL 443

Query: 463 DVIYRDLKPENILLDYQGHIALCDFGLC-------KLNMKDQD-----------KTDTFC 504
             IYRDLKPENILL   GH+ L DF L        K  MKD             +T++F 
Sbjct: 444 GFIYRDLKPENILLHQSGHVMLSDFDLSIQATGSKKPTMKDSTYLDTKICSDGFRTNSFV 503

Query: 505 GTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFP- 563
           GT EYLAPE++   G++  VDWWTLGIL+YEML G  P+  ++  + +  IL   ++FP 
Sbjct: 504 GTEEYLAPEVIRGNGHTAAVDWWTLGILIYEMLFGCTPFKGDNSNETFSNILTKDVKFPH 563

Query: 564 -EGFDRDAKDLLIGLLSRDPDRRLGC-NGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPV 621
            +   ++ KDL+  LL+++  +RLG  +GA +IK HPFF ++ W  L N+   PP  P +
Sbjct: 564 DKEVSKNCKDLIKKLLNKNEAKRLGSKSGAADIKRHPFFKKVQWSFLRNQD--PPLIPAL 621

Query: 622 SD 623
           +D
Sbjct: 622 ND 623

>CAGL0J06072g complement(572377..574698) similar to sp|P53894
           Saccharomyces cerevisiae YNL161w CBK1, hypothetical
           start
          Length = 773

 Score =  222 bits (565), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 131/350 (37%), Positives = 187/350 (53%), Gaps = 65/350 (18%)

Query: 343 DDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNC 402
           +DF  ++VIGKG+FG+V  V+K+DT KIYA+K + KS +  K ++ H  AER VLA  + 
Sbjct: 368 EDFHTVQVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGTDS 427

Query: 403 PFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNL 462
           P+IV L +SFQ  + LYL++  + GG+L   L +   F     RFY AE + A+ET+H L
Sbjct: 428 PWIVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHKL 487

Query: 463 DVIYRDLKPENILLDYQGHIALCDFGLC-------------------------------- 490
             I+RD+KP+NIL+D +GHI L DFGL                                 
Sbjct: 488 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKLLQQDEATTKNGAPNDAG 547

Query: 491 --------------KLNMKDQDKTDTF-----------CGTPEYLAPELLLNQGYSKVVD 525
                          L M ++ +  T+            GTP+Y+APE+ L QGY +  D
Sbjct: 548 DGSNNRQTMIVDSINLTMSNRQQIQTWRKSRRLMAYSTVGTPDYIAPEIFLYQGYGQDCD 607

Query: 526 WWTLGILLYEMLTGLPPYYDEDVPKMYRKIL--QDPLRFPEG--FDRDAKDLLIGLLSRD 581
           WW+LG ++YE L G PP+  E   + YRKI+  +  L+FPE      +A+DL+  LL+  
Sbjct: 608 WWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQFPEDVHISYEAEDLIRRLLTHS 667

Query: 582 PDRRLG-CNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNF 630
            ++RLG   GA EIK+HPFF  + W  +  +    PY P +S   DTR F
Sbjct: 668 -NQRLGRQGGADEIKSHPFFRGVDWNTI--RQVEAPYIPKLSSITDTRFF 714

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score =  223 bits (567), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 173/302 (57%), Gaps = 30/302 (9%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPF 404
           F+ ++++G+G  GKV  V+++ T ++YALK   KS ++ + ++   LAE+ +LA  N PF
Sbjct: 497 FEKIRLLGQGDVGKVYLVKEKRTNRLYALKIFSKSEMIKRKKIKRILAEQEILATSNHPF 556

Query: 405 IVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSR--ARFYTAELLCALETLHNL 462
           +V L  SFQS + LYL +    GGE F  LQ      +S   A+FY +E+  ALE LH L
Sbjct: 557 VVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKSKCISEEDAKFYASEVTAALEYLHLL 616

Query: 463 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQD----------------------KT 500
             IYRDLKPENILL   GHI L DF L  +  KD                        +T
Sbjct: 617 GFIYRDLKPENILLHQSGHIMLSDFDLS-IQAKDAKVPVVKGNAQSTVVDTKICSDGFRT 675

Query: 501 DTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPL 560
           ++F GT EY+APE++   G++  VDWWTLGIL+YEML G  P+  E+  + +  IL+  +
Sbjct: 676 NSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGENTNETFSNILKKDV 735

Query: 561 RFPEG--FDRDAKDLLIGLLSRDPDRRLGCN-GAHEIKNHPFFSQLSWKRLWNKGYIPPY 617
            FP      R+ KDL+  LL ++  +RLG   GA +IK HPFF +++W  L N+   PP 
Sbjct: 736 TFPNNNEVSRNCKDLIKKLLIKNESKRLGSKMGAADIKKHPFFKKVNWTLLRNQE--PPL 793

Query: 618 KP 619
            P
Sbjct: 794 IP 795

>Kwal_23.6458
          Length = 868

 Score =  222 bits (566), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 123/302 (40%), Positives = 173/302 (57%), Gaps = 30/302 (9%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPF 404
           F+ +K++G+G  GKV  V+++ T ++YALK   K  ++ + ++   LAE+ +LA  N PF
Sbjct: 464 FEKIKLLGQGDVGKVYLVKEKKTNRLYALKIFSKEEMIKRKKIKRILAEQEILATSNHPF 523

Query: 405 IVPLKFSFQSPEKLYLVLACINGGELFYHLQ--KEGRFELSRARFYTAELLCALETLHNL 462
           IV L  SFQS + LYL +    GGE F  LQ  K    +   ARFY++E++ A+E LH +
Sbjct: 524 IVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCIDEDDARFYSSEVVAAIEYLHLM 583

Query: 463 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQD----------------------KT 500
             IYRDLKPENILL   GHI L DF L  +  KD                        +T
Sbjct: 584 GFIYRDLKPENILLHKSGHIMLSDFDLS-VQAKDTKNPVVKGSAQSSLLDTKICSDGFRT 642

Query: 501 DTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPL 560
           ++F GT EY+APE++   G++  VDWWTLGIL+YEML G  PY  ++  K +  +L++ +
Sbjct: 643 NSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPYKGDNTNKTFSNVLKNEV 702

Query: 561 RFPEG--FDRDAKDLLIGLLSRDPDRRLGCN-GAHEIKNHPFFSQLSWKRLWNKGYIPPY 617
            FP      R+ KDL+  LL +   RRLG   GA +IK HPFF ++ W  L N+   PP 
Sbjct: 703 SFPNNNEVSRNCKDLIRKLLIKSETRRLGSKFGASDIKKHPFFKKVQWSLLRNQE--PPL 760

Query: 618 KP 619
            P
Sbjct: 761 IP 762

>Scas_629.16
          Length = 918

 Score =  221 bits (562), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 124/306 (40%), Positives = 174/306 (56%), Gaps = 30/306 (9%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPF 404
           F+ +K++G+G  GKV  VR++ T ++YALK   KS ++ + ++   LAE+ +LA  N PF
Sbjct: 519 FEKIKLLGQGDVGKVYLVREKKTNRLYALKIFSKSEMIKRKKIKRILAEQEILATSNHPF 578

Query: 405 IVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSR--ARFYTAELLCALETLHNL 462
           +V L  SFQS + LY  +    GGE F  LQ      +S   ARFY +E+  ALE LH L
Sbjct: 579 VVTLYHSFQSEDYLYFCMEYCMGGEFFRALQTRRTKCISEDDARFYASEVTAALEYLHLL 638

Query: 463 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQD----------------------KT 500
             IYRDLKPENILL   GHI L DF L  +  KD                        +T
Sbjct: 639 GFIYRDLKPENILLHKSGHIMLSDFDLS-VQAKDAKVPVMKGSAESTVVDTKICSDGFRT 697

Query: 501 DTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPL 560
           ++F GT EY+APE++   G++  VDWWTLGIL+YEML G  P+      + +  IL++ +
Sbjct: 698 NSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGSSSNETFSNILKNDV 757

Query: 561 RFPEGFD--RDAKDLLIGLLSRDPDRRLGCN-GAHEIKNHPFFSQLSWKRLWNKGYIPPY 617
            FP   D  R+ KDL+  LL ++  +RLG   GA ++K HPFF ++ W  L N+   PP 
Sbjct: 758 SFPNNNDISRNCKDLIKKLLCKNEAKRLGSKMGAADVKRHPFFKKVQWSFLRNQE--PPL 815

Query: 618 KPPVSD 623
            P +S+
Sbjct: 816 IPILSE 821

>Kwal_56.22788
          Length = 515

 Score =  212 bits (540), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 130/391 (33%), Positives = 202/391 (51%), Gaps = 62/391 (15%)

Query: 336 KNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIV---SKSE------ 386
           K+   T++DF  ++V+G+G++GKV+ V+   T ++YA+K ++K+ I+     SE      
Sbjct: 116 KHGTRTLEDFAPVRVLGRGAYGKVLLVKDSHTSRLYAMKQLKKAEILIHDGSSEEGQPDS 175

Query: 387 -----VTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFE 441
                +  T AERT+L+++  P IV L +SF    KLYL+L  I GGELFYHL+++G  +
Sbjct: 176 NLEKRLERTFAERTILSQLEHPNIVKLFYSFHDHHKLYLILQFIPGGELFYHLKEQGTLD 235

Query: 442 LSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQD--- 498
                FY AE+ CAL  LH   V+YRDLKPEN LLD +GH+ L DFGL K++  D     
Sbjct: 236 EDTVAFYAAEISCALRFLHKRGVVYRDLKPENCLLDERGHLVLTDFGLSKVSASDDSADG 295

Query: 499 --------KTDTFC------GTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYY 544
                   + ++ C      GTPEY APE+L  + Y++  DW++LG L+++ML G PPY 
Sbjct: 296 GDVNTNGHEGESVCTLHSIIGTPEYCAPEILEGKPYTQNCDWYSLGCLIFDMLIGKPPYT 355

Query: 545 DEDVPKMYRKILQDPL-RFPEGFDRDAKDLLIGLLSRDPDRR------------------ 585
             +   +  KIL+D + + P       KD L  LL +D  +R                  
Sbjct: 356 GVNHKVILNKILKDKIPKIPSYLSEGMKDFLAALLKKDVTKRWDVDKFWNTDGPKLKKKK 415

Query: 586 LGCNGAHEIKNHPFFSQLSWKRL----WNKGYIPPYKPPVSDAADTRNFDQEFT------ 635
            G       + H  F ++SW ++      +    P  P ++D     NFD EFT      
Sbjct: 416 AGQAKTTSFQAHFVFRKISWLKMETGELQRNTEGPILPIITDWELAENFDSEFTEMRLDS 475

Query: 636 --KEKPIDSVVDEYLSESVQKQFGGWTYVGS 664
             +++P +  ++ +     +  F G++YV S
Sbjct: 476 EAQDQPANLQINGFSRSGDKDVFKGFSYVAS 506

>ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) -
           SH] complement(994583..997204) [2622 bp, 873 aa]
          Length = 873

 Score =  215 bits (547), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 122/305 (40%), Positives = 174/305 (57%), Gaps = 28/305 (9%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPF 404
           F+ ++++G+G  GKV  VR++ + ++YALK   K+ ++ + ++   LAE+ +LA  N PF
Sbjct: 461 FEKIRLLGQGDVGKVYLVREKKSDRLYALKIFGKAEMIKRKKIKRILAEQEILATSNHPF 520

Query: 405 IVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSR--ARFYTAELLCALETLHNL 462
           IV L  SFQ+ + LYL +    GGE F  LQ      +S   ARFY +E+  ALE LH +
Sbjct: 521 IVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARFYASEVTAALEYLHLM 580

Query: 463 DVIYRDLKPENILLDYQGHIALCDFGLC-----------KLNMK----------DQDKTD 501
             IYRDLKPENILL   GH+ L DF L            K N +          D  +T+
Sbjct: 581 GFIYRDLKPENILLHQSGHVMLSDFDLSVQAKGTRNPQVKGNAQSSLVDTKVCSDGFRTN 640

Query: 502 TFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLR 561
           +F GT EY+APE++   G++  VDWWTLGIL YEML G  P+  ++  + +  IL++ + 
Sbjct: 641 SFVGTEEYIAPEVIRGNGHTASVDWWTLGILTYEMLFGFTPFKGDNTNQTFSNILKNDVY 700

Query: 562 FPEGFD--RDAKDLLIGLLSRDPDRRLGCN-GAHEIKNHPFFSQLSWKRLWNKGYIPPYK 618
           FP   D  R  KDL+  LL +   +RLG   GA EIK HPFF  + W  L N+   PP  
Sbjct: 701 FPNNNDISRTCKDLIKKLLVKKESKRLGSKFGASEIKKHPFFKTVQWALLRNQE--PPLI 758

Query: 619 PPVSD 623
           P +++
Sbjct: 759 PVLTE 763

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score =  209 bits (533), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 126/351 (35%), Positives = 190/351 (54%), Gaps = 47/351 (13%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIV-------------SKSEVT 388
           +DDF  ++ +G+G++GKV+ V+   + K+YA+K ++K+ I+              +  + 
Sbjct: 167 LDDFVPIRCLGEGAYGKVLLVKDSLSSKLYAMKQLKKAEILISEDSIEKDANTTVEKRIE 226

Query: 389 HTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFY 448
            T AERT+L+++  P IV L +SF    KLYLVL  I GGELFYHL+++G  +     FY
Sbjct: 227 RTFAERTILSQLEHPNIVKLFYSFHDNHKLYLVLQYIPGGELFYHLKEQGTLDEGTVAFY 286

Query: 449 TAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTD------- 501
            AEL CAL+ LH+  ++YRDLKPEN LL+ +GH+ L DFGL K ++ D   T        
Sbjct: 287 AAELSCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSVFDDAATPEEGENVN 346

Query: 502 ---TFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQD 558
              +  GTPEY APE+L  + Y++  DW++LG L+Y+ML G PP+   +   +  KI Q+
Sbjct: 347 QLYSIIGTPEYCAPEILAGEPYTQNCDWYSLGCLVYDMLIGKPPFTGVNHKIILNKIKQE 406

Query: 559 P--LRFPEGFDRDAKDLLIGLLSRDPDRRLGCN---------------GAHEIKN---HP 598
               R P       KD L  LL +DP +R   +               G  +  N   H 
Sbjct: 407 KTGARIPSYLSDGFKDYLGALLRKDPTKRWDVDKYWAQDGPKTKKKKAGQAKTTNYIGHF 466

Query: 599 FFSQLSWKRLWN----KGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVVD 645
            F ++ WK+L +    K  + P  P ++D     NFD EFT+++   S+ D
Sbjct: 467 IFRKIIWKQLLSGDLQKISVGPILPIITDWELAENFDTEFTEKRLDTSIYD 517

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score =  209 bits (531), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 135/392 (34%), Positives = 199/392 (50%), Gaps = 67/392 (17%)

Query: 311 LYNHHWVTLENTLGRINISVDYK------------PSKNKRLT---IDDFDLLKVIGKGS 355
           LYN   V+      R  +SVD +            PS  KR T   ++DF  ++V+G+G+
Sbjct: 97  LYNKFAVSTPPNTTRFPVSVDAEAFLDPTLPEGMSPSFQKRQTPRKLEDFKPVRVLGRGA 156

Query: 356 FGKVMQVRKRDTQKIYALKAIRKSYIVSKS--------------------EVTHTLAERT 395
           +GKV+ V+ + T K++A+K ++K+ IV  +                     V  T AERT
Sbjct: 157 YGKVLLVKDQLTSKLFAMKQLKKAEIVVTAPEEESTDGEDAVLLPAVVEKRVERTFAERT 216

Query: 396 VLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCA 455
           +L+++  P IV L +SF    KLYLVL  I GGELFYHL+++G  +     FY AE+ CA
Sbjct: 217 ILSQLEHPNIVKLFYSFHDHHKLYLVLQYIPGGELFYHLKEQGTLDEVTVSFYAAEISCA 276

Query: 456 LETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQD---------KTDTFCGT 506
           L+ LH+  ++YRDLKPEN LLD +GH+ L DFGL K  +   D         +  +  GT
Sbjct: 277 LKFLHSKGIVYRDLKPENCLLDDKGHLVLTDFGLSKRGVNQADSPLGGEQVEELYSIIGT 336

Query: 507 PEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDP-LRFPEG 565
           PEY APE+L  Q Y++  DW++LG L Y+ML G PP+   +   +  KI QD  ++ P  
Sbjct: 337 PEYCAPEILCGQPYTQNCDWYSLGSLTYDMLIGKPPFTGANHKVILSKIKQDKGIKIPHY 396

Query: 566 FDRDAKDLLIGLLSRDPDRRLGCNGAHE------------------IKNHPFFSQLSWKR 607
                KD L  LL +D  +R   +   +                   ++H  F +++WK 
Sbjct: 397 LSDGMKDYLNALLKKDIGKRWDVDRFWDKEGTKTKKKKAGQAKTSCYQSHFIFRKINWKL 456

Query: 608 LWN----KGYIPPYKPPVSDAADTRNFDQEFT 635
           + N    +    P  P ++D     NFD EFT
Sbjct: 457 MENGDLQRTTYGPIIPVITDWELAENFDSEFT 488

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score =  207 bits (528), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 131/363 (36%), Positives = 185/363 (50%), Gaps = 73/363 (20%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIV-------SKSE-------- 386
           + DF  ++V+G+G++GKV+ V+  +T K+YA+K +RK+ I+       SK E        
Sbjct: 125 LHDFKPVRVLGQGAYGKVLLVKDVNTSKLYAMKQLRKAEILISQTATDSKREDEDKNDGN 184

Query: 387 -----------VTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQ 435
                      +  T AER++L+ +  P IV L +SF    KLYL+L  I GGELFYHL+
Sbjct: 185 NNDNDDGLSKRLERTFAERSILSEIEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFYHLK 244

Query: 436 KEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMK 495
           + G  + +   FY AE+ CAL  LH   V+YRDLKPEN LL+ +GH+ L DFGL K +  
Sbjct: 245 EHGTLDETTVSFYAAEISCALRFLHTKGVVYRDLKPENCLLNQRGHLVLTDFGLSKKSAN 304

Query: 496 DQ--DKTD--------TFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYD 545
           D   D+ D        +  GTPEY APE+LL + YS+  DW++LG LLY+ML G PPY  
Sbjct: 305 DSAVDEEDPENVNALYSIIGTPEYCAPEILLGKAYSQNCDWYSLGCLLYDMLVGKPPYTG 364

Query: 546 EDVPKMYRKILQD------PLRFPEGFDRDAKDLLIGLLSRDPDRRLGCN------GAHE 593
            +   +  KI Q+      P    EG     KD+L  LL ++  +R   +      GA+ 
Sbjct: 365 SNHKVIINKIQQNKQGPKIPFYLSEGM----KDILNALLKKETAKRWNVDKYWAKTGANN 420

Query: 594 -----------------IKNHPFFSQLSWKRL----WNKGYIPPYKPPVSDAADTRNFDQ 632
                               H  F ++ WK L      K  + P  P ++D     NFD 
Sbjct: 421 KPTKSKKKKSGAARTSLFTEHFIFRKIDWKLLESGQLQKTTLGPIVPVITDLELAENFDT 480

Query: 633 EFT 635
           EFT
Sbjct: 481 EFT 483

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score =  212 bits (540), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 170/302 (56%), Gaps = 30/302 (9%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPF 404
           F+ ++++G+G  G+V  VR++ T ++YALK   K  ++ + ++   L E+ +LA  N PF
Sbjct: 379 FEKIRLLGQGDVGRVYLVREKQTNRLYALKIFSKPEMIKRKKIKRILTEQEILATSNHPF 438

Query: 405 IVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSR--ARFYTAELLCALETLHNL 462
           IV L  SFQ+ + LYL +    GGE F  LQ      +S   ARFY++E+  ALE LH +
Sbjct: 439 IVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARFYSSEVTAALEYLHLM 498

Query: 463 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQD----------------------KT 500
             IYRDLKPENILL   GHI L DF L  +  KD                        +T
Sbjct: 499 GFIYRDLKPENILLHQSGHIMLSDFDLS-VQAKDTKNPQVKGNASHSLVDTKICSDGFRT 557

Query: 501 DTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPL 560
           ++F GT EY+APE++   G++  VDWWTLGIL+YEML G  P+  ++  + +  IL++ +
Sbjct: 558 NSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGDNTNQTFSNILKNEV 617

Query: 561 RFPEGFD--RDAKDLLIGLLSRDPDRRLGCN-GAHEIKNHPFFSQLSWKRLWNKGYIPPY 617
             P   +  R  KDL+  LL ++ ++RLG   GA +IK HPFF    W  L N+   PP 
Sbjct: 618 VIPNNNETSRACKDLIRKLLIKNENKRLGSKLGASDIKKHPFFKNDQWSLLRNQE--PPL 675

Query: 618 KP 619
            P
Sbjct: 676 IP 677

>Scas_720.103
          Length = 804

 Score =  212 bits (539), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 126/357 (35%), Positives = 186/357 (52%), Gaps = 50/357 (14%)

Query: 313 NHHWVTLENTLGRINISVDYKPSKNKRL--------------TIDDFDLLKVIGKGSFGK 358
           NH    ++ +  +   S+D +P +++RL                  F+ +K++G+G  GK
Sbjct: 359 NHTQSEVQISKDKRTYSIDSEPKRSQRLRNKSFGNKFQDIKVNPQSFEKIKLLGQGDVGK 418

Query: 359 VMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKL 418
           V  V+++ T  +YA+K   K  ++ + ++   + E+ +LA  N PFIV L  SFQ+ + L
Sbjct: 419 VFLVKEKKTNGLYAMKIYNKKDMIKREKIKRVITEQEILATSNHPFIVTLYHSFQTEDYL 478

Query: 419 YLVLACINGGELFYHLQKEGRFELSR--ARFYTAELLCALETLHNLDVIYRDLKPENILL 476
           YL +    GGE F  LQ      +    ARFY +E+L ALE LH L  IYRDLKPENILL
Sbjct: 479 YLCMEYCMGGEFFRALQTRDSKCICEDDARFYASEVLAALEYLHLLGFIYRDLKPENILL 538

Query: 477 DYQGHIALCDFGLCKLNMKDQD----------------------------KTDTFCGTPE 508
              GHI L DF L  ++ KD                              +T++F GT E
Sbjct: 539 HKSGHIMLSDFDLS-VHAKDSKNPIFMKDGILPTTNSNLIVDTKICSEGFRTNSFVGTEE 597

Query: 509 YLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFD- 567
           Y+APE++   G++  VDWWTLGIL++EML G  P+  +   + +  IL     FP   D 
Sbjct: 598 YIAPEVIRGNGHTVAVDWWTLGILIFEMLFGKTPFKGDTTNETFANILSKDFEFPNSNDI 657

Query: 568 -RDAKDLLIGLLSRDPDRRLGCN-GAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVS 622
            R+ K+L+  LL+++  +RLG   GA EIK H FF  ++W  L N+   PP  P +S
Sbjct: 658 TRNCKNLIKKLLTKNETKRLGSKMGAAEIKKHSFFKNVNWNMLRNEE--PPLIPELS 712

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score =  203 bits (516), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 127/364 (34%), Positives = 180/364 (49%), Gaps = 70/364 (19%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIV------------------- 382
           I DF  ++V+G+G++GKV+ V+ + T K+YA+K ++K+ I+                   
Sbjct: 142 ISDFKPIRVLGQGAYGKVILVKDKQTSKLYAMKQLKKAEILIAPTDANTESMDKLAELDK 201

Query: 383 ---SKSE-----VTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHL 434
              S+ E     +  T AERT+L+++  P IV L +SF    KLYL+L  I GGELF+HL
Sbjct: 202 PVDSEDEKLSKRIERTFAERTILSQLEHPNIVKLFYSFHDTSKLYLLLQYIPGGELFFHL 261

Query: 435 QKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 494
           ++ G  E     FY AE+ CAL+ LH+  V+YRDLKPEN LL+  GH+ L DFGL K + 
Sbjct: 262 KEHGTLEEDTVAFYAAEISCALKFLHSKGVVYRDLKPENCLLNQNGHLVLTDFGLSKSSA 321

Query: 495 KDQDKTD--------------TFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGL 540
            +  + D              +  GTPEY APE+LL Q Y+   DW++LG LLY+MLTG 
Sbjct: 322 SNASQEDLGAGNEGEDVNELHSIIGTPEYCAPEILLGQPYTANCDWYSLGCLLYDMLTGK 381

Query: 541 PPYYDEDVPKMYRKILQDPL--RFPEGFDRDAKDLLIGLLSRDPDRRLGCNG-------- 590
           PPY   +   +  KI  D    + P       KD+L  LL  DP +R   +         
Sbjct: 382 PPYTGANHKVIANKIKNDKQGPKIPYYLSDGMKDVLGALLKSDPKKRWDVDKYWSEPKKD 441

Query: 591 ---------------AHEIKNHPFFSQLSWKRL----WNKGYIPPYKPPVSDAADTRNFD 631
                              ++H  F ++ WK L           P  P ++D     NFD
Sbjct: 442 NSQKKGQKKKKSKERTSPFQSHFVFRKVDWKGLSSGELQNTTFGPIVPVITDWELAENFD 501

Query: 632 QEFT 635
            EFT
Sbjct: 502 SEFT 505

>Scas_593.14d
          Length = 495

 Score =  192 bits (487), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 166/292 (56%), Gaps = 36/292 (12%)

Query: 341 TIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIV------SKSE-------- 386
           T+ DF  ++V+G+G++GKV+ V+ + T K+YA+K ++K+ I+      S  E        
Sbjct: 132 TVKDFRPVRVLGQGAYGKVILVKDKLTNKLYAMKQLKKAEILITESPKSNEEDDVNLGKR 191

Query: 387 VTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRAR 446
           +  T AE+++LA +  P IV L +SF    KLYL+L  I GGELF+HL+++G  +     
Sbjct: 192 IERTFAEKSILAELEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFFHLKEQGTLDEDTVA 251

Query: 447 FYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCK--------------- 491
           FY AE+ CAL+ LH+  ++YRDLKPEN LL+ +GH+ L DFGL K               
Sbjct: 252 FYAAEISCALKFLHDKGIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVTQNSANPSEVTS 311

Query: 492 LNMKDQDKT--DTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVP 549
           LN   +D +   +  GTPEY APE+L    Y+K  DW++LG L+Y+ML+G PPY   +  
Sbjct: 312 LNEPSEDLSTLHSIIGTPEYCAPEILQGLPYNKNCDWYSLGCLIYDMLSGKPPYTGANHK 371

Query: 550 KMYRKILQDPL--RFPEGFDRDAKDLLIGLLSRDPDRRLGCN---GAHEIKN 596
            +  KI +D    + P       KD+L  LL +D  +R   +    A  IKN
Sbjct: 372 VILNKIQKDKQGPKIPYYLSEGMKDMLNWLLKKDQSKRWDVDKYWAAEPIKN 423

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score =  176 bits (447), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/280 (35%), Positives = 159/280 (56%), Gaps = 7/280 (2%)

Query: 321 NTLGRINISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSY 380
           N+LGR ++    K + N +L++ DF++ + +GKG FGKV  VR + +  I ALKAI K+ 
Sbjct: 79  NSLGRNSLE---KSTYNNKLSLKDFEVGRKLGKGKFGKVYCVRHKKSGFICALKAIEKNE 135

Query: 381 IVSKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRF 440
           I+  + +     E  +   ++ P I+ L   F   +++YL++     GEL+  L+  G F
Sbjct: 136 ILQFNLLKQLKREVDIQLGMDHPNIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGPF 195

Query: 441 ELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKT 500
               A  Y  ++  AL  +H   +I+RD+KPEN+L+ +   + L DFG   LN  +  K 
Sbjct: 196 NDVLASHYIYQIADALHYMHKKRIIHRDVKPENVLIGFDNVVKLADFGWSILN-PEGSKR 254

Query: 501 DTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPL 560
            T CGT +YL+PE++  + Y + VD W LG+L YE++ G+PP+ +      Y++IL+  L
Sbjct: 255 KTLCGTIDYLSPEMITPREYDEQVDVWALGVLAYELVVGVPPFEENSKELTYKRILKCDL 314

Query: 561 RFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFF 600
            FPE   +DAKDL+  LL  D  +RL   G   +K HP+ 
Sbjct: 315 NFPESISKDAKDLISKLLVTDTTQRLSLTG---VKTHPWI 351

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score =  170 bits (431), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 98/276 (35%), Positives = 161/276 (58%), Gaps = 8/276 (2%)

Query: 336 KNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERT 395
           K + +T+ DF++ K++GKG FGKV  V+ R+T  I ALKA+ K  IV  +       E  
Sbjct: 91  KFENMTLQDFEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQYTIQKQFRREVE 150

Query: 396 VLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCA 455
           +        +  L   F   +++YL++  +  GEL+  L+  G    + A ++  ++  A
Sbjct: 151 IQGSFKHKNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETLASYFVYQMANA 210

Query: 456 LETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELL 515
           L+ +H+ ++++RD+KPENIL+ +   I L DFG    N +D  K  T CGT +YL+PEL+
Sbjct: 211 LDYMHSKNILHRDIKPENILIGFNNTIKLTDFGWSVYN-EDGQKRKTLCGTIDYLSPELI 269

Query: 516 LNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKM-YRKILQDPLRFPEGFDRDAKDLL 574
            ++ Y+  VD W LG+L YE+L G PP ++ED  +M YR+IL+  L+FP      A+DL+
Sbjct: 270 KSREYNNKVDVWALGVLTYELLVGSPP-FEEDTKEMTYRRILRCDLKFPLNVSPQARDLI 328

Query: 575 IGLLSRDPDRRLGCNGAHEIKNHPFFS--QLSWKRL 608
           + LL  +P +R+  +   E+K+H + +  + SW  L
Sbjct: 329 VRLLQFEPSKRIPLS---EVKSHAWIANNRGSWTDL 361

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score =  169 bits (428), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 93/268 (34%), Positives = 153/268 (57%), Gaps = 4/268 (1%)

Query: 335 SKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAER 394
           SK + L + DF++ KV+GKG FG+V  VR  ++  + ALKA+ K  I+  +       E 
Sbjct: 99  SKLQNLKLADFEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKKDIIQYNIEKQFRREV 158

Query: 395 TVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLC 454
            + + +  P +  L   F   +++YL++  +  GEL+ HL+    F    A +Y  ++  
Sbjct: 159 EIQSSLRHPNLTQLYGYFHDEKRVYLLMEYLVNGELYKHLKGRSHFNDVVASYYVYQMAD 218

Query: 455 ALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPEL 514
           AL+ +H  ++++RD+KPENI++ +   I L DFG   +  K   K  T CGT +YL+PEL
Sbjct: 219 ALDYMHERNILHRDIKPENIIIGFNNTIKLTDFGWSVITPKG-SKRKTLCGTVDYLSPEL 277

Query: 515 LLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLL 574
           + ++ Y++ VD W LG+L YE+L G PP+ +E     Y++IL+  L FP+  D +A+ L+
Sbjct: 278 IRSREYNEKVDVWALGVLTYELLVGSPPFEEESKELTYKRILKRNLIFPDHVDTEARHLI 337

Query: 575 IGLLSRDPDRRLGCNGAHEIKNHPFFSQ 602
             LL  DP  R+      E+K HP+  +
Sbjct: 338 SRLLEYDPGDRIPLK---EVKKHPWIEK 362

>Kwal_23.3992
          Length = 571

 Score =  170 bits (431), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 107/350 (30%), Positives = 166/350 (47%), Gaps = 54/350 (15%)

Query: 344 DFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCP 403
           DF+++  +G+G +G+V   RKRDT++I ALK + K  ++  +E  H L ER +L      
Sbjct: 175 DFEMITQVGQGGYGQVYLARKRDTREICALKILNKKLLIKLNETNHVLTERDILTTTRSE 234

Query: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463
           ++V L ++FQ P  LYL +  + GG+    L      +   ARFY +E+ CA++ LH L 
Sbjct: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294

Query: 464 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 490
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354

Query: 491 -------KLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPY 543
                   L   D +   +  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 414

Query: 544 YDEDVPKMYR--KILQDPLRFPE------GFDRDAKDLLIGLLSRDPDRRLGCNGAHEIK 595
                 + Y   +  +  LR P        F     DL+I L++ DP  RL       +K
Sbjct: 415 SGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIA-DPISRL--RSFEHVK 471

Query: 596 NHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVVD 645
              +F+++S++ L N    PP+ P + +  D   FD +FT E  +    D
Sbjct: 472 KMKYFAEISFENLRNVS--PPFIPQLDNETDAGYFD-DFTSEADMAKYAD 518

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score =  171 bits (434), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 100/298 (33%), Positives = 161/298 (54%), Gaps = 21/298 (7%)

Query: 339 RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLA 398
           ++ I DF   + +G GS+  V+    RD+ K YA+K + K Y++ + +V +   E+  L 
Sbjct: 119 KMGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTVEKLALQ 178

Query: 399 RVN-CPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALE 457
           ++N    I  L F+FQ    LY +L     G+    ++K G    + AR+Y ++++ A++
Sbjct: 179 KLNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYYASQIIDAVD 238

Query: 458 TLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKL------NMKDQD-------KTDTFC 504
           +LHN+ +I+RD+KPENILLD    + L DFG  K+      N  D         K+ +F 
Sbjct: 239 SLHNIGIIHRDIKPENILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFV 298

Query: 505 GTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPE 564
           GT EY++PELL +       D W  G +LY+ML G PP+   +    ++K+++    F  
Sbjct: 299 GTAEYVSPELLNDNYTDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTA 358

Query: 565 GFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWK--RLW--NKGYIPPYK 618
           GF +  KDL+  LL RDP+ RL      +IK H FF +++++   +W  N   I PYK
Sbjct: 359 GFPQIVKDLVKKLLVRDPNDRLTIK---QIKAHLFFHEVNFEDGSVWDDNPPEIQPYK 413

>CAGL0B04147g 402798..404498 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase related to DBF20P or sp|P32328 Saccharomyces
           cerevisiae YPR111w DBF20 cell cycle protein kinase
           related to DBF2P, hypothetical start
          Length = 566

 Score =  167 bits (422), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 106/351 (30%), Positives = 162/351 (46%), Gaps = 56/351 (15%)

Query: 344 DFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCP 403
           DF+++  +G+G +G+V   RKRDT+++ ALK + K  +V  +E  H L ER +L      
Sbjct: 170 DFEMITQVGQGGYGQVYLARKRDTKEVCALKILNKKLLVKLNETNHILTERDILTTTRSE 229

Query: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463
           ++V L ++FQ PE LYL +  + GG+    L          ARFY +E+ CA+  LH L 
Sbjct: 230 WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289

Query: 464 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 490
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349

Query: 491 -------KLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPY 543
                   L   D +  ++  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPF 409

Query: 544 YDEDVPKMYRKI--LQDPLRFPEGFDRDAKDL-------LIGLLSRDPDRRLGCNGAHEI 594
                 + Y  +   +  LR P  F  D +         LI  L  DP  RL       +
Sbjct: 410 SGSSTNETYENLRHWKRTLRRP--FLNDGRSAISDRAWELITRLIADPINRL--RSFEHV 465

Query: 595 KNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVVD 645
           K   +F ++++  L  +   PP+ P + +  D   FD +FT E  +    D
Sbjct: 466 KRMNYFHEINFDTL--RQLSPPFTPQLDNETDAGYFD-DFTNEADMAKYAD 513

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score =  168 bits (425), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 152/286 (53%), Gaps = 17/286 (5%)

Query: 337 NKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERT- 395
           +++ T  DF   + +G GS+  V +   R T +++A+K   K +I+S+++V +   E+  
Sbjct: 2   SRKRTPQDFSFKERLGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTIEKNT 61

Query: 396 --VLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELL 453
             +LA  N P I+ L ++F   E LY VL    GGEL   LQ +GRF  +  + +  +L+
Sbjct: 62  LNLLAHGNHPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGRFNEAWTKHFMCQLI 121

Query: 454 CALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQD---KTDTFCGTPEYL 510
            ALE +H   V++RDLKPEN+LL  +G + + DFG+   N+   D    T +F GT EY+
Sbjct: 122 DALEYIHGCKVVHRDLKPENLLLSSEGKLMITDFGVAS-NLAATDNLSSTSSFVGTAEYV 180

Query: 511 APELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDA 570
           +PELLL    +   D W +G +LY+   G PP+  E+    + KI+     +     +  
Sbjct: 181 SPELLLQNKSNFCSDIWAVGCMLYQFTQGTPPFRGENELAAFEKIVNLDYHWIYMVSQHI 240

Query: 571 KDLLIGLLSRDPDRRLGCNGAHEIKNHPFFS-------QLSWKRLW 609
            DL+  +L  DPD R       +IKNH +F        +L WK +W
Sbjct: 241 TDLVSKILVLDPDSRYTL---PQIKNHAWFQGIDWTNKELIWKGIW 283

>Scas_705.23
          Length = 553

 Score =  165 bits (418), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 117/396 (29%), Positives = 178/396 (44%), Gaps = 80/396 (20%)

Query: 344 DFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCP 403
           DF+++  +G+G +G+V   RKRDT+++ ALK + K  +   +E  H L ER +L      
Sbjct: 157 DFEMITQVGQGGYGQVYLARKRDTKEVCALKILNKKLLFKLNETNHVLTERDILTTTRSD 216

Query: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRF-ELSRARFYTAELLCALETLHNL 462
           ++V L ++FQ  E LYL +  + GG+ F  L    RF   + ARFY +E+ CA+  LH L
Sbjct: 217 WLVKLLYAFQDTESLYLAMEFVPGGD-FRTLLINTRFLRNTHARFYISEMFCAVNALHEL 275

Query: 463 DVIYRDLKPENILLDYQGHIALCDFGLCK------------------------------- 491
              +RDLKPEN L+D +GHI L DFGL                                 
Sbjct: 276 GYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSI 335

Query: 492 ---------LNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPP 542
                    L   + +  ++  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P
Sbjct: 336 EDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTP 395

Query: 543 YYDEDVPKMYRKI--LQDPLRFP------EGFDRDAKDLLIGLLSRDPDRRLGCNGAHEI 594
           +      + Y  +   +  LR P        F     D++  L++ DP  RL       I
Sbjct: 396 FSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIA-DPINRL--RSFEHI 452

Query: 595 KNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPI-------------- 640
           K  P+F+++++  L  +   PP+ P +    D   FD +FT E  +              
Sbjct: 453 KRMPYFAEVNFNTL--RQSAPPFTPQLDSETDAGYFD-DFTNEADMAKYADVFKRQNKLS 509

Query: 641 ----DSVVDEYL------SESVQKQFGGWTYVGSEQ 666
               DS VD  L        + QK   G  Y GSE 
Sbjct: 510 SMVDDSAVDSKLVGFTFRHRNGQKGLSGILYNGSEH 545

>YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine
           protein kinase related to Dbf20p, required for events in
           anaphase/telophase, component of the CCR4-NOT
           transcriptional complex [1719 bp, 572 aa]
          Length = 572

 Score =  164 bits (414), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 103/352 (29%), Positives = 167/352 (47%), Gaps = 54/352 (15%)

Query: 344 DFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCP 403
           DF+++  +G+G +G+V   RK+DT+++ ALK + K  +   +E  H L ER +L      
Sbjct: 176 DFEMITQVGQGGYGQVYLARKKDTKEVCALKILNKKLLFKLNETKHVLTERDILTTTRSE 235

Query: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463
           ++V L ++FQ  + LYL +  + GG+    L      +   ARFY +E+ CA+  LH+L 
Sbjct: 236 WLVKLLYAFQDLQSLYLAMEFVPGGDFRTLLINTRCLKSGHARFYISEMFCAVNALHDLG 295

Query: 464 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 490
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 296 YTHRDLKPENFLIDAKGHIKLTDFGLAAGTISNERIESMKIRLEKIKDLEFPAFTEKSIE 355

Query: 491 -------KLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPY 543
                  +L  K+ +  ++  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 356 DRRKMYNQLREKEINYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPF 415

Query: 544 YDEDVPKMYRKI--LQDPLRFPEGFDRDAK------DLLIGLLSRDPDRRLGCNGAHEIK 595
                 + Y  +   +  LR P   D  A       DL+  L++ DP  RL       +K
Sbjct: 416 SGSSTNETYDNLRRWKQTLRRPRQSDGRAAFSDRTWDLITRLIA-DPINRL--RSFEHVK 472

Query: 596 NHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVVDEY 647
              +F+ +++  L  +  IPP+ P +    D   FD +FT E  +    D +
Sbjct: 473 RMSYFADINFSTL--RSMIPPFTPQLDSETDAGYFD-DFTSEADMAKYADVF 521

>Kwal_56.24091
          Length = 381

 Score =  159 bits (401), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 155/269 (57%), Gaps = 4/269 (1%)

Query: 334 PSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAE 393
           P   + +++DDF++ K +GKG FGKV  V+ + T  I ALKA++KS IV  +       E
Sbjct: 112 PVHYQDISLDDFEVGKKLGKGKFGKVYCVKHKRTGFICALKAMKKSEIVQYNVQKQFRRE 171

Query: 394 RTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELL 453
             + + +  P +  L   F   +++YL++  +  GEL+ HL+  G F    A  +  ++ 
Sbjct: 172 VEIQSSLKHPNLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDITASHFVHQMA 231

Query: 454 CALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPE 513
            AL  +H+ ++++RD+KPENILL +Q  + L DFG    N+ +  K  T CGT +YL+PE
Sbjct: 232 DALNYMHSKNILHRDIKPENILLGFQNTLKLTDFGWSVSNVGN-SKRKTLCGTMDYLSPE 290

Query: 514 LLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDL 573
           L+ ++ Y   VD W LG+L YE+L G PP+ ++     Y++I++  LRFP+     A+DL
Sbjct: 291 LIKSREYDNKVDVWALGVLTYELLVGSPPFEEDTKELTYKRIIKRDLRFPDQVSPHARDL 350

Query: 574 LIGLLSRDPDRRLGCNGAHEIKNHPFFSQ 602
           +  LL  DP  R+      ++K HP+  +
Sbjct: 351 ISRLLEYDPQNRIPLK---DVKRHPWIKK 376

>CAGL0G03047g 282299..283918 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase or sp|P32328 Saccharomyces cerevisiae YPR111w
           DBF20, hypothetical start
          Length = 539

 Score =  162 bits (409), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 106/351 (30%), Positives = 161/351 (45%), Gaps = 54/351 (15%)

Query: 343 DDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNC 402
           +DF++L  +G+G +G+V   RKRDT+++ ALK + K  +   +E  H L ER +L     
Sbjct: 142 NDFEMLTQVGQGGYGQVYLARKRDTKEVCALKILNKKLLHRLNETNHVLTERDILTTTRS 201

Query: 403 PFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNL 462
            ++V L ++FQ    LYL +  + GG+    L      + + ARFY +E+ CA+  LH L
Sbjct: 202 EWLVKLLYAFQDSSSLYLAMEFVPGGDFRTLLINTKYLKSTHARFYISEMFCAVNALHEL 261

Query: 463 DVIYRDLKPENILLDYQGHIALCDFGLCK------------------------------- 491
              +RDLKPEN L+D +GHI L DFGL                                 
Sbjct: 262 GYTHRDLKPENFLIDAKGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTERPI 321

Query: 492 ---------LNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPP 542
                    L   D +  ++  G+P+Y+A E+L  + Y   VD+W+LG +L+E L    P
Sbjct: 322 EDRRKMYHDLRDTDINYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVSFTP 381

Query: 543 YYDEDVPKMY------RKILQDPLRFPEG--FDRDAKDLLIGLLSRDPDRRLGCNGAHEI 594
           +      + Y      RK L+ P R   G     D     I  L  DP  RL       +
Sbjct: 382 FSGATTNETYENLRHWRKTLRRP-RLGNGRYAVSDRTWAFITSLIADPINRL--KSFEHV 438

Query: 595 KNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVVD 645
           K  P+FS++ + +L  +   PP+ P +    D   FD +FT E  +    D
Sbjct: 439 KRMPYFSEIDFSKL--REMSPPFIPQLDSEVDAGYFD-DFTNEADMAKYAD 486

>Kwal_56.22693
          Length = 984

 Score =  164 bits (414), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 92/290 (31%), Positives = 158/290 (54%), Gaps = 16/290 (5%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVN 401
           I DF   +V+G GS+  VM  R  D+ K YA+K + K Y++ + +V +   E+  L R+N
Sbjct: 155 IKDFRFGEVLGDGSYSTVMLARSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLN 214

Query: 402 -CPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLH 460
               ++ L F+FQ    LY +L     G+    ++K G      A +Y+A++L A++ LH
Sbjct: 215 DGRGVIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKFGSLSQECAVYYSAQILDAIDYLH 274

Query: 461 NLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQ--------DKTDTFCGTPEYLAP 512
           +  +++RD+KPENILLD    + L DFG  ++  KD+        +++ +F GT EY++P
Sbjct: 275 HKGIVHRDIKPENILLDKDMKVKLTDFGTARILEKDETTQTFNLLERSKSFVGTAEYVSP 334

Query: 513 ELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKD 572
           ELL +       D W  G +L++M+ G PP+   +    ++K+++    F  GF    +D
Sbjct: 335 ELLNDNYVDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLVIRD 394

Query: 573 LLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWK--RLWNKG--YIPPYK 618
           L+  +L + P++RL    A +IK H FF  +++    +W+     + PYK
Sbjct: 395 LIKKILVKSPEQRL---DASQIKKHHFFKDVNFNDGSVWDSDPPELAPYK 441

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score =  163 bits (413), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 93/291 (31%), Positives = 159/291 (54%), Gaps = 17/291 (5%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARV- 400
           I+DF   + +G GS+  V+     ++ K YA+K + K Y++ + +V +   E+  L R+ 
Sbjct: 152 INDFKFGETLGDGSYSTVLLATSIESNKKYAVKILNKEYLIKQKKVKYVNIEKNTLQRLK 211

Query: 401 NCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLH 460
           N   I+ L F+FQ    LY +L     G+L   ++K G       ++Y A+++ AL  +H
Sbjct: 212 NTKGIISLYFTFQDESSLYFLLEYAPNGDLLSLMRKHGSVNEKCTQYYAAQIIDALGFMH 271

Query: 461 NLDVIYRDLKPENILLDYQGHIALCDFGLCKL--NMKDQD-------KTDTFCGTPEYLA 511
           +  VI+RDLKPENILLD    + L DFG  +L  +  + D       ++++F GT EY++
Sbjct: 272 DKGVIHRDLKPENILLDVDMKVKLTDFGTARLLDSTSEDDLKYDLLTRSNSFVGTAEYVS 331

Query: 512 PELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAK 571
           PELL +       D W  G +L++M+ G PP+   +    ++K+++    F  GF    +
Sbjct: 332 PELLNDNYVDFRCDIWAFGCILFQMIAGKPPFKANNEYLTFQKVMKVQFAFTAGFPMTVR 391

Query: 572 DLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKR--LWNKG--YIPPYK 618
           DL+  +L ++P+RRL  N   +IK H FF+ +++    +W+K    + PYK
Sbjct: 392 DLVKNILIKNPERRLLIN---QIKAHQFFADVNFGNGSVWDKDPPELGPYK 439

>KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1
           Kluyveromyces lactis DBF2, start by similarity
          Length = 567

 Score =  158 bits (400), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 104/354 (29%), Positives = 167/354 (47%), Gaps = 58/354 (16%)

Query: 344 DFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCP 403
           DF+++  +G+G +G+V   RK+DT++I ALK + K  ++      H L ER +L      
Sbjct: 171 DFEMITQVGQGGYGQVYLARKKDTKEICALKILNKKLLMKLEGTDHVLTERDILTTTRSE 230

Query: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463
           ++V L ++FQ P+ LYL +  + GG+    L      +   ARFY +E+ CA+  LH L 
Sbjct: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290

Query: 464 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 490
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350

Query: 491 -------KLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPY 543
                  KL  ++     +  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 410

Query: 544 YDEDVPKMY------RKILQDPL----RFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHE 593
                 + Y      + +LQ P     R+   F     +L+  L++ DP  RL       
Sbjct: 411 SGNSTNETYENLRNWKHVLQRPKCDNGRY--AFSDRTWELITRLIA-DPINRL--KSFEH 465

Query: 594 IKNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVVDEY 647
           +K   +FS++ +  L  +   PP+ P + +  D   FD +FT E+ +   VD +
Sbjct: 466 VKRMRYFSEIDFNTL--RTIHPPFIPQLDNEEDVGYFD-DFTNEEHMARYVDVF 516

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score =  160 bits (404), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 99/295 (33%), Positives = 156/295 (52%), Gaps = 27/295 (9%)

Query: 337 NKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERT- 395
           +KR +  DF   + +G GS+  V +V +R +Q  YA+K   K +I+ +++V +   E+  
Sbjct: 2   SKRKSPHDFLFREELGHGSYSTVYRVVERSSQHQYAIKICSKRHIIGENKVKYVTIEKNT 61

Query: 396 --VLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELL 453
             +L + N P I+ L ++F   E LY V+    GGEL   L+++  F  + AR Y  +L+
Sbjct: 62  LNLLGQANHPGIIKLYYTFHDQENLYFVMDLAPGGELLQLLRRQRVFSEAWARHYMCQLV 121

Query: 454 CALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKL-----NMKDQDKTDT-FCGTP 507
             +E +H++ VI+RDLKPEN+LLD +G + + DFG            D DK  T F GT 
Sbjct: 122 DTVEYIHSMGVIHRDLKPENVLLDKEGRLMIADFGAAYTVGQSDAGSDGDKPATSFVGTA 181

Query: 508 EYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKI--LQDPLRFPEG 565
           EY++PELLL        D W LG +LY+ L G PP+  ++  + + +I  L    R P  
Sbjct: 182 EYVSPELLLENKSYYSSDVWALGCMLYQFLQGTPPFRGQNEMETFEQIVNLDYTWRIP-- 239

Query: 566 FDRDAKDLLIGLLSR----DPDRRLGCNGAHEIKNHPFFSQLSW---KRLWNKGY 613
               A  L  GL+S+    DP +R       +IK H +FS + W   +++W   +
Sbjct: 240 ----ANPLAAGLVSKILVLDPSQRYTL---EQIKKHKWFSGVDWNNKEKIWRGSW 287

>Scas_627.7
          Length = 349

 Score =  152 bits (383), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 97/270 (35%), Positives = 152/270 (56%), Gaps = 5/270 (1%)

Query: 335 SKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAER 394
           S  K L++DDF++ K +GKG FGKV  VR ++T  I ALK + K+ IV  +       E 
Sbjct: 81  SPPKPLSLDDFEIGKKLGKGKFGKVYCVRHKETGFICALKVMDKAEIVQYNLQKQFRREV 140

Query: 395 TVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLC 454
            +   +N P +  L   F   +++YL++  +  GEL+  L+  G F    A  +  ++  
Sbjct: 141 EIQTSLNHPNLTKLYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRFVFQIAD 200

Query: 455 ALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPEL 514
           AL  LH+  +I+RDLKPENIL+ +   I L DFG   +N +   K  T CGT +YL+PE+
Sbjct: 201 ALNYLHDKQIIHRDLKPENILIGFNNVIKLTDFGWSIINPRGV-KRKTLCGTIDYLSPEM 259

Query: 515 LLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLL 574
           + ++ Y   VD W LG+L YE++ G PP+ ++     Y++IL++ ++FPE    D KDL+
Sbjct: 260 IRSREYDDKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFPETVSHDVKDLI 319

Query: 575 IGLLSRDPDRRLGCNGAHE----IKNHPFF 600
             LL  +P  R+      +    I+N PF+
Sbjct: 320 SKLLKYNPSERISMRDVMKHPWIIRNKPFW 349

>ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W
           (DBF20) - SH] complement(764718..766451) [1734 bp, 577
           aa]
          Length = 577

 Score =  156 bits (395), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 100/350 (28%), Positives = 163/350 (46%), Gaps = 54/350 (15%)

Query: 344 DFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCP 403
           DF+++  +G+G +G+V   RK+DT++I ALK + K+ +   +   H L ER +L      
Sbjct: 181 DFEIITQVGQGGYGQVYLARKKDTKEICALKILNKNLLAKLNGTDHVLTERDILTTTRSE 240

Query: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463
           ++V L ++FQ P  LYL +  + GG+    L      +   ARFY +E+ CA++ LH L 
Sbjct: 241 WLVKLLYAFQDPHSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHKLG 300

Query: 464 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 490
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 301 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMRIRLEEVKNLEFPEFKETSMD 360

Query: 491 -------KLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPY 543
                  ++  K+ +   +  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 361 YRRKMYHRVREKELNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 420

Query: 544 YDEDVPKMYRKI--LQDPLRFPE------GFDRDAKDLLIGLLSRDPDRRLGCNGAHEIK 595
                 + Y  +   +  LR P        F     +L+  L++ DP  RL       +K
Sbjct: 421 SGSSSNETYENLRRWKQVLRRPRCENGRPAFSDRTWELITRLIA-DPINRL--RSFEHVK 477

Query: 596 NHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVVD 645
              +F+++ +  L  +   PP+ P +    D   FD +FT E  +    D
Sbjct: 478 KMKYFAEIDFANL--RSMSPPFIPQLDSETDAGYFD-DFTNEADMAKYAD 524

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score =  158 bits (400), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 92/310 (29%), Positives = 157/310 (50%), Gaps = 30/310 (9%)

Query: 339 RLTIDDFDLLKVIGKGSFGKV-MQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVL 397
           R  I DF    ++G GS+ +V +   K D+ K YA+K + K Y++ + +V +   E+T L
Sbjct: 112 RKGIKDFKFGDMLGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIEKTAL 171

Query: 398 ARV-NCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCAL 456
             + +   ++ L F+FQ    LY +L     G+    ++K G        +Y+A+++ A+
Sbjct: 172 QNLKSVTGVINLSFTFQDEANLYFLLEYAPNGDFLSLIKKFGTLNEECTIYYSAQIIDAI 231

Query: 457 ETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDK-----------TDTFCG 505
            ++H+  +I+RD+KPENILLD    I L DFG  KL  K  DK           + +F G
Sbjct: 232 GSMHSHGIIHRDIKPENILLDGNMKIKLTDFGTAKLLQKKSDKNGKPHYNLLTRSSSFVG 291

Query: 506 TPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEG 565
           T EY++PELL +       D W  G L+Y+M+ G PP+   +    ++K+++    F  G
Sbjct: 292 TAEYVSPELLSDNYTDYKCDIWAFGCLVYQMIAGKPPFKATNEYLTFQKVMKVQFAFTAG 351

Query: 566 FDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSW--KRLWNKG----------- 612
           F    +DL+  +L + P++RL      +IK H  F  +++    +WN+            
Sbjct: 352 FPTIIRDLVKNILVKQPEKRLTI---PQIKEHCLFENINFSDNSVWNRDPPKILPYRINA 408

Query: 613 -YIPPYKPPV 621
             + P+ PP+
Sbjct: 409 KSMQPFSPPI 418

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score =  157 bits (396), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 94/315 (29%), Positives = 163/315 (51%), Gaps = 28/315 (8%)

Query: 339 RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLA 398
           R  I DF   +++G G++  VM    +D+ K YA+K + K Y++ + +V +   E+  L 
Sbjct: 176 RKGIKDFKFGEMVGDGAYSTVMLATAKDSGKKYAVKVLNKEYLIKQKKVKYVNIEKNALQ 235

Query: 399 RVN-CPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALE 457
           R+N    IV L F+FQ    LY +L     G+    ++K G       R+Y+A+++  ++
Sbjct: 236 RLNNSRGIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYGSLSEDCTRYYSAQIIDGIK 295

Query: 458 TLHNLDVIYRDLKPENILLDYQGHIALCDFGLCK-LNMKDQD----------KTDTFCGT 506
            LH+  +I+RD+KPENILLD    + + DFG  K L  K++D          ++ +F GT
Sbjct: 296 YLHSKGIIHRDIKPENILLDKDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSFVGT 355

Query: 507 PEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGF 566
            EY++PELL +       D W  G ++++M+ G PP+   +    ++K+++    F  GF
Sbjct: 356 AEYVSPELLNDSYVDARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGF 415

Query: 567 DRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWK--RLWNKGY--IPPYK---- 618
               +DL+  +L + P++RL      +I+ H F+  +S++   +W      I PYK    
Sbjct: 416 PVVVRDLVKRILLKVPEQRLTI---PQIEKHHFYKDISFEDGSVWTAPAPEIQPYKINAK 472

Query: 619 -----PPVSDAADTR 628
                P + DA + R
Sbjct: 473 SMQPVPELKDAPNKR 487

>Scas_660.20
          Length = 957

 Score =  157 bits (396), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 95/282 (33%), Positives = 154/282 (54%), Gaps = 25/282 (8%)

Query: 344 DFDLLKVIGKGSFGKVMQ-VRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERT---VLAR 399
           DF   + +G GS+  V + + KR+T++I+A+K   K++I+ +S+V +   E+    +LA+
Sbjct: 10  DFIFKEELGHGSYSTVYKAIDKRNTKRIFAIKVCSKAHIIKESKVKYVTIEKNTLNLLAK 69

Query: 400 VNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETL 459
            + P IV L ++F   E LY VL  + GGEL   L K   F    ++ +T +L+  LE +
Sbjct: 70  AHHPGIVKLYYTFHDEENLYYVLDYLPGGELLSLLHKMKTFSEVWSKHFTVQLVDTLEFI 129

Query: 460 HNLDVIYRDLKPENILLDYQGHIALCDFGLCKL----NMKDQDKTDTFCGTPEYLAPELL 515
           H+  VI+RDLKPEN+LLD  G + + DFG        N      + +F GT EY++PELL
Sbjct: 130 HSQGVIHRDLKPENVLLDRDGKLMITDFGAAYTTTAGNNDANKSSSSFVGTAEYVSPELL 189

Query: 516 LNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFP--------EGFD 567
           L+   S   D W LG ++++ +TG PP+  E+  K + KI+   L +P          F 
Sbjct: 190 LHNQCSFSSDVWALGCMIFQFVTGSPPFRGENELKTFEKIVA--LDYPWSSTNIHNNKFL 247

Query: 568 RDAKDLLIGLLSR----DPDRRLGCNGAHEIKNHPFFSQLSW 605
            +   L+I L+ +    +P  RL      +IK  P+F+ ++W
Sbjct: 248 NNINPLIINLVRKILVLEPKDRLSLK---KIKQDPWFATVNW 286

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score =  152 bits (385), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 102/303 (33%), Positives = 158/303 (52%), Gaps = 44/303 (14%)

Query: 344 DFDLLKVIGKGSFGKVMQ-VRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERT---VLAR 399
           DF   + +G GS+  V + + K+   KIYA+K   K +I+ +++V +   E+    +LA+
Sbjct: 10  DFIFKEELGHGSYSTVFKALDKKSPNKIYAIKVCSKKHIIKEAKVKYVTIEKNTMNLLAQ 69

Query: 400 VNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETL 459
            +   I+ L ++F   E LY VL    GGEL   L K G F     R +TA+L+ ALE +
Sbjct: 70  KHHAGIIKLYYTFHDEENLYFVLDFAPGGELLSLLHKMGTFNDIWTRHFTAQLIDALEFI 129

Query: 460 HNLDVIYRDLKPENILLDYQGHIALCDFGL------------CKLN-----MKDQDKTDT 502
           H+  +I+RDLKPEN+LLD  G + + DFG              K N      KD     +
Sbjct: 130 HSHGIIHRDLKPENVLLDRDGRLMITDFGAAATIDPSLSGDSAKFNSDSNGSKDNQNCAS 189

Query: 503 FCGTPEYLAPELLL-NQ-GYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPL 560
           F GT EY++PELLL NQ GY    D W LG ++Y+ + G PP+  E+  K + KI+   L
Sbjct: 190 FVGTAEYVSPELLLYNQCGYGS--DIWALGCMIYQFVQGQPPFRGENELKTFEKIVA--L 245

Query: 561 RFPEGFDRDAKD-------LLIGLLSR----DPDRRLGCNGAHEIKNHPFFSQLSWK--- 606
            +P G +    +       L+I L+ +    + + R+      +IK HP+FS++ W    
Sbjct: 246 DYPWGPNNRINNSTSPINPLVINLVQKILVIEVNERISL---EQIKRHPYFSKVDWNDKI 302

Query: 607 RLW 609
           ++W
Sbjct: 303 KIW 305

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score =  152 bits (385), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 91/292 (31%), Positives = 154/292 (52%), Gaps = 18/292 (6%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVN 401
           I DF   + +G GS+  V+     ++ K YA K + K Y++ + +V +   E+  L R+N
Sbjct: 197 IKDFKFGEALGDGSYSTVVLATCIESGKKYAAKILNKEYLIKQKKVKYVNIEKNTLQRLN 256

Query: 402 ---CPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALET 458
               P ++ L F+FQ    LY +L     G+    +++ G       ++Y A++L A+  
Sbjct: 257 SSRVPGVIKLYFTFQDEANLYFLLEYAPNGDFLSVMKRFGTLSEECTKYYGAQILDAIHH 316

Query: 459 LHNLDVIYRDLKPENILLDYQGHIALCDFGLCKL-NMKDQDK-------TDTFCGTPEYL 510
           LH   +I+RD+KPENILLD    I L DFG  KL   +D++K       + +F GT EY+
Sbjct: 317 LHKQGIIHRDVKPENILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFVGTAEYV 376

Query: 511 APELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDA 570
           +PELL +       D W  G +L++M+ G PP+   +    ++K+++    F  GF    
Sbjct: 377 SPELLNDNYVDSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTAGFPMIL 436

Query: 571 KDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKR--LWNK--GYIPPYK 618
           +DL+  LL + P++RL      +I+ H FF+ ++++   +W+     I PYK
Sbjct: 437 RDLIKQLLVKKPEQRLTI---LQIEKHHFFNDINFRNGSVWSNPAPQIAPYK 485

>Scas_716.33
          Length = 573

 Score =  150 bits (378), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 102/353 (28%), Positives = 168/353 (47%), Gaps = 56/353 (15%)

Query: 344 DFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCP 403
           DF+++  +G+G +G+V   RK+DT ++ ALK + K  +   +E  H L ER +L      
Sbjct: 177 DFEMITQVGQGGYGQVYLARKKDTNEVCALKILNKKLLFKLNETNHVLTERDILTTTRSQ 236

Query: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRF-ELSRARFYTAELLCALETLHNL 462
           ++V L ++FQ  + LYL +  + GG+ F  L    RF + + ARFY +E+  A+  LH+L
Sbjct: 237 WLVKLLYAFQDTQNLYLAMEFVPGGD-FRTLLINTRFLKSTHARFYISEMFLAVNALHDL 295

Query: 463 DVIYRDLKPENILLDYQGHIALCDFGLC------------KLNMKD---------QDKT- 500
              +RDLKPEN L+D +GHI L DFGL             K+ +++          DK+ 
Sbjct: 296 GYTHRDLKPENFLIDAKGHIKLTDFGLAAGTISNDRIQSMKVRLEEVKNLEFPEFSDKSI 355

Query: 501 ------------------DTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPP 542
                             ++  G+P+Y+A E+L  + Y   VD+W+L  +L+E L G  P
Sbjct: 356 EDRRQMYQKYRETEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLSCMLFESLVGYTP 415

Query: 543 YYDEDVPKMY------RKILQDPL--RFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEI 594
           +      + Y      +K L+ P+       F     D +  L++ DP  RL       +
Sbjct: 416 FSGSSTNETYENLRHWKKTLRRPMLDNGRPAFSDRTWDFITRLIA-DPINRL--RSFEHV 472

Query: 595 KNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVVDEY 647
           K   +F  + +  L  +   PP+ P + +  D   FD +FT E  +    D +
Sbjct: 473 KRMTYFESVDFNTL--RDLSPPFIPQLDNETDAGYFD-DFTNEADMAKYADVF 522

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score =  151 bits (381), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 84/265 (31%), Positives = 151/265 (56%), Gaps = 6/265 (2%)

Query: 327 NISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKS- 385
           N++      +  R T+  + L K +GKGS G+V   +  +T K+ A+K + K ++ S   
Sbjct: 55  NVNNTKTSKRRNRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQI 114

Query: 386 -EVTHTLAERTVLAR-VNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELS 443
            ++ + +    ++ + ++ P ++ L   +++  +LYLVL  + GGELF +L  +G+   S
Sbjct: 115 KQLPYGIEREIIIMKLISHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPES 174

Query: 444 RARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGH-IALCDFGLCKLNMKDQDKTDT 502
            A  Y  +++ A+   H  ++ +RDLKPEN+LLD +   I + DFG+  L   D+   +T
Sbjct: 175 EAIHYFKQIVQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIADFGMAALETSDK-LLET 233

Query: 503 FCGTPEYLAPELLLNQGY-SKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLR 561
            CG+P Y +PE++L + Y     D W+ GI+L+ +LTG  P+ D++V K+  K+     +
Sbjct: 234 SCGSPHYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQ 293

Query: 562 FPEGFDRDAKDLLIGLLSRDPDRRL 586
            P+    +AKDL+  +L  DP+RR+
Sbjct: 294 MPQWLSVEAKDLISRILVVDPNRRI 318

>Kwal_26.7788
          Length = 1267

 Score =  148 bits (373), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 88/279 (31%), Positives = 153/279 (54%), Gaps = 15/279 (5%)

Query: 336 KNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLA--- 392
           +  R TI  + L K +GKGS G+V   +  +T K+ A+K + K+    KS  T +L    
Sbjct: 49  RRSRDTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKT----KSSRTGSLPYGI 104

Query: 393 --ERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTA 450
             E  ++  ++ P ++ L   +++  +L+LVL  ++GGELF +L   GR     A  Y  
Sbjct: 105 EREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIHYFR 164

Query: 451 ELLCALETLHNLDVIYRDLKPENILLDYQG-HIALCDFGLCKLNMKDQDKTDTFCGTPEY 509
           +++      H  ++ +RDLKPEN+LLD +   I + DFG+  L   ++   +T CG+P Y
Sbjct: 165 QIIEGTAYCHGFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNK-LLETSCGSPHY 223

Query: 510 LAPELLLNQGYS-KVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDR 568
            +PE+++ + Y+    D W+ GI+L+ +LTG  P+ D+++ ++  K+     + P+    
Sbjct: 224 ASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQSVSS 283

Query: 569 DAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKR 607
            A+DL+  +L  DPD+R+  N   EI  HP  ++   KR
Sbjct: 284 GAQDLISRILVVDPDKRISIN---EILAHPLLAKYGNKR 319

>KLLA0D07810g complement(669095..671251)
           gi|401646|sp|P31034|YL44_KLULA Kluyveromyces lactis
           Hypothetical 31.8 kDa protein in L44/L41 3 region, start
           by similarity
          Length = 718

 Score =  147 bits (370), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 104/158 (65%)

Query: 343 DDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNC 402
           DDF+ +KVIGKG+FG+V  V+K+DT KIYA+K + KS + +K ++ H  AER VLA  + 
Sbjct: 301 DDFNSVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYNKDQLAHVKAERDVLAGSDS 360

Query: 403 PFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNL 462
           P++V L +SFQ  + LYL++  + GG+L   L +   F     RFY AE + A+E +H L
Sbjct: 361 PWVVSLYYSFQDSQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEVIHKL 420

Query: 463 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKT 500
             I+RD+KP+NIL+D +GHI L DFGL     K  D +
Sbjct: 421 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSS 458

 Score =  105 bits (263), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/131 (41%), Positives = 77/131 (58%), Gaps = 6/131 (4%)

Query: 504 CGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKIL--QDPLR 561
            GTP+Y+APE+ L QGY +  DWW+LG ++YE L G PP+  E   + YRKI+  +  L+
Sbjct: 531 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQ 590

Query: 562 FPEG--FDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKP 619
           FP+      +A+DL+  LL+   +R     GA EIK HPFFS + W  +  +    PY P
Sbjct: 591 FPDDIHISYEAEDLIRRLLTHSENRLGRHGGADEIKAHPFFSGVDWNTI--RQVEAPYIP 648

Query: 620 PVSDAADTRNF 630
            +S   DTR F
Sbjct: 649 KLSSVTDTRFF 659

>Scas_502.2
          Length = 1116

 Score =  146 bits (369), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 88/290 (30%), Positives = 152/290 (52%), Gaps = 16/290 (5%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVN 401
           I DF   +++G G++  VM     D+ K YA+K + K Y++ + +V +   E+  L R+N
Sbjct: 171 IKDFKFGEMLGDGAYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKLALQRLN 230

Query: 402 -CPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLH 460
               I+ L F+FQ    LY +L     G+L   ++K G        +Y A+++ A++ +H
Sbjct: 231 NSRSIIRLFFTFQDEASLYFLLEYAPNGDLLSLMKKFGSLNEECCCYYGAQIIDAIKFMH 290

Query: 461 NLDVIYRDLKPENILLDYQGHIALCDFGLCK-LNMKDQD-------KTDTFCGTPEYLAP 512
           +  +I+RD+KPENILLD    + + DFG  K L+ K          ++ +F GT EY++P
Sbjct: 291 SKGIIHRDIKPENILLDKDMKVKITDFGTAKILDNKPPGTSYDLLTRSKSFVGTAEYVSP 350

Query: 513 ELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKD 572
           ELL +       D W  G ++++M+ G PP+   +    ++K+++    F  GF    +D
Sbjct: 351 ELLNDNYTDARSDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPTVVRD 410

Query: 573 LLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWK--RLWNKGY--IPPYK 618
           L+  +L + P++RL       I+ H FF   +++   +WN     I PYK
Sbjct: 411 LVKRILIKAPEQRLTIEA---IEKHHFFRSKNFQDSSIWNDPAPEIQPYK 457

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score =  146 bits (369), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 83/272 (30%), Positives = 145/272 (53%), Gaps = 11/272 (4%)

Query: 336 KNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLA--- 392
           +  R T+  + L K +GKGS G+V   +   + K+ A+K + K  +    +    L    
Sbjct: 52  RKNRDTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQVTALPYGI 111

Query: 393 --ERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTA 450
             E  ++  +  P I+ L   +++  +LYLVL  + GGELF +L   G+     A  Y  
Sbjct: 112 EREIIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIHYFK 171

Query: 451 ELLCALETLHNLDVIYRDLKPENILLDYQGH-IALCDFGLCKLNMKDQDKTDTFCGTPEY 509
           +++  +   HN ++ +RDLKPEN+LLD +   + + DFG+  L   ++   +T CG+P Y
Sbjct: 172 QIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETTNR-LLETSCGSPHY 230

Query: 510 LAPELLLNQGY-SKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDR 568
            +PE+++ Q Y     D W+ GI+L+ +LTG  P+ D++V K+  K+     + P    +
Sbjct: 231 ASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPSNVSK 290

Query: 569 DAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFF 600
           +AKDL+  +L  DP++R+  +   +I  HP  
Sbjct: 291 EAKDLISKILVVDPEKRITVD---KILEHPLL 319

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score =  145 bits (366), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 89/261 (34%), Positives = 138/261 (52%), Gaps = 13/261 (4%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVN 401
           I ++ + K IG+GSFGKV     R T +   LK   K          + + E     + +
Sbjct: 34  IGNYKISKFIGEGSFGKVYLATHRLTHQKVVLKTGNK-------RDPNVVREVFYHRQFD 86

Query: 402 CPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHN 461
            P+I  L     +  ++++VL   +G EL+ HL KE R  L  ++   +++  A+   H 
Sbjct: 87  FPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKKLFSQIASAVYYAHE 146

Query: 462 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYS 521
           L  ++RDLK EN+LLD  GH  L DFG  +  M  + + +T CGT  Y+APEL+  + Y 
Sbjct: 147 LKCVHRDLKLENVLLDGNGHAKLTDFGFTR-EMATRSQLETICGTTVYMAPELIERKCYD 205

Query: 522 KV-VDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRF-PEGFDRDAKDLLIGLLS 579
              VD W+LGI+LY M+ G  P+ ++D  K   KI+ D L F  E    DA DL+ G+L 
Sbjct: 206 GFKVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQEWISDDAIDLIQGMLR 265

Query: 580 RDPDRRLGCNGAHEIKNHPFF 600
           ++P+ R+      ++ +HPF 
Sbjct: 266 KNPNERISLA---QVLSHPFL 283

>Kwal_33.14554
          Length = 714

 Score =  144 bits (364), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 101/156 (64%)

Query: 343 DDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNC 402
           +DF  +KVIGKG+FG+V  V+K+DT KIYA+K + KS +  K ++ H  AER VLA  + 
Sbjct: 301 EDFQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDS 360

Query: 403 PFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNL 462
           P++V L +SFQ  + LYL++  + GG+L   L +   F     RFY AE + A+E +H L
Sbjct: 361 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEAIHKL 420

Query: 463 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQD 498
             I+RD+KP+NIL+D +GHI L DFGL     K  D
Sbjct: 421 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHD 456

 Score =  104 bits (259), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 81/132 (61%), Gaps = 8/132 (6%)

Query: 504 CGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKIL--QDPLR 561
            GTP+Y+APE+ L QGY +  DWW+LG ++YE L G PP+  E   + YRKI+  +  L+
Sbjct: 529 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQ 588

Query: 562 FPEG--FDRDAKDLLIGLLSRDPDRRLGCN-GAHEIKNHPFFSQLSWKRLWNKGYIPPYK 618
           FP+      +A+DL+  LL+   D+RLG + GA EIK+HPFF  + W  +  +    PY 
Sbjct: 589 FPDDIHISYEAEDLIRRLLTH-ADQRLGRHGGADEIKSHPFFRGVDWNTI--RQVEAPYI 645

Query: 619 PPVSDAADTRNF 630
           P +S   DTR F
Sbjct: 646 PKLSSITDTRFF 657

>Scas_654.12
          Length = 737

 Score =  144 bits (363), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 101/156 (64%)

Query: 343 DDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNC 402
           +DF  +KVIGKG+FG+V  V+K DT KIYA+K + KS +  K ++ H  AER VLA  + 
Sbjct: 317 EDFHTVKVIGKGAFGEVRLVQKIDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDS 376

Query: 403 PFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNL 462
           P++V L +SFQ  + LYL++  + GG+L   L +   F     RFY AE + A+ET+H L
Sbjct: 377 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHKL 436

Query: 463 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQD 498
             I+RD+KP+NIL+D +GHI L DFGL     K  D
Sbjct: 437 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHD 472

 Score =  105 bits (261), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 81/132 (61%), Gaps = 8/132 (6%)

Query: 504 CGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKIL--QDPLR 561
            GTP+Y+APE+ L QGY +  DWW+LG ++YE L G PP+  E   + YRKI+  +  L+
Sbjct: 548 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQ 607

Query: 562 FPEG--FDRDAKDLLIGLLSRDPDRRLGCN-GAHEIKNHPFFSQLSWKRLWNKGYIPPYK 618
           FP+      +A+DL+  LL+   D+RLG + GA EIK+HPFF  + W  +  +    PY 
Sbjct: 608 FPDDIHISYEAEDLIRRLLTH-ADQRLGRHGGADEIKSHPFFRGVDWNTI--RQVEAPYI 664

Query: 619 PPVSDAADTRNF 630
           P +S   DTR F
Sbjct: 665 PKLSSITDTRFF 676

>Kwal_47.18307
          Length = 621

 Score =  143 bits (361), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 85/273 (31%), Positives = 148/273 (54%), Gaps = 11/273 (4%)

Query: 341 TIDDFDLLKVIGKGSFGKVMQ-VRKRDTQKIYALKAIRKSYIVSKSEVTHTLAER---TV 396
           T D +  L  +G+GS+  V + V + ++ + YA+K   K +I+ + +V +   E+    +
Sbjct: 6   TPDSYVFLDRLGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREKKVKYVTIEKDLLNM 65

Query: 397 LARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCAL 456
           LA+     IV L  +F   E LY VL  ++GGEL   +Q+ GR     +R  TA+L+  +
Sbjct: 66  LAKGGHLGIVKLFCTFHDIENLYFVLEYVSGGELLALIQRLGRLTEDLSRHITAQLVDTV 125

Query: 457 ETLHNLDVIYRDLKPENILLDYQGHIALCDFG-LCKL---NMKDQDKTDTFCGTPEYLAP 512
           + +H+  VI+RDLKPEN+LL  +G + + DFG  C       ++  +T +F GT EY++P
Sbjct: 126 DYMHSKGVIHRDLKPENVLLSQEGRVVITDFGAACTAADRKFENTKRTASFVGTAEYVSP 185

Query: 513 ELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKD 572
           ELLL+       D W LG ++Y++  G PP+  E+  + + KI+    ++          
Sbjct: 186 ELLLHSQCGFSSDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALDYKWLFSNSPQVVS 245

Query: 573 LLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSW 605
           ++  +L  DP +R     A ++K +P+F+ + W
Sbjct: 246 IVQSILVTDPLKR---PSAAQLKQNPWFASIDW 275

>AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH]
           complement(498529..500688) [2160 bp, 719 aa]
          Length = 719

 Score =  144 bits (363), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 101/156 (64%)

Query: 343 DDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNC 402
           +DF  +KVIGKG+FG+V  V+K+DT KIYA+K + KS +  K ++ H  AER VLA  + 
Sbjct: 308 EDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDS 367

Query: 403 PFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNL 462
           P++V L +SFQ  + LYL++  + GG+L   L +   F     RFY AE + A+E +H L
Sbjct: 368 PWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEAIHKL 427

Query: 463 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQD 498
             I+RD+KP+NIL+D +GHI L DFGL     K  D
Sbjct: 428 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHD 463

 Score =  114 bits (284), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 60/131 (45%), Positives = 81/131 (61%), Gaps = 7/131 (5%)

Query: 504 CGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKIL--QDPLR 561
            GTP+Y+APE+ L QGY +  DWW+LG ++YE L G PP+  E   + YRKI+  +  L 
Sbjct: 532 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLV 591

Query: 562 FPEG--FDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKP 619
           FP+      +A+DL+  LLS   D RLG +GA+EIKNHPFF  + W+ +   G   PY P
Sbjct: 592 FPDDIHISYEAEDLIRRLLSH-ADERLGRHGANEIKNHPFFRGVDWETIRQVG--APYIP 648

Query: 620 PVSDAADTRNF 630
            +S   DTR F
Sbjct: 649 KLSSVTDTRFF 659

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score =  142 bits (359), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 98/304 (32%), Positives = 151/304 (49%), Gaps = 41/304 (13%)

Query: 344 DFDLLKVIGKGSFGKVMQVRKRDTQKI-YALKAIRKSYIVSKSEVTHTLAERT---VLAR 399
           +F   + +G GS+  V +   +   K  YA+K   K +I+ +++V +   E+    +LAR
Sbjct: 10  EFIFKEELGHGSYSTVYKALDKKDLKKPYAIKVCSKRHIIKEAKVKYVTIEKNTLNLLAR 69

Query: 400 VNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETL 459
            N P IV L ++F   E LY VL   +GGEL   L K G F  S A+ + A+L+  LE +
Sbjct: 70  GNHPGIVKLYYTFHDEENLYFVLDYASGGELLSLLHKMGTFTDSWAKHFAAQLVDTLEFM 129

Query: 460 HNLDVIYRDLKPENILLDYQGHIALCDFGLCKL--NMKDQDKT----------------- 500
           H   VI+RDLKPEN+LL  +G + + DFG      N  D+D T                 
Sbjct: 130 HARGVIHRDLKPENVLLSKEGILMITDFGAAATQNNFSDKDNTRSNANEGIPKDDVPSSG 189

Query: 501 -----DTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKI 555
                 +F GT EY++PELLL    S   D W LG ++Y+ + G PP+  E+  K + KI
Sbjct: 190 DKTECSSFVGTAEYVSPELLLYNKCSFGSDIWALGCMVYQFIQGFPPFRGENELKTFEKI 249

Query: 556 LQ-----DPLRFPE--GFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSW--- 605
           +      +P R       +    +L+  +L+ D  +R   +   +IK  P+F+ + W   
Sbjct: 250 VSLDYSWNPERQTNFGTINIQVVNLVRRMLTIDTTQRATID---QIKRDPWFANVDWGDK 306

Query: 606 KRLW 609
           K+LW
Sbjct: 307 KKLW 310

>Scas_616.10
          Length = 1461

 Score =  140 bits (354), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 92/317 (29%), Positives = 160/317 (50%), Gaps = 44/317 (13%)

Query: 324 GRINISVDYKPSKNK-RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIV 382
            + + S D K SK K R T+  + L K +GKGS G+V   +  +T ++ A+K + K + +
Sbjct: 79  SQFSTSTDTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHKL 138

Query: 383 ----SKSEVT------------HTLA---------------------ERTVLARVNCPFI 405
               S S V+             TLA                     E  ++  ++ P +
Sbjct: 139 FMKSSHSNVSFFSAASNSNSNISTLATSPPMNNGSEKNQPNPYGIEREIVIMKLISHPNV 198

Query: 406 VPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVI 465
           + L   +++  +LYLVL  ++GGELF +L  +G+     A  Y  +++  +   H+ ++ 
Sbjct: 199 MALYEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNIC 258

Query: 466 YRDLKPENILLDYQGH-IALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGY-SKV 523
           +RDLKPEN+LLD +   I + DFG+  L + ++    T CG+P Y +PE+++ + Y    
Sbjct: 259 HRDLKPENLLLDKKNKSIKIADFGMAALELPNK-LLQTSCGSPHYASPEIVMGKSYHGGP 317

Query: 524 VDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPD 583
            D W+ GI+L+ +LTG  P+ D+++ K+  K+     R P     +A+DL+  +L  DP 
Sbjct: 318 SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKFRMPSTLSPEAQDLISRILVIDPS 377

Query: 584 RRLGCNGAHEIKNHPFF 600
           +R+  +    I NHP  
Sbjct: 378 KRITTD---RILNHPLI 391

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score =  139 bits (349), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 92/297 (30%), Positives = 153/297 (51%), Gaps = 26/297 (8%)

Query: 338 KRLTIDDFDLLKVIGKGSFGKVM----------QVRKRDTQKIYALKAIRKSYIVSKSEV 387
           K +T   + +   +G+G FGKV             ++    K  A+K IR+  IV  SE 
Sbjct: 37  KHVTFGPYIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEK 96

Query: 388 THTL-AERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRAR 446
              +  E   L  +  P +V L+   Q+ + + +VL   +GGE + ++Q++ R + S A 
Sbjct: 97  EIKIYREINALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTAC 156

Query: 447 FYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGT 506
              A+L+  +  +H+ ++++RDLK EN+LLD   ++ + DFG     + D +   T CG+
Sbjct: 157 RLFAQLISGVTYMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEYMKTSCGS 216

Query: 507 PEYLAPELLLNQG--YSKVVDWWTLGILLYEMLTGLPPYYD-------EDVPKMYRKILQ 557
           P Y APEL+++     ++  D W+ GI+LY ML G  P+ D       +D+ K+Y+ I +
Sbjct: 217 PCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITR 276

Query: 558 DPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHE---IKNH-PFF--SQLSWKRL 608
            PL+FPE      +DLL  +L  DP++R+     H    +K H PF   S   W +L
Sbjct: 277 TPLKFPEYITPIPRDLLRKILVPDPNKRVNMQYIHRHEWLKPHRPFLAVSTSQWDKL 333

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score =  138 bits (348), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 143/278 (51%), Gaps = 18/278 (6%)

Query: 344 DFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCP 403
           D+   + +G+G F +  Q+ K D+ KI+A K + K  I S+      L+E  +   ++  
Sbjct: 80  DYHRGQFLGEGGFARCFQI-KDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMSHT 138

Query: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463
            IV     F+    +Y++L     G L   ++K         RF+  ++   ++ +H+  
Sbjct: 139 NIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFMTQICGGIQYMHSNR 198

Query: 464 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQ--GYS 521
           VI+RDLK  NI  D   ++ + DFGL  +   D+++  T CGTP Y+APE+L+ +  G+S
Sbjct: 199 VIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAPEVLMGKHSGHS 258

Query: 522 KVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFP--EGFDRDAKDLLIGLLS 579
             VD W++G++LY +L G PP+  +DV  +Y +I Q    +P  +   +DAK L+  +LS
Sbjct: 259 YEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNFAYPKDKKISQDAKYLIDDILS 318

Query: 580 RDPDRRLGCNGAHEIKNHPFFSQLSWKRLWNKGYIPPY 617
            +P  R       EI ++          +W +G  PPY
Sbjct: 319 LNPMERPSI---QEIMDY----------VWFRGTFPPY 343

>Kwal_26.8709
          Length = 829

 Score =  137 bits (346), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 88/274 (32%), Positives = 141/274 (51%), Gaps = 16/274 (5%)

Query: 329 SVDYKPSKNKRLTIDDFDLLKVIGKGSFGKV------MQVRKRDTQKIYALKAIRKSYIV 382
           S  Y   K K +T   + +   +G+G FGKV            D  K  A+K IR+  I 
Sbjct: 24  STSYSTQKRKHVTFGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIP 83

Query: 383 SKSEVTHTL-AERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFE 441
             SE    +  E   L  +N P IV L+   Q+ + + +VL   +GGE + ++QK+ R +
Sbjct: 84  KNSEKEIKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLK 143

Query: 442 LSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTD 501
              A    A+L+  +  +H+  +++RDLK EN+LLD   ++ + DFG     + + +   
Sbjct: 144 EGPACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMK 203

Query: 502 TFCGTPEYLAPELLLNQG--YSKVVDWWTLGILLYEMLTGLPPYYD-------EDVPKMY 552
           T CG+P Y APEL++      ++  D W+ G++LY ML G  P+ D       +D+ K+Y
Sbjct: 204 TSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPDGDDIGKLY 263

Query: 553 RKILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRL 586
           R I + PL+FP+      +DLL  +L  DP RR+
Sbjct: 264 RYITRTPLKFPDYIAPVPRDLLREILIPDPKRRI 297

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score =  133 bits (334), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 131/251 (52%), Gaps = 10/251 (3%)

Query: 344 DFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCP 403
           D+   K +G G+FG V Q R     +  A+K + K  +   +E+     E ++L +++ P
Sbjct: 55  DYIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRAL-KGNELQMLYDELSILQKLDHP 113

Query: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463
            IV  K  F+S EK Y+V     GGELF  + K+G+F  + A     ++L A+E +H+ +
Sbjct: 114 NIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQMLTAVEYMHSQN 173

Query: 464 VIYRDLKPENIL-LDY--QGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGY 520
           V++RDLKPEN+L LD   +  + + DFG+ K    +        G+  Y+APE+L   G+
Sbjct: 174 VVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGYVAPEVLTTSGH 233

Query: 521 SKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKIL--QDPLRFPEGF----DRDAKDLL 574
            K  D W+LG++ Y +L G  P+  E       ++    DP+ F   +     ++AK  +
Sbjct: 234 GKPCDIWSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPYWNNISKEAKQFI 293

Query: 575 IGLLSRDPDRR 585
           +  L+  P RR
Sbjct: 294 LRALTLTPARR 304

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score =  135 bits (339), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 94/317 (29%), Positives = 160/317 (50%), Gaps = 37/317 (11%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKS---------EVTHTLA 392
           I  + L + +G GS GKV+  +  +T +I A+K I KS   ++          +V     
Sbjct: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75

Query: 393 ER--TVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTA 450
           ER   ++  +N P ++ L   +++ + LY+VL  +  GELF  L + G    + A  +  
Sbjct: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135

Query: 451 ELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYL 510
           +++  +   H L +++RDLKPEN+LLD++ +I L DFG+  L  KD+   +T CG+P Y 
Sbjct: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDK-LLETSCGSPHYA 194

Query: 511 APELLLNQGYSKV-VDWWTLGILLYEMLTGLPPYYDED--VPKMYRKILQDPLRFPEGFD 567
           APE++    Y     D W+ G++LY +LTG  P+ +ED  +  +  K+       P G D
Sbjct: 195 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIP-GED 253

Query: 568 R---DAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDA 624
               +A+DL++ +L+ +P++R+      EI  HP   +                P + D+
Sbjct: 254 EISPEARDLIVQILTVEPEQRIKT---REILKHPLLQKY---------------PSIKDS 295

Query: 625 ADTRNFDQEFTKEKPID 641
              RN  +E T   P+D
Sbjct: 296 KSIRNLPREDTYLNPLD 312

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score =  135 bits (340), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 89/312 (28%), Positives = 158/312 (50%), Gaps = 42/312 (13%)

Query: 329 SVDYKPSKNK-RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAI-RKSYI----- 381
           S + K SK K R T+  + L K +GKGS G+V   +  +   + A+K + +++Y      
Sbjct: 76  SNNTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRRMRD 135

Query: 382 --------VSKSEVTHTLAER---------------------TVLARVNCPFIVPLKFSF 412
                   VS    +   + R                      ++  ++ P ++ L   +
Sbjct: 136 QKMKTAGGVSSGTDSKDSSNREDPIKNGTDSALNPYGIEREIVIMKLISHPNVMGLLEVW 195

Query: 413 QSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPE 472
           ++  +LYLVL  ++GGELF +L  +G+     A  Y  +++  +   H+ ++ +RDLKPE
Sbjct: 196 ENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPE 255

Query: 473 NILLDYQGH-IALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGY-SKVVDWWTLG 530
           N+LLD +   I + DFG+  L + ++   +T CG+P Y +PE+++ + Y     D W+ G
Sbjct: 256 NLLLDKKNKVIKIADFGMAALELPNK-LLETSCGSPHYASPEIVMGKPYHGGPSDVWSCG 314

Query: 531 ILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNG 590
           I+L+ +LTG  P+ D+++ K+  K+     + P     DAKDL+  +L  +P++RL  N 
Sbjct: 315 IILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPPYLTNDAKDLITRILVTNPEKRLTIN- 373

Query: 591 AHEIKNHPFFSQ 602
             EI NHP   +
Sbjct: 374 --EILNHPLIKK 383

>Kwal_0.96
          Length = 427

 Score =  130 bits (327), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 81/259 (31%), Positives = 135/259 (52%), Gaps = 10/259 (3%)

Query: 337 NKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKS-EVTHTLAERT 395
           N  +   D+   K +G GSFG V Q R+  + +  A+K + K  +  K  E+     E +
Sbjct: 38  NSYVNKSDYIFGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGKDVELQMLYDELS 97

Query: 396 VLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCA 455
           +L +++ P IV  K  F+S +K Y+V     GGELF  + K+G+F    A     ++L A
Sbjct: 98  ILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRIVYQILKA 157

Query: 456 LETLHNLDVIYRDLKPENILLDYQG---HIALCDFGLCKLNMKDQDKTDTFCGTPEYLAP 512
           +E LH+ ++++RDLKPEN+L   +     + L DFG+ K    D +      G+  Y+AP
Sbjct: 158 VEYLHSRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSMGYVAP 217

Query: 513 ELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRK--ILQDPLRFPEGF---- 566
           E++   G+ K  D W+LG++ Y +L G  P+  E V     +  I + P+ F + +    
Sbjct: 218 EVVTTSGHGKPCDIWSLGVVTYTLLCGYSPFVAESVEGFLEECTIGRTPVTFHKPYWSNI 277

Query: 567 DRDAKDLLIGLLSRDPDRR 585
             +AKD ++  L+ +P  R
Sbjct: 278 SNEAKDFILRALTVNPHDR 296

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score =  133 bits (335), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 132/246 (53%), Gaps = 5/246 (2%)

Query: 344 DFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCP 403
           D+     +G+G F +  Q+ K D+ K++A K + K  I S+      L+E  +   +  P
Sbjct: 72  DYHRGMFLGEGGFARCFQM-KDDSGKVFAAKTVAKISIKSEKTRKKLLSEIQIHKSMKHP 130

Query: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463
            IV     F+    +Y++L     G L   L++  +      RF+T +++ A++ +H+  
Sbjct: 131 NIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPEVRFFTTQIVGAIKYMHSRR 190

Query: 464 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQ--GYS 521
           +I+RDLK  NI  D   ++ + DFGL  +   D+++  T CGTP Y+APE+L  +  G+S
Sbjct: 191 IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVLTGKHTGHS 250

Query: 522 KVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEG--FDRDAKDLLIGLLS 579
             VD W++G+++Y +L G PP+  ++V  +Y +I      FP+      +AK L+  +LS
Sbjct: 251 FEVDIWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFSFPKDKPISSEAKVLIKDILS 310

Query: 580 RDPDRR 585
            DP  R
Sbjct: 311 LDPLER 316

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score =  131 bits (330), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 91/290 (31%), Positives = 138/290 (47%), Gaps = 33/290 (11%)

Query: 343 DDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNC 402
           D + L K +G G +  V + + + T +  A+K         + +      E  +L RV  
Sbjct: 198 DKYLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQH 257

Query: 403 PFIVPLKFSFQSPE-----KLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALE 457
           P IV L  SF  P      + YLVL  I+ GELF  + ++       ++    +LL  L+
Sbjct: 258 PNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKALFKQLLTGLK 317

Query: 458 TLHNLDVIYRDLKPENILLDYQG-------------------HIALCDFGLCKLNMKDQD 498
            LH  ++I+RD+KPENILL+                       + + DFGL K   + Q 
Sbjct: 318 YLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGEMQ- 376

Query: 499 KTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDE-DVPKMYRKILQ 557
            T+T CGTP Y+APE+L  +GY+  VD W+ G++LY  L G PP+ D+   P +  +ILQ
Sbjct: 377 FTNTLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGPPSLKEQILQ 436

Query: 558 DPLRFPEGF----DRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQL 603
               F   +    D     L+  LL  +PD R   +   E  NHP+F+ +
Sbjct: 437 AKYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNID---EALNHPWFNDI 483

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score =  133 bits (334), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 91/316 (28%), Positives = 153/316 (48%), Gaps = 42/316 (13%)

Query: 334 PSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDT--------------------QKIYAL 373
           P   K +T   + +   +G+G FGKV     +                       K  A+
Sbjct: 37  PKHRKHVTFGPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAI 96

Query: 374 KAIRKSYIVSK-SEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFY 432
           K I++ +I    S+ T    E   L  ++ P IV L+   Q+ + + +VL    GGE + 
Sbjct: 97  KLIKRDFITKDPSKETKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEFYK 156

Query: 433 HLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKL 492
            +Q++ R + + A    ++L+ A+  +H+  +++RDLK EN+LLD + ++ + DFG    
Sbjct: 157 FIQRKRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVNE 216

Query: 493 NMKDQDKTDTFCGTPEYLAPELLL-NQGY-SKVVDWWTLGILLYEMLTGLPPYYDE---- 546
            ++      T CG+P Y APEL++ N+ Y ++  D W+ GI+L+ ML G  P+ D+    
Sbjct: 217 FLRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPKNP 276

Query: 547 ---DVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQL 603
              D+ ++Y  IL  PL+FPE  +   +DLL  +L  DP +R+       I+ HP+    
Sbjct: 277 DGHDISRLYNYILNTPLKFPEYINPVPRDLLRKILVIDPKKRINIRS---IEKHPWLESH 333

Query: 604 S---------WKRLWN 610
           S         W RL N
Sbjct: 334 STFLSITPDEWDRLSN 349

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score =  131 bits (330), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 89/309 (28%), Positives = 159/309 (51%), Gaps = 19/309 (6%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARV 400
           + ++ ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 36  VGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 94

Query: 401 NCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLH 460
             P I+ L    +S +++ +V+    G ELF ++ +  +     AR +  +++ A+E  H
Sbjct: 95  RHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRNKMSEQEARRFFQQIISAVEYCH 153

Query: 461 NLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGY 520
              +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++  + Y
Sbjct: 154 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLY 212

Query: 521 SK-VVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLS 579
           +   VD W+ G++LY ML    P+ DE +P +++ I       P+     A DL+  +L 
Sbjct: 213 AGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGASDLIKRMLI 272

Query: 580 RDPDRRLGCNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKP 639
            +P  R+     HEI       Q  W ++    Y+ P      D      F+++   E+ 
Sbjct: 273 VNPLNRISI---HEIM------QDEWFKVDLAEYLVP-----QDLKQQEQFNKKSGNEEN 318

Query: 640 IDSVVDEYL 648
           ++ + DE +
Sbjct: 319 VEEIDDEMV 327

>Kwal_47.18233
          Length = 598

 Score =  131 bits (329), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 93/318 (29%), Positives = 163/318 (51%), Gaps = 16/318 (5%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARV 400
           I  + ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 28  IGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 86

Query: 401 NCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLH 460
             P I+ L    +S +++ +V+    G ELF ++ +  +   + AR +  +++ A+E  H
Sbjct: 87  RHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEARRFFQQIISAVEYCH 145

Query: 461 NLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGY 520
              +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++  + Y
Sbjct: 146 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLRTSCGSPNYAAPEVISGKLY 204

Query: 521 S-KVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLS 579
           +   VD W+ G++LY ML    P+ DE +P +++ I       P+     A +L+  +L 
Sbjct: 205 AGPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGIYTLPKFLSPGAANLIKRMLI 264

Query: 580 RDPDRRLGCNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKP 639
            +P  R+     HEI       Q  W ++  + Y+ P  P + + A+    D E   +  
Sbjct: 265 VNPLNRITI---HEI------MQDEWFKVDMQDYLIP--PDLKNEAENHGHDGEQQGQND 313

Query: 640 IDSVVDEYLSESVQKQFG 657
            +  VD+ L   + K  G
Sbjct: 314 AEEEVDDSLVTMLSKTMG 331

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score =  130 bits (327), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 88/288 (30%), Positives = 149/288 (51%), Gaps = 18/288 (6%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARV 400
           I  + ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 36  IGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 94

Query: 401 NCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLH 460
             P I+ L    +S +++ +V+    G ELF ++ +  +   + AR +  +++ A+E  H
Sbjct: 95  RHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEARRFFQQIISAVEYCH 153

Query: 461 NLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGY 520
              +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++  + Y
Sbjct: 154 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLY 212

Query: 521 S-KVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLS 579
           +   VD W+ G++LY ML    P+ DE +P +++ I       P+   + A +L+  +L 
Sbjct: 213 AGPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGVYSIPKFLSQGAANLIKRMLI 272

Query: 580 RDPDRRLGCNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADT 627
            +P  R+     HEI              W K  +P Y  PV   AD 
Sbjct: 273 VNPLNRITI---HEIMEDE----------WFKVDLPDYLVPVDMKADA 307

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score =  127 bits (319), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 89/292 (30%), Positives = 130/292 (44%), Gaps = 33/292 (11%)

Query: 339 RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLA 398
           R   D +   K +G G +  V + R ++T +  A+K                  E  +L 
Sbjct: 95  RSFFDKYLAGKELGTGHYAIVKEARNKETGETVAVKIFHPQQNDDDKRTKKFTEETKILL 154

Query: 399 RVNCPFIVPLKFSFQSPE-----KLYLVLACINGGELFYHLQKEGRFELSRARFYTAELL 453
            +  P IV L   F  P      + YLVL  IN GELF  + ++        +    +LL
Sbjct: 155 SIQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDGELFERIVRKNNLREDETKALFRQLL 214

Query: 454 CALETLHNLDVIYRDLKPENILLDYQG-------------------HIALCDFGLCKLNM 494
             L+ LH+ ++I+RD+KPENILL                        + + DFGL K   
Sbjct: 215 NGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGLAKFT- 273

Query: 495 KDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDV-PKMYR 553
            +   T+T CGTP Y+APE+L+  GY+  VD W+ G+LLY  L G PP+ ++   P M  
Sbjct: 274 GEMKFTNTLCGTPSYVAPEVLVKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQLAPPSMKE 333

Query: 554 KILQDPLRFP----EGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFS 601
           +ILQ    F     +  D     L+  LL  +P  R   N A     HP+F+
Sbjct: 334 QILQGKFAFYSPYWDNIDDSVLHLISNLLVVNPASRFSVNDAL---THPWFT 382

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score =  128 bits (322), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 88/291 (30%), Positives = 141/291 (48%), Gaps = 33/291 (11%)

Query: 343 DDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNC 402
           D + L K +G G +  V + + + T +  A+K         + +      E T+L +++ 
Sbjct: 191 DKYLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFREETTILMKIHH 250

Query: 403 PFIVPLKFSFQSPE-----KLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALE 457
           P IV L  SF  P      + YLVL  I+ GELF  + K+       ++    ++L  L+
Sbjct: 251 PNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQEESKAIFKQILTGLK 310

Query: 458 TLHNLDVIYRDLKPENILLDYQG-------------------HIALCDFGLCKLNMKDQD 498
            LH+ ++I+RD+KPENILL+ +                     + + DFGL K   + Q 
Sbjct: 311 YLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFGLAKFTGEMQ- 369

Query: 499 KTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDE-DVPKMYRKILQ 557
            T+T CGTP Y+APE+L+ +GY+  VD W+ G++LY  L G PP+ D+   P +  +I+ 
Sbjct: 370 FTNTLCGTPSYVAPEVLVKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGPPSLKEQIMS 429

Query: 558 DPLRFPEGF----DRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLS 604
               F   +    D  A  L+  LL  DP+ R   + A     HP+   +S
Sbjct: 430 AKYAFYSPYWDEIDDAALHLISNLLVLDPENRYDVDAAAA---HPWLDSVS 477

>Scas_618.8
          Length = 427

 Score =  127 bits (319), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 83/290 (28%), Positives = 150/290 (51%), Gaps = 16/290 (5%)

Query: 339 RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAI-RKSYIVSKSEVTHTLAERTVL 397
           ++T  D++  K +G GSFG V +  K+   +  A+K + +K+   ++ ++     E T+L
Sbjct: 21  KVTKSDYEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGNQVQLQMLYDELTIL 80

Query: 398 ARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALE 457
            +++ P IV  K  F++ +K+Y+V     GGELF  + K+GRF    A     ++L A+E
Sbjct: 81  KKLHHPNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGRFSEDDAVKILIQILSAVE 140

Query: 458 TLHNLDVIYRDLKPENILL---DYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPEL 514
            +H+ D+++RDLKPEN+L         + + DFG+ K   K +       G+  Y+APE+
Sbjct: 141 YIHSRDIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSLGYVAPEV 200

Query: 515 LLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQD--PLRFPEGF----DR 568
           L   G+ K  D W++G++ Y +L+G   +  E V     +      P++F + +      
Sbjct: 201 LTVDGHGKPCDIWSIGVITYTLLSGYAAFVAETVEGFLDECTSGDYPVKFHKPYWDNISD 260

Query: 569 DAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRLWNKGYIPPYK 618
           DAK+ ++  L  +P +R     A E+ + P+ +    K   N   +P +K
Sbjct: 261 DAKNFILKALDLNPQKR---PTATELLDDPWITS---KVCRNADLLPSFK 304

>Kwal_33.13112
          Length = 505

 Score =  128 bits (321), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 140/267 (52%), Gaps = 12/267 (4%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPF 404
           +D+ + +GKGSFG V +   ++T ++ A+K I      ++ ++     E   L+ +  PF
Sbjct: 36  YDIKECVGKGSFGDVYRAIDKETGEMVAVKIINLEE--TQDDIDVLAQEIYFLSELRAPF 93

Query: 405 IVPLKFSFQSPEKLYLVLACINGG---ELFYHLQKEGRFELSRARFYTAELLCALETLHN 461
           +     ++     +++V+    GG   +L  HL  E R   ++  +   E+L  LE LH+
Sbjct: 94  VTTYYKTYVEDVSMWIVMEFCGGGSCADLLKHL-PEHRLPENKVAYIIREVLYGLEYLHS 152

Query: 462 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLL-NQGY 520
              I+RD+K  NILL  +G + L DFG+    M    K +TF GTP ++APE++  + GY
Sbjct: 153 QRKIHRDVKAANILLTDEGEVKLGDFGVSGQIMATL-KRNTFVGTPYWMAPEIIARDNGY 211

Query: 521 SKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKI-LQDPLRFPEGFDRDAKDLLIGLLS 579
            +  D W+LGI   E+LTG PPY   D  K+   I L+ P R    F   A+D +   L+
Sbjct: 212 DEKADIWSLGITAMELLTGQPPYAKYDPMKVLMNIPLRKPPRLQGRFTSSARDFIALCLT 271

Query: 580 RDPDRRLGCNGAHEIKNHPFFSQLSWK 606
           +DP  R     A ++ +H F ++ +W+
Sbjct: 272 KDPALR---PTASDLLSHKFLNRPTWR 295

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score =  129 bits (325), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 128/246 (52%), Gaps = 5/246 (2%)

Query: 344 DFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCP 403
           D+     +G+G F +  Q+ K D  K++A K + K  I S+      L+E  +   +  P
Sbjct: 89  DYHRGHFLGEGGFARCFQM-KDDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMKHP 147

Query: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463
            IV     F+    +Y++L     G +   L++         RF   +++ A+  +H+  
Sbjct: 148 NIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCMIQIIGAIRYMHSRR 207

Query: 464 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQ--GYS 521
           VI+RDLK  NI  D + ++ + DFGL  +   D+++  T CGTP Y+APE+L  +  G+S
Sbjct: 208 VIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAPEVLTGKHTGHS 267

Query: 522 KVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFP--EGFDRDAKDLLIGLLS 579
             VD W++G++LY +L G PP+  ++V  +Y +I      FP  +    DAK+L+  LL 
Sbjct: 268 YEVDIWSIGVMLYALLFGKPPFQAKEVETIYERIKCRDFIFPADKPVSSDAKNLISHLLQ 327

Query: 580 RDPDRR 585
            +P  R
Sbjct: 328 LNPAAR 333

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score =  129 bits (323), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 81/261 (31%), Positives = 140/261 (53%), Gaps = 8/261 (3%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARV 400
           I ++ ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 52  IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 110

Query: 401 NCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLH 460
             P I+ L    +S +++ +V+    G ELF ++ +  +     AR +  +++ A+E  H
Sbjct: 111 RHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQQIISAVEYCH 169

Query: 461 NLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGY 520
              +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++  + Y
Sbjct: 170 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLY 228

Query: 521 S-KVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLS 579
           +   VD W+ G++LY ML    P+ DE +P +++ I       P+     A  L+  +L 
Sbjct: 229 AGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLI 288

Query: 580 RDPDRRLGCNGAHEIKNHPFF 600
            +P  R+     HEI    +F
Sbjct: 289 VNPLNRISI---HEIMQDDWF 306

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score =  126 bits (317), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 87/272 (31%), Positives = 141/272 (51%), Gaps = 16/272 (5%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTV-LARVNCP 403
           +++L+ IG+G+FG V + R   + +I A+K +    +    E    LA+    L+ +  P
Sbjct: 20  YEILQCIGRGNFGDVYKARDLTSNEIVAIKVVN---LEDTDEPIDLLAQEIFFLSELRSP 76

Query: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQ--KEGRFELSRARFYTAELLCALETLHN 461
           +I   K +F     +++V+    GG     L+   E +    +  F  +E+L  L+ LH+
Sbjct: 77  YITNYKTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLIGLDYLHS 136

Query: 462 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELL--LNQG 519
              I+RD+K  NILL   GH+ L DFG+    M  + K DTF GTP ++APE++    QG
Sbjct: 137 QRKIHRDIKSANILLTDNGHVKLGDFGVSGQMMVTR-KRDTFVGTPFWMAPEVIDRNKQG 195

Query: 520 YSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKI-LQDPLRFPEGFDRDAKDLLIGLL 578
           Y+++ D W+LGI + E+L G PP    D  K    I  +DP +  + F   A+D +   L
Sbjct: 196 YNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRDPPKLDKRFSSHARDFVAQCL 255

Query: 579 SRDPDRRLGCNGAHEIKNHPFFSQLSWKRLWN 610
            +DP +R     A E+  H F  ++   RL+N
Sbjct: 256 IKDPSQR---PTAAELLKHRFVKRV---RLYN 281

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score =  129 bits (325), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 85/261 (32%), Positives = 134/261 (51%), Gaps = 13/261 (4%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVN 401
           + ++ ++K +G+GSFGKV     + T +   LK   KS      EV +         +  
Sbjct: 34  VGNYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKSDPNVVREVFYH-------RQFE 86

Query: 402 CPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHN 461
            PFI  L     +  ++++ L    G EL+ +L  + R  L   R   A+++ A+   H+
Sbjct: 87  YPFITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRRLFAQIVSAVFYAHS 146

Query: 462 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYS 521
           L  ++RDLK ENILLD  G+  L DFG  +     + + +T CGT  Y+APEL+  + Y 
Sbjct: 147 LQCVHRDLKLENILLDKNGYAMLTDFGFTR-ECATKTQLETVCGTTVYMAPELIKREAYD 205

Query: 522 KV-VDWWTLGILLYEMLTGLPPYYDEDVPKMYRKIL-QDPLRFPEGFDRDAKDLLIGLLS 579
              VD W+LGI+LY ML G  P+ ++D  +   KI+ ++P    E     AKDL++ LL 
Sbjct: 206 GYKVDTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLLD 265

Query: 580 RDPDRRLGCNGAHEIKNHPFF 600
           ++  +R   N   E+  HPF 
Sbjct: 266 KNAAQRPNLN---EVLQHPFL 283

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score =  129 bits (325), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 93/317 (29%), Positives = 156/317 (49%), Gaps = 39/317 (12%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIV------SKSEVTHTL---- 391
           I  + L + +G GS GKV+      T++  A+K I K+         S  + T+ L    
Sbjct: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNI 76

Query: 392 -AERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTA 450
             E  ++  +N P ++ L   +++   LYLVL     GELF  L + G    + A     
Sbjct: 77  EQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFR 136

Query: 451 ELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYL 510
           +++  +   H+L V++RDLKPEN+LLD + +I + DFG+  L  +D+   +T CG+P Y 
Sbjct: 137 QIIIGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALESEDK-LLETSCGSPHYA 195

Query: 511 APELLLN---QGYSKVVDWWTLGILLYEMLTGLPPYYDED--VPKMYRKILQDPLRFPEG 565
           APE++     +G+S   D W+ G++L+ +LTG  P+ +ED  +  +  K+ +     P+ 
Sbjct: 196 APEIISGLPYEGFSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDD 253

Query: 566 --FDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSD 623
               ++A+DLL  LL+ DP +R+      EI  HP   +                P + D
Sbjct: 254 DEITKEAQDLLARLLTVDPSKRITI---REILKHPLLQKY---------------PSIKD 295

Query: 624 AADTRNFDQEFTKEKPI 640
           +   RN  +E T   P+
Sbjct: 296 SRSIRNLPREDTYLSPL 312

>Scas_693.17
          Length = 1049

 Score =  129 bits (324), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 84/292 (28%), Positives = 146/292 (50%), Gaps = 38/292 (13%)

Query: 339 RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIR--------KSYIVSKSEVTHT 390
           R ++ D+D ++ +G GS GKV   + R T ++ A+K +         K Y    +  T  
Sbjct: 65  RTSLGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKHNGYTIP 124

Query: 391 LAERTVLAR-----------------------VNCPFIVPLKFSFQSPEKLYLVLACING 427
           L+E+ V+ R                       +  P I  L          Y++   ++G
Sbjct: 125 LSEKEVIERQKNLEKEASRDKRTVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSG 184

Query: 428 GELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDF 487
           G+L  ++ + G  + SRAR +T ++  AL+ LH+ ++++RDLK ENI++   G+I L DF
Sbjct: 185 GQLLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDF 244

Query: 488 GLCKLNMKDQ-DKTDTFCGTPEYLAPELLLNQGY-SKVVDWWTLGILLYEMLTGLPPYYD 545
           GL   N+ D+ +K  T+CG+  + APELL    Y    +D W+ G++LY ++ G  P+ D
Sbjct: 245 GLS--NLYDKCNKLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDD 302

Query: 546 EDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNH 597
           E+   ++ KI Q  + +P+    +   LL  +L  DP +R   +   ++ NH
Sbjct: 303 ENSNVLHEKIKQGKVFYPQFLSIEVISLLSKMLVVDPFKRATLD---QVMNH 351

>Scas_644.15
          Length = 726

 Score =  128 bits (322), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 131/246 (53%), Gaps = 5/246 (2%)

Query: 344 DFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCP 403
           D+     +G+G F +  Q+ K ++ KI+A K + K  I ++      L+E  +   +  P
Sbjct: 91  DYRRGHFLGEGGFARCFQI-KDESGKIFAAKTVAKISIKTEKTKKKLLSEIQIHKSMKHP 149

Query: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463
            IV     F+    +Y++L   + G L   ++K         RF+T ++  A++ +H+  
Sbjct: 150 NIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPEVRFFTTQICGAVKYMHSRR 209

Query: 464 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQ--GYS 521
           VI+RDLK  NI  D   ++ + DFGL  +   ++++  T CGTP Y+APE+L+ +  G+S
Sbjct: 210 VIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIAPEVLMGKHAGHS 269

Query: 522 KVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEG--FDRDAKDLLIGLLS 579
             VD W++G+++Y +L G PP+  +DV  +Y +I      +P+      +AK L+  +L 
Sbjct: 270 FEVDIWSIGVMIYALLVGKPPFQAKDVNVIYDRIKACQYGYPKDKYVSSEAKTLIADILC 329

Query: 580 RDPDRR 585
            DP  R
Sbjct: 330 VDPVER 335

>Scas_660.28
          Length = 623

 Score =  127 bits (320), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 136/247 (55%), Gaps = 5/247 (2%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARV 400
           I ++ ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 43  IGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 101

Query: 401 NCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLH 460
             P I+ L    +S +++ +V+    G ELF ++ +  +     AR +  +++ A+E  H
Sbjct: 102 RHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDEARRFFQQIISAVEYCH 160

Query: 461 NLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGY 520
              +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++  + Y
Sbjct: 161 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLY 219

Query: 521 S-KVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLS 579
           +   VD W+ G++LY ML    P+ DE +P +++ I       P+   + A  L+  +L 
Sbjct: 220 AGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNINNGVYTIPKFLSQGASTLIKKMLI 279

Query: 580 RDPDRRL 586
            +P  R+
Sbjct: 280 VNPLNRI 286

>Scas_700.34
          Length = 864

 Score =  128 bits (321), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 95/315 (30%), Positives = 156/315 (49%), Gaps = 28/315 (8%)

Query: 336 KNKRLTIDDFDLLKVIGKGSFGKVM----------QVRKRDTQKIYALKAIRKSYIVS-K 384
           K K +T   + +   +G+G FGKV                D  K  A+K IR+  I    
Sbjct: 39  KRKHVTFGPYIIGSTLGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKDS 98

Query: 385 SEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSR 444
           S+      E   L  +  P IV L+   Q+ + + +VL   +GGE + ++Q++ R +   
Sbjct: 99  SKEIKIYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKEGP 158

Query: 445 ARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFC 504
           A    A+L+  +  +H+  +++RDLK EN+LLD   ++ + DFG         +   T C
Sbjct: 159 ACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEFYSHGELMKTSC 218

Query: 505 GTPEYLAPELLLN-QGY-SKVVDWWTLGILLYEMLTGLPPYYD-------EDVPKMYRKI 555
           G+P Y APEL+++ + Y +K  D W+ G++LY ML G  P+ D       +D+ ++Y  I
Sbjct: 219 GSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPWDDDAGNPDGDDISRLYHYI 278

Query: 556 LQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCN--GAHE-IKNHPFFSQLS---WKRLW 609
            Q PL+FP+  +   +DLL  +L  DP RR+       HE +K H  F  ++   W  + 
Sbjct: 279 TQTPLKFPDYINPIPRDLLRRILISDPRRRITIKYIEKHEWLKPHSAFLSITPEEWDTIM 338

Query: 610 NKGYIPPYKPPVSDA 624
           +K +  P + P S A
Sbjct: 339 HKKF--PLRSPKSVA 351

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score =  124 bits (312), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 78/252 (30%), Positives = 130/252 (51%), Gaps = 10/252 (3%)

Query: 344 DFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARVNC 402
           D+   K +G G+FG V Q R   + +  A+K + K  +  +S     L  E ++L ++N 
Sbjct: 45  DYIFGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQSVQLQMLYDELSILQQLNH 104

Query: 403 PFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNL 462
           P IV  K  F+S EK Y+V     GGELF  + ++G+F    A F   ++L  ++ LH  
Sbjct: 105 PNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEVDAVFIVKQILQGVQYLHQR 164

Query: 463 DVIYRDLKPENILLDYQGH---IALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQG 519
           ++++RDLKPENIL   +     + + DFG+ K    D +      G+  Y+APE+L + G
Sbjct: 165 NIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSMGYVAPEVLTSSG 224

Query: 520 YSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKIL--QDPLRFPEGF----DRDAKDL 573
           + K  D W++G++ Y +L G  P+  E       +    Q P+ F + +     + AK+ 
Sbjct: 225 HGKPCDIWSIGVITYTLLCGYSPFLAESADGFIEECTSGQYPVVFHKPYWNNVSKTAKEF 284

Query: 574 LIGLLSRDPDRR 585
           ++  L+  P RR
Sbjct: 285 ILWALTVSPKRR 296

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score =  126 bits (317), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 80/261 (30%), Positives = 139/261 (53%), Gaps = 8/261 (3%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARV 400
           I  + ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 32  IGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 90

Query: 401 NCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLH 460
             P I+ L    +S +++ +V+    G ELF ++ +  +     AR +  +++ A++  H
Sbjct: 91  RHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQEARRFFQQIISAVDYCH 149

Query: 461 NLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGY 520
              +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++  + Y
Sbjct: 150 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLY 208

Query: 521 S-KVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLS 579
           +   VD W+ G++LY ML    P+ DE +P +++ I       P    + A  L+  +L 
Sbjct: 209 AGPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGVYTIPNFLSQGAASLIKKMLI 268

Query: 580 RDPDRRLGCNGAHEIKNHPFF 600
            +P  R+     HEI    +F
Sbjct: 269 VNPVNRITV---HEIMQDEWF 286

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score =  127 bits (318), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 87/289 (30%), Positives = 146/289 (50%), Gaps = 34/289 (11%)

Query: 338 KRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVL 397
           K  +I+D    +V+G G+F  V +  +R+T K +A+K I K  +V   +      E  VL
Sbjct: 185 KDFSIND----EVVGTGAFATVKKAVERNTGKTFAVKIINKRKVVGNMDGVSR--ELEVL 238

Query: 398 ARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALE 457
            ++N P IV LK  ++     Y+V+  I+GG+L   +   G       R  + ++L A++
Sbjct: 239 QKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREISRQILEAIQ 298

Query: 458 TLHNLDVIYRDLKPENILLDYQGH--IALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELL 515
            +H+  + +RDLKP+NIL++      + + DFGL K+   +     TFCGT  Y+APE++
Sbjct: 299 YIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKV-QGNGSIMKTFCGTLAYVAPEVI 357

Query: 516 --------------LNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLR 561
                             YS +VD W++G L++ +LTG  P+      ++Y +I +    
Sbjct: 358 GGFTGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPFSGSTQEQLYEQIRKGS-- 415

Query: 562 FPEGFDRD------AKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLS 604
           + EG  +D      A+D + GLL  D  +R+  + A    NHP+  Q S
Sbjct: 416 YHEGPLKDFRISDEARDFIDGLLQVDQSKRMTVDDAL---NHPWIKQCS 461

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score =  126 bits (316), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 90/284 (31%), Positives = 145/284 (51%), Gaps = 36/284 (12%)

Query: 338 KRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVL 397
           K  +I+D    +V+G+G+F  V +  +R+T K +A+K I K  ++    V     E  VL
Sbjct: 214 KDFSIND----EVVGQGAFATVKKAVERNTGKTFAVKIINKRKVMGN--VDGVTRELEVL 267

Query: 398 ARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALE 457
            R+N P IV LK  ++  E  YL++  ++GG+L   +   G       R  T ++L A+ 
Sbjct: 268 RRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVR 327

Query: 458 TLHNLDVIYRDLKPENILLDYQGH--IALCDFGLCKLNMKDQDKT---DTFCGTPEYLAP 512
            +H   + +RDLKP+NIL++      + + DFGL K+    QD T    TFCGT  Y+AP
Sbjct: 328 YIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLAKI----QDNTTFMKTFCGTLAYVAP 383

Query: 513 ELLLNQG----------YSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRF 562
           E++  +           YS +VD W++G L+Y +LTG  P+      ++Y++I      +
Sbjct: 384 EVIGGKNPEGNGANGNLYSSLVDMWSIGCLVYVILTGHLPFSGSTQEQLYKQIANGS--Y 441

Query: 563 PEGFDRD------AKDLLIGLLSRDPDRRLGCNGAHEIKNHPFF 600
            EG  +D      A+D +  LL  +P  RL    A +   HP+ 
Sbjct: 442 HEGPLKDYWISDEARDFIDSLLQINPVDRLTAERALQ---HPWL 482

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score =  125 bits (315), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 93/329 (28%), Positives = 158/329 (48%), Gaps = 40/329 (12%)

Query: 341 TIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKS---------EVTHTL 391
           TI  + L   +G GS GKV+        +  A+K I KS   ++          +V    
Sbjct: 13  TIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGNDPDVLPYG 72

Query: 392 AERTV--LARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYT 449
            ER +  +  +N P ++ L   +++ + LY+VL  +  GELF  L + G    + A  + 
Sbjct: 73  IEREIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLPENEAVRFF 132

Query: 450 AELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEY 509
            +++  +   H L +++RDLKPEN+LLD++ ++ L DFG+  L  KD+   +T CG+P Y
Sbjct: 133 RQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAALESKDK-LLETSCGSPHY 191

Query: 510 LAPELLLNQGYSKV-VDWWTLGILLYEMLTGLPPYYDED--VPKMYRKILQDPLRFP--E 564
            APE++    Y     D W+ G++LY +LTG  P+ +ED  +  +  K+       P  +
Sbjct: 192 AAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPGDD 251

Query: 565 GFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDA 624
               +A+DL+  +L+ DP++R+      EI  HP   +                P + D+
Sbjct: 252 EISSEAQDLIARILTVDPEQRIKT---REILKHPLLRKY---------------PSIKDS 293

Query: 625 ADTRNFDQEFTKEKPI-----DSVVDEYL 648
              RN  +E T   P+     +  VDE +
Sbjct: 294 KSIRNLPREDTYLNPLSLEGGNQCVDETI 322

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score =  122 bits (306), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/249 (30%), Positives = 131/249 (52%), Gaps = 14/249 (5%)

Query: 349 KVIGKGSFGKVMQVRKRDTQKIYALKAI-RKSYIVSKSEVTHTLAERTVLARVNCPFIVP 407
           K +G G+FG V Q R   T +  A+K + +K+   +  ++     E ++L  +  P IV 
Sbjct: 49  KTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGNDVQLQMLYDELSILQMLKHPNIVE 108

Query: 408 LKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYR 467
            K  F+S +K Y+V     GGELF  +  +G+F    A   T ++L A++ +H+ +V++R
Sbjct: 109 FKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQILSAVDYMHSKNVVHR 168

Query: 468 DLKPENIL-LDYQ--GHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVV 524
           DLKPEN+L +D      + + DFG+ K    + D      G+  Y+APE+L N G+ K  
Sbjct: 169 DLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGYVAPEVLTNNGHGKPC 228

Query: 525 DWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDR--------DAKDLLIG 576
           D W++G+++Y +L G   +  E V     +  Q+  ++P  F +        +AK+ ++ 
Sbjct: 229 DIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQN--KYPVTFHKPYWDNISDEAKNFILR 286

Query: 577 LLSRDPDRR 585
            L+ DP  R
Sbjct: 287 ALTLDPAER 295

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score =  125 bits (313), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 90/290 (31%), Positives = 150/290 (51%), Gaps = 18/290 (6%)

Query: 335 SKNKRLTIDDFDLLKVIGKGSFGKVM----QVRKRDTQKIYALKAIRKSYIVSKSEVTHT 390
           SK K++T   + +   +G+G FGKV     + R     +  A+K IR+  +   SE    
Sbjct: 35  SKKKQVTFGPYIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRRDTVPKNSEKEIK 94

Query: 391 L-AERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYT 449
           +  E   L  ++ P IV L+   Q+ + + +VL   +GGE + ++QK+ R +   A    
Sbjct: 95  IYRELNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLF 154

Query: 450 AELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEY 509
           A+L+  +  +H   + +RDLK EN+LLD   ++ + DFG      K+ D   T CG+P Y
Sbjct: 155 AQLISGVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVNEFHKN-DLMRTSCGSPCY 213

Query: 510 LAPELLL-NQGYS-KVVDWWTLGILLYEMLTGLPPYYD-------EDVPKMYRKILQDPL 560
            APEL++ ++ YS +  D W+ G++LY ML G  P+ D       ED+ K+Y+ I    L
Sbjct: 214 AAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGEDIAKLYQYITHTSL 273

Query: 561 RFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRLWN 610
           +FPE      +DLL  +L  +P+ RL      +I+ H +    +   +W+
Sbjct: 274 KFPEYIKPIPRDLLKRILVSNPEVRLTVA---DIEQHAWLQPHAQFLMWS 320

>Kwal_26.8796
          Length = 796

 Score =  124 bits (311), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 87/268 (32%), Positives = 142/268 (52%), Gaps = 24/268 (8%)

Query: 349 KVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARVNCPFIVP 407
           +V+G+G+F  V +  +R T K +A+K I K  +V    V   +A E  VL R++ P IV 
Sbjct: 192 EVVGQGAFATVKKAIERKTGKTHAVKIISKRKVVG---VMDGVARELEVLQRLDHPRIVS 248

Query: 408 LKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYR 467
           LK  ++  +  YLV+  ++GG+L   +   G       R  T ++L A++ +H++ + +R
Sbjct: 249 LKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVKYIHSMGISHR 308

Query: 468 DLKPENILLDYQGH--IALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLL--NQG---- 519
           DLKP+NIL++      + + DFGL K+   +     TFCGT  Y+APE++   N G    
Sbjct: 309 DLKPDNILIERDDPVLVKITDFGLAKIQ-GNGTFMKTFCGTLAYVAPEVISGKNSGEKEG 367

Query: 520 --YSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKIL-----QDPLRFPEGFDRDAKD 572
             YS +VD W++G L+Y +LTG  P+       +Y++I      + PL+     D DA+D
Sbjct: 368 NTYSSLVDMWSIGCLVYVILTGHLPFSGSTQNDLYKQITAGSYHEGPLKDYRISD-DARD 426

Query: 573 LLIGLLSRDPDRRLGCNGAHEIKNHPFF 600
            +   L  DP  R+    A +   HP+ 
Sbjct: 427 FIESFLQVDPRNRM---TAEQALRHPWI 451

>Kwal_56.22476
          Length = 697

 Score =  123 bits (309), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 127/246 (51%), Gaps = 5/246 (2%)

Query: 344 DFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCP 403
           D+     +G+G F +  Q+ K D  KI+A K + K  I S+      L+E  +   +   
Sbjct: 78  DYHRGHFLGEGGFARCFQI-KDDGGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMRHT 136

Query: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463
            IV     F+    +Y++L     G L   L++         RF+T +++ A++ +H+  
Sbjct: 137 NIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPEVRFFTTQIVGAVKYMHSRR 196

Query: 464 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQ--GYS 521
           VI+RDLK  NI  D   ++ + DFGL  +   D+++  T CGTP Y+APE+L  +  G+S
Sbjct: 197 VIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPEVLTGKHTGHS 256

Query: 522 KVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEG--FDRDAKDLLIGLLS 579
             VD W+ G+++Y +L G PP+  ++V  +Y +I      FP+      +A  L+  +LS
Sbjct: 257 YEVDIWSCGVMIYALLIGKPPFQAKEVNIIYERIKCGDFVFPKDKFISPEALVLIKDILS 316

Query: 580 RDPDRR 585
            DP  R
Sbjct: 317 IDPLER 322

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score =  124 bits (310), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 78/268 (29%), Positives = 143/268 (53%), Gaps = 25/268 (9%)

Query: 350 VIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVPLK 409
           ++G+G+F  V +  +R T K +A+K I K  ++ K +      E  VL ++N P IV LK
Sbjct: 197 IVGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFDGVKR--ELDVLQKLNHPRIVKLK 254

Query: 410 FSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDL 469
             F+  +  Y+++  ++GG+L   +   G       R  T ++L A++ +H+  + +RDL
Sbjct: 255 DFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEAVKYMHDQGISHRDL 314

Query: 470 KPENILLDYQGH--IALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQG-------- 519
           KP+NI+++      I + DFGL K+  ++    +TFCGT  Y+APE++  +         
Sbjct: 315 KPDNIMIEQDDPVLIKITDFGLAKVQNQNT-FLNTFCGTLAYVAPEVIDGKNAEDKTNRD 373

Query: 520 -YSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEG------FDRDAKD 572
            YS +VD W++G L+Y +LTG  P+  +   +++++I +    + EG         +A++
Sbjct: 374 LYSSLVDMWSIGCLVYVILTGHLPFSGQSQNELFKQIKRGS--YHEGPLKDYRISEEARN 431

Query: 573 LLIGLLSRDPDRRLGCNGAHEIKNHPFF 600
            +  LL+ DP  R+    A +   HP+ 
Sbjct: 432 FIDCLLNVDPKERMNAGKALQ---HPWM 456

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score =  124 bits (311), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 84/283 (29%), Positives = 145/283 (51%), Gaps = 27/283 (9%)

Query: 341 TIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYI----VSKSEVTHTLA---- 392
           TI  + L + +G GS GKV   R   T +  A+K I K+      VS + +  +      
Sbjct: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74

Query: 393 ------ERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRAR 446
                 E  ++  +N P ++ L   +++   LYLVL     GELF  L + G      A 
Sbjct: 75  PYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAI 134

Query: 447 FYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGT 506
            +  +++  +   H L +++RDLKPEN+LLD++ +I + DFG+  L  + +   +T CG+
Sbjct: 135 RFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGK-LLETSCGS 193

Query: 507 PEYLAPELLLN---QGYSKVVDWWTLGILLYEMLTGLPPYYDED--VPKMYRKILQDPLR 561
           P Y APE++     QG++   D W+ G++L+ +LTG  P+ +ED  +  +  K+ +    
Sbjct: 194 PHYAAPEIVSGIPYQGFAS--DVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFE 251

Query: 562 FP--EGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQ 602
            P  +   R+A+DL+  +L+ DP+RR+      +I  HP   +
Sbjct: 252 MPSDDEISREAQDLIRKILTVDPERRIKT---RDILKHPLLQK 291

>Scas_564.7
          Length = 1210

 Score =  124 bits (311), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 84/298 (28%), Positives = 143/298 (47%), Gaps = 33/298 (11%)

Query: 333 KPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIR---KSYIVSKSEVTH 389
           +P +  R ++ D+D L+ +G GS GKV   R   T++I A+K +    K+++  +  +  
Sbjct: 150 EPKQFHRKSLGDWDFLETVGAGSMGKVKLARHHQTKEICAIKIVNRAMKAFLHKEQSMPP 209

Query: 390 TLAERTVLAR-----------------------VNCPFIVPLKFSFQSPEKLYLVLACIN 426
              E+ VL R                       +  P I  L          Y++   ++
Sbjct: 210 PRTEQEVLERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVS 269

Query: 427 GGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCD 486
           GG+L  ++ + G      AR +   +  ALE +H  ++++RDLK ENI++   G I + D
Sbjct: 270 GGQLLDYIIQHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMISTSGEIKIID 329

Query: 487 FGLCKLNMKDQDKT-DTFCGTPEYLAPELLLNQGYS-KVVDWWTLGILLYEMLTGLPPYY 544
           FGL   N+ D+ K   TFCG+  + APELL    Y+   VD W+ G++LY ++ G  P+ 
Sbjct: 330 FGLS--NVFDRKKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFD 387

Query: 545 DEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQ 602
           DE+   ++ KI Q  + +P     +   LL  +L  DP RR       ++  HP+ ++
Sbjct: 388 DENSSVLHEKIKQGKVDYPNHLSIEVISLLSKMLVVDPLRRASLK---QVVEHPWMTR 442

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score =  120 bits (301), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 78/261 (29%), Positives = 133/261 (50%), Gaps = 12/261 (4%)

Query: 349 KVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVPL 408
           + +G GSFG V + ++  + +  A+K + K  +     +     E  ++  ++ P IV  
Sbjct: 69  RTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEPIYDELNIIQHLDHPNIVKF 128

Query: 409 KFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRD 468
           K  F++  K Y+V    +GGELF  +  +G++    A     ++L A+E LH+ ++I+RD
Sbjct: 129 KDWFETESKFYIVTQLASGGELFDRIMHDGKYTEEDAVNIVVQILKAVEYLHSQNIIHRD 188

Query: 469 LKPENIL-LDYQ--GHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVD 525
           LKPEN+L LD      I L DFG+ +    D D      G+  Y+APE+  + G+ K  D
Sbjct: 189 LKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAPEVFTSDGHGKPSD 248

Query: 526 WWTLGILLYEMLTGLPPYYDEDVPKMYRKILQD--PLRFP----EGFDRDAKDLLIGLLS 579
            W++G++ Y +L G  P+  E V     ++  D  P++F     +G    AK+ ++ +L 
Sbjct: 249 IWSVGVITYTLLCGYSPFKAESVDGFLDEVTSDENPVKFQRPYWDGISELAKNFILRILD 308

Query: 580 RDPDRRLGCNGAHEIKNHPFF 600
            DP  R     A E+ N P+ 
Sbjct: 309 LDPACR---PSATELLNDPWI 326

>Scas_613.5
          Length = 517

 Score =  121 bits (303), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 90/299 (30%), Positives = 140/299 (46%), Gaps = 34/299 (11%)

Query: 333 KPSKNKRLTI-DDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTL 391
           K  + K+L+  D + L K +G G +  V +   + T +  A+K         + +     
Sbjct: 191 KIVRTKQLSFFDKYVLGKDLGSGHYATVKEGINKVTGQTVAVKIFHPQQNDDEKKSKQFR 250

Query: 392 AERTVLARVNCPFIVPLKFSFQSPE-----KLYLVLACINGGELFYHLQKEGRFELSRAR 446
            E  +L R++ P IV L   F  P      + YLVL  I+ GELF  + K+        +
Sbjct: 251 EETNILMRIHHPNIVNLLDFFIEPVSKSQIQKYLVLDKIDDGELFERIVKKTCLRQDETK 310

Query: 447 FYTAELLCALETLHNLDVIYRDLKPENILLDYQG-------------------HIALCDF 487
               ++L  L+ LH  ++I+RD+KPENILL+                       + + DF
Sbjct: 311 AIFNQILMGLKHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIADF 370

Query: 488 GLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDE- 546
           GL K   + Q  T+T CGTP Y+APE+L  +GY+  VD W+ G++LY  L G PP+ ++ 
Sbjct: 371 GLAKFTGEMQ-FTNTLCGTPSYVAPEVLTKKGYTSKVDMWSAGVILYVCLCGFPPFSEQL 429

Query: 547 DVPKMYRKILQDPLRFP----EGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFS 601
             P +  +ILQ    F     +  D +   L+  LL  D D R       +  NHP+F+
Sbjct: 430 GPPSLKEQILQAKFAFYTPYWDNIDDNVLHLISHLLVLDADARY---SVEDTINHPWFN 485

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score =  119 bits (299), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/247 (29%), Positives = 130/247 (52%), Gaps = 10/247 (4%)

Query: 349 KVIGKGSFGKVMQVRKRDTQKIYALKA-IRKSYIVSKSEVTHTLAERTVLARVNCPFIVP 407
           K +G G+FG V Q +  +T +  A+K  I+K+   +K ++     E  +L R++ P IV 
Sbjct: 41  KTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHPNIVA 100

Query: 408 LKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYR 467
            K  F+S +K Y++     GGELF  + K+G+F    A     E+L A++ +H+ ++++R
Sbjct: 101 FKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKYMHSQNIVHR 160

Query: 468 DLKPENILL---DYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVV 524
           DLKPEN+L      +  + + DFG+ K    D++      G+  Y+APE+L   G+ K  
Sbjct: 161 DLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVLTQDGHGKPC 220

Query: 525 DWWTLGILLYEMLTGLPPYYDEDVPKMYRKIL--QDPLRFP----EGFDRDAKDLLIGLL 578
           D W++G++ Y +L G   +  E V     +    + P++F     +     AK  ++  L
Sbjct: 221 DIWSIGVITYTLLCGYSAFRAERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFILKAL 280

Query: 579 SRDPDRR 585
           + DP +R
Sbjct: 281 NLDPSKR 287

>Scas_493.2
          Length = 1117

 Score =  121 bits (304), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 92/327 (28%), Positives = 156/327 (47%), Gaps = 41/327 (12%)

Query: 341 TIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSK--SEVTHTLA------ 392
           TI  + L + +G GS GKV       T +  A+K I KS   +K  S  T  +A      
Sbjct: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSL 77

Query: 393 ------ERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRAR 446
                 E  ++  +    ++ L   +++   LY++L     GELF  L ++G      A 
Sbjct: 78  PYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAV 137

Query: 447 FYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGT 506
            +  +++  +   H L +++RDLKPEN+LLD++ +I + DFG+  L  +D+   +T CG+
Sbjct: 138 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDK-LLETSCGS 196

Query: 507 PEYLAPELLLNQGYSKV-VDWWTLGILLYEMLTGLPPYYDED--VPKMYRKILQDPLRFP 563
           P Y APE++    Y     D W+ G++L+ +LTG  P+ +ED  +  +  K+       P
Sbjct: 197 PHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 256

Query: 564 EG--FDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPV 621
           +     RDA+DL+  +L+ DP +R+      EI  HP   +                P +
Sbjct: 257 DDDEMSRDAQDLISRILTVDPTKRIKT---REILKHPLLQKY---------------PSI 298

Query: 622 SDAADTRNFDQEFTKEKPI---DSVVD 645
            D+   +N  +E T   P+   +SV+D
Sbjct: 299 KDSKSIKNLPREDTYLFPLSDNNSVID 325

>Scas_640.14*
          Length = 728

 Score =  120 bits (302), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 86/289 (29%), Positives = 146/289 (50%), Gaps = 25/289 (8%)

Query: 335 SKNKR--LTIDDFDLLKVIGKGSFGKV---------MQVRKRDTQKIYALKAIRKSYIVS 383
           S+NK+  +    + +   +G+G FGKV            +  +  K  A+K IR+ +I  
Sbjct: 26  SRNKKSHMKFGPYIVGATLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRDFIKK 85

Query: 384 KSEVTHTL-AERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFEL 442
            SE    +  E   L  +  P IV L+   Q+ + + +VL   +GGE + ++Q++ R + 
Sbjct: 86  GSEKEMKIFREINSLKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLKE 145

Query: 443 SRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDT 502
           + A    A+L+  +  +H+  +++RDLK EN+LLD   ++ + DFG       D +   T
Sbjct: 146 ATACRLFAQLISGVSYMHSKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNELMKT 205

Query: 503 FCGTPEYLAPELLL-NQGY-SKVVDWWTLGILLYEMLTGLPPYYD-------EDVPKMYR 553
            CG+P Y APEL++  + Y ++  D W+ GI+LY ML G  P+ D       ED+ ++Y 
Sbjct: 206 SCGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIVRLYH 265

Query: 554 KILQDPLRFPE-GFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFS 601
            I + PL+FP   +       L  +L  +P RR+    +  IK H + S
Sbjct: 266 YITKTPLKFPRIHYTTFLGICLRHILVSNPVRRM---SSRHIKKHEWLS 311

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score =  121 bits (303), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 91/320 (28%), Positives = 142/320 (44%), Gaps = 47/320 (14%)

Query: 334 PSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAI----------------- 376
           P    R ++ D+D L+ +G GS GKV   + R T ++ A+K +                 
Sbjct: 43  PKPFHRKSLGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKSFMHKQQLQGLP 102

Query: 377 -----------RKSYIVSKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACI 425
                      RK      S    T+ E ++   +  P I  L          Y++   +
Sbjct: 103 PPATEEELLERRKKLEKEVSRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYV 162

Query: 426 NGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALC 485
           +GG+L  ++ + G      AR +   +  AL+ LH  ++++RDLK ENI++   G I + 
Sbjct: 163 SGGQLLDYIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMISSSGEIRII 222

Query: 486 DFGLCKLNMKDQDKT-DTFCGTPEYLAPELLLNQGYS-KVVDWWTLGILLYEMLTGLPPY 543
           DFGL   NM D  K   TFCG+  + APELL    Y+   VD W+ G++LY ++ G  P+
Sbjct: 223 DFGLS--NMYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPF 280

Query: 544 YDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQL 603
            DE+   ++ KI Q  + +P+    D   LL  +L  DP +R                Q+
Sbjct: 281 DDENASVLHEKIKQGKVEYPQHLSIDVISLLSKMLVVDPYKRA------------TLKQV 328

Query: 604 SWKRLWNKGY-IPP--YKPP 620
              +   KGY  PP  Y PP
Sbjct: 329 VHHQWMQKGYDFPPPSYLPP 348

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score =  120 bits (302), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 80/264 (30%), Positives = 133/264 (50%), Gaps = 13/264 (4%)

Query: 336 KNKRLTIDDFDLLKVIGKGSFGKVM---QVRKRDTQKIYALKAIRKSYIVSKSEV-THTL 391
           + +++T   + +   +G+G FGKV         D  K  A+K IR+  I   SE      
Sbjct: 47  RRRQVTFGPYIIGPTLGEGEFGKVKLGWSKSNSDESKNVAIKLIRRDTIPKNSEKEVKIY 106

Query: 392 AERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAE 451
            E   L  +  P IV L+   Q+ + + +VL   +GGE + ++QK+ R +   A    A+
Sbjct: 107 REINALKHLAHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACRLFAQ 166

Query: 452 LLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLA 511
           L+  +  +H+  + +RDLK EN+LLD   ++ + DFG         D   T CG+P Y A
Sbjct: 167 LISGVHYMHHKGLAHRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKTSCGSPCYAA 226

Query: 512 PELLL-NQGY-SKVVDWWTLGILLYEMLTGL-------PPYYDEDVPKMYRKILQDPLRF 562
           PEL++  + Y ++  D W+ G++LY ML G             +D+ K+Y  I +  L+F
Sbjct: 227 PELVVTTKAYEARKADVWSCGVILYAMLAGYLPWDDDPDNPDGDDIAKLYNYITKTSLKF 286

Query: 563 PEGFDRDAKDLLIGLLSRDPDRRL 586
           PE  +   +D+L  +L  DP +R+
Sbjct: 287 PEYINPIPRDILRRILVSDPSKRI 310

>Scas_700.28
          Length = 896

 Score =  120 bits (302), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 80/261 (30%), Positives = 129/261 (49%), Gaps = 13/261 (4%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVN 401
           + ++ +L  IG+GSFGKV   + R T     LK+       S     + + E     + +
Sbjct: 35  VGNYKILDQIGEGSFGKVYLAQHRPTHTKVVLKS-------SDKNDPNIVREVFYHRQFD 87

Query: 402 CPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHN 461
            P+I  L     +  K+++ L    G EL+  +    R          A+++  +   H+
Sbjct: 88  YPYITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQLFAQIVGGVHYAHS 147

Query: 462 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYS 521
           L+ ++RDLK ENILLD  G   L DFG  +  M  +   +T CGT  Y+APEL+  + Y 
Sbjct: 148 LNCVHRDLKLENILLDKSGDAKLTDFGFTRECMT-KTTLETICGTTVYMAPELIERKSYD 206

Query: 522 KV-VDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGF-DRDAKDLLIGLLS 579
              +D W+LG++LY M+ G  P+ ++D  K   KI+    +  E     DAKDL++ LL+
Sbjct: 207 GFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENIVTADAKDLILRLLA 266

Query: 580 RDPDRRLGCNGAHEIKNHPFF 600
           ++P+ R       +I  HPF 
Sbjct: 267 KNPNDRPTV---EQILKHPFL 284

>Scas_700.54
          Length = 698

 Score =  120 bits (300), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 80/275 (29%), Positives = 142/275 (51%), Gaps = 24/275 (8%)

Query: 349 KVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVPL 408
           +V+G+G+F  V +  +R T K +A+K I K  ++   E      E  VL +++ P IV L
Sbjct: 227 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNMEGVSR--ELEVLQQLDHPRIVRL 284

Query: 409 KFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRD 468
           K  ++  +  Y+V+  ++GG+L   +   G       +  + ++L A++ +H+  + +RD
Sbjct: 285 KGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQILEAVKYIHSKGISHRD 344

Query: 469 LKPENILLDYQGH--IALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQG------- 519
           LKP+NIL++      + + DFGL K+   +     TFCGT  Y+APE++  +G       
Sbjct: 345 LKPDNILIEQDDPVLVKITDFGLAKVQ-GNGSFMKTFCGTLAYVAPEVIGGKGETNEERN 403

Query: 520 -YSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRD------AKD 572
            YS +VD W++G L+Y +LTG  P+      ++Y++I +    + EG  +D      A+ 
Sbjct: 404 EYSSLVDMWSMGCLVYVILTGHLPFSGSTQEQLYKQISRGS--YHEGPLKDFRISDEARS 461

Query: 573 LLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKR 607
            +  LL  +P  RL    A E   HP+     + +
Sbjct: 462 FIDSLLQVNPGNRLTAARALE---HPWIKMAQYSQ 493

>Kwal_23.3590
          Length = 499

 Score =  118 bits (296), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 87/299 (29%), Positives = 135/299 (45%), Gaps = 34/299 (11%)

Query: 333 KPSKNKRLTI-DDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTL 391
           +P  N+R +  D +   K +G G +  V +   +D+  + A+K     +   + +     
Sbjct: 173 RPLANRRPSFFDRYIAGKELGSGHYAIVKEAIDKDSGDVVAVKIFHAQHNDDQKKTKQFR 232

Query: 392 AERTVLARVNCPFIVPLKFSFQSPE-----KLYLVLACINGGELFYHLQKEGRFELSRAR 446
            E  +L  +    IV L   F  P      + +LVL  ++ GELF  + ++ R       
Sbjct: 233 EETKILMSIQHKNIVKLIDRFVEPVSKAQIQTFLVLEKVSDGELFDRIVRKTRLREDETN 292

Query: 447 FYTAELLCALETLHNLDVIYRDLKPENILLDYQGH-------------------IALCDF 487
               ++L  L  LH  ++I+RD+KPENILL  +                     I + DF
Sbjct: 293 AIFKQILNGLRYLHAKNIIHRDIKPENILLSIRKRRHSDEQQLGPWDDDEIDITIKIADF 352

Query: 488 GLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDED 547
           GL K  + +   T+T CGTP Y+APE+L   GY+  VD W+ G+LLY  L G PP+ ++ 
Sbjct: 353 GLAKF-IGEMQFTNTLCGTPSYVAPEVLTKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQL 411

Query: 548 V-PKMYRKILQDPLRFPEGFDRDAKD----LLIGLLSRDPDRRLGCNGAHEIKNHPFFS 601
             P M  +IL     F   +  D  D    L+  LL  +P  R       +  NHP+FS
Sbjct: 412 APPSMKEQILNGKFAFYSPYWDDIDDSCLHLISNLLVVNPAYRF---DVQKTINHPWFS 467

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score =  120 bits (301), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 132/261 (50%), Gaps = 13/261 (4%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVN 401
           + ++ + K IG+GSFGKV     R T++   LK   KS         + + E     + +
Sbjct: 39  VGNYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKS-------DPNVVREVFYHRQFD 91

Query: 402 CPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHN 461
            P+I  L     +  K+++ L    G EL+ HL  + R          A++  A+   H 
Sbjct: 92  YPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELFAQITGAVHYAHT 151

Query: 462 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYS 521
           L+ ++RDLK EN+LLD  G+  L DFG  + +M  +   +T CGT  Y+APE++ ++ Y 
Sbjct: 152 LNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMT-KAVLETVCGTTVYMAPEMIQHKPYD 210

Query: 522 KV-VDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFD-RDAKDLLIGLLS 579
              VD W+LG++LY +L G  P+ ++D     +KI+ D     E     +A++L+  LLS
Sbjct: 211 GFKVDIWSLGVILYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERITIPEAQNLIEQLLS 270

Query: 580 RDPDRRLGCNGAHEIKNHPFF 600
           +DP  R   +    I  HPF 
Sbjct: 271 KDPTERPNTSA---ILLHPFL 288

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score =  119 bits (299), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 79/249 (31%), Positives = 126/249 (50%), Gaps = 9/249 (3%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARV-NCP 403
           F   +VIG+G FG V +     T+++YA+K +  +   S+ EV     E   LA +   P
Sbjct: 16  FKRTEVIGRGKFGIVYKGYHVKTKQVYAIKVL--NLDSSEDEVEDVQREIQFLASLKQIP 73

Query: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463
            I     S+     L++++    GG L   L + G+ +         ELL AL+ +H  +
Sbjct: 74  NITRYYGSYLRGTSLWIIMEYCAGGSL-RSLLRPGKIDEKYIGVIMRELLVALKVIHKDN 132

Query: 464 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQG--YS 521
           VI+RD+K  N+L+  +G + LCDFG+     +   +  T  GTP ++APE+++ +G  Y 
Sbjct: 133 VIHRDIKAANVLITNEGQVKLCDFGVAAQLNQTSLRRQTMAGTPYWMAPEVIM-EGVYYD 191

Query: 522 KVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQD-PLRFPE-GFDRDAKDLLIGLLS 579
             VD W+LGI  YE+ TG PPY D +  +  + I++  P R  E  +    K+ +   L 
Sbjct: 192 TKVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLD 251

Query: 580 RDPDRRLGC 588
            DP  RL  
Sbjct: 252 EDPQERLSA 260

>Scas_201.1*
          Length = 274

 Score =  112 bits (281), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/218 (32%), Positives = 119/218 (54%), Gaps = 6/218 (2%)

Query: 355 SFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARVNCPFIVPLKFSFQ 413
           +FG V Q R+  +Q+  A+K + K+ +         L  E ++L R++ P IV  K  F+
Sbjct: 45  TFGVVRQARQFFSQEAVAVKILLKNALKGNDVQLQMLYDELSILQRLHHPNIVAFKDWFE 104

Query: 414 SPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPEN 473
           S +K Y+V     GGELF  + K+G+F    A     +LL A++ +H+ ++++RDLKPEN
Sbjct: 105 SRDKFYIVTQLATGGELFDRIIKKGKFTEVDAVNIMVQLLDAVKYIHSQNIVHRDLKPEN 164

Query: 474 IL-LDY--QGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLG 530
           +L LD   +  + + DFG+ K    + D      G+  Y+APE+L  +G+ K  D W+LG
Sbjct: 165 VLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGYVAPEVLTKEGHGKPCDIWSLG 224

Query: 531 ILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDR 568
           ++ Y +L+G  P+  E V     +  +   R+P  F +
Sbjct: 225 VITYTLLSGYSPFIAESVEGFLEECTRS--RYPVQFHK 260

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score =  119 bits (297), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 138/276 (50%), Gaps = 32/276 (11%)

Query: 339 RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIR---KSYIVSKSEV-------- 387
           R ++  +D ++ +G GS GKV   + +++ ++ A+K +    K+Y+    ++        
Sbjct: 61  RKSLSGWDFMETVGAGSMGKVKLAKNKNSNEVCAIKIVHRATKAYMHKAQQLPPPADENE 120

Query: 388 ---------------THTLAERTVLARVNCPFIVPLKFSFQS-PEKLYLVLACINGGELF 431
                            T+ E ++   +  P +  L +  Q+     Y+    I+GG+L 
Sbjct: 121 AKERQKRLNKEISRDKRTVREASLGQILFHPNVCKL-YEMQTLSNHYYMFFEFISGGQLL 179

Query: 432 YHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCK 491
            ++ + G  + + AR  +  +L AL+ LH  ++++RDLK ENI+L   G I L DFGL  
Sbjct: 180 DYIIQHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSKTGEIKLIDFGLS- 238

Query: 492 LNMKDQDKT-DTFCGTPEYLAPELLLNQGY-SKVVDWWTLGILLYEMLTGLPPYYDEDVP 549
            NM D  K+  TFCG+  + APELL    Y    VD W+ G++LY ++ G  P+ DE+  
Sbjct: 239 -NMYDPRKSLQTFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDENSS 297

Query: 550 KMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDRR 585
            ++ KI +  + +P+    D   LL  +L  DP +R
Sbjct: 298 ALHEKIKKGKVTYPQFLSIDVISLLSKILVVDPQKR 333

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score =  118 bits (296), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/282 (27%), Positives = 135/282 (47%), Gaps = 32/282 (11%)

Query: 339 RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIR---KSYIVSKSEVTHTLAERT 395
           R ++ D+D L+ +G GS GKV   + R T ++ A+K +    KSY+  ++++     E  
Sbjct: 92  RKSLGDWDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRAAKSYMHKQNQLPPPKTEEE 151

Query: 396 VLAR-----------------------VNCPFIVPLKFSFQSPEKLYLVLACINGGELFY 432
           ++ R                       +  P I  L          Y++   ++GG+L  
Sbjct: 152 LMERKKKLEKELSRDRRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 211

Query: 433 HLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKL 492
           ++ + G      AR +   +  AL+ LH  ++++RDLK ENI++   G I + DFGL  L
Sbjct: 212 YIIQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSNL 271

Query: 493 NMKDQDKTDTFCGTPEYLAPELLLNQGY-SKVVDWWTLGILLYEMLTGLPPYYDEDVPKM 551
              ++ +  TFCG+  + APELL    Y    VD W+ G+++Y ++ G  P+ DE+   +
Sbjct: 272 -YDNKKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDDENASVL 330

Query: 552 YRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLG----CN 589
           + KI +  + +P+    +   LL  +L  DP +R      CN
Sbjct: 331 HEKIKKGKVEYPQHLSIECISLLSKMLVVDPLKRASLKQVCN 372

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score =  118 bits (295), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 137/292 (46%), Gaps = 33/292 (11%)

Query: 339 RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIR---KSYIVSKSEVTHTLAERT 395
           R ++ D+D L+ +G GS GKV   + R T ++ A+K +    K+++  +      +  + 
Sbjct: 102 RKSLGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQE 161

Query: 396 VLARVN-----------------------CPFIVPLKFSFQSPEKLYLVLACINGGELFY 432
           ++ R                          P I  L          Y++   + GG+L  
Sbjct: 162 IMERQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLD 221

Query: 433 HLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKL 492
           ++ + G      AR +   +  AL+ LH  ++++RDLK ENI++   G I + DFGL   
Sbjct: 222 YIIQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLS-- 279

Query: 493 NMKDQDKT-DTFCGTPEYLAPELLLNQGYS-KVVDWWTLGILLYEMLTGLPPYYDEDVPK 550
           N+ D  K   TFCG+  + APELL    Y+   VD W+ G++LY ++ G  P+ DE+   
Sbjct: 280 NVYDTRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV 339

Query: 551 MYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQ 602
           ++ KI +  + +P+    +   LL  +L  DP RR       ++  HP+ ++
Sbjct: 340 LHEKIKRGKVEYPQHLSIEVMSLLSKMLVVDPSRRASLK---QVVEHPWMTK 388

>Scas_713.7
          Length = 983

 Score =  117 bits (293), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 85/269 (31%), Positives = 134/269 (49%), Gaps = 15/269 (5%)

Query: 334 PSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAE 393
           P+KNK +    + L +VIGKGS+G V +   + T +I A+K +      +  E+   + E
Sbjct: 18  PNKNKSV---QYQLKQVIGKGSYGVVYKAVNKKTLQIVAIKEVNYD---NDDELIEIMTE 71

Query: 394 RTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQ--KEGRFELSRARFYTAE 451
             +L  +N   IV      Q    LY++L   + G L   L   K+G  EL  A+ Y  +
Sbjct: 72  IDLLKNLNHVNIVKYHGFIQKSSNLYIILEFCSKGSLKNLLTGYKDGIPELD-AKVYIRQ 130

Query: 452 LLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLA 511
            L  L  LH   VI+RD+K  N+LLD    + L DFG+   + K  +   T  G+  +++
Sbjct: 131 TLNGLVYLHEQGVIHRDIKAANLLLDSNDVVKLADFGV---STKVSNTAMTLAGSLHWMS 187

Query: 512 PELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAK 571
           PE++ N+G S + D W+LG  + E++TG PP+Y      +Y  I  DP   PE    +AK
Sbjct: 188 PEIIGNRGASTLSDIWSLGATVVELVTGNPPFYKLVDVNIYYAIENDPFIPPEFLSNEAK 247

Query: 572 DLLIGLLSRDPDRRLGCNGAHEIKNHPFF 600
           D L     ++  +R     A ++  HP+ 
Sbjct: 248 DFLKKCFQKNMYKR---PTAKKLLKHPWL 273

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score =  117 bits (294), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 99/155 (63%), Gaps = 1/155 (0%)

Query: 341 TIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVL-AR 399
           +I D+D++K I KG++G V   RK+ T   +A+K +RKS +++K++VT+  +ER ++  +
Sbjct: 778 SIKDYDIIKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQ 837

Query: 400 VNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETL 459
            + P++  L  +FQ+ + L+LV+  + GG+L   L+  G       + Y +E++  +E +
Sbjct: 838 SDKPYVARLYATFQNKDNLFLVMEYLPGGDLATLLKMMGCLPDEWVKQYLSEIIIGVEDM 897

Query: 460 HNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 494
           HN  +I+ DLKPEN+L+D  GH+ L DFGL +  +
Sbjct: 898 HNNGIIHHDLKPENLLIDVSGHLKLTDFGLSRAGL 932

 Score =  116 bits (291), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 93/172 (54%), Gaps = 17/172 (9%)

Query: 489  LCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDV 548
            L   N +D  +   F GTP+YLAPE +   G     DWW++G +L+EM+ G PP++ E  
Sbjct: 1089 LILFNPEDSKQDKRFFGTPDYLAPETIEGTGEDNQCDWWSVGCILFEMVFGYPPFHAETP 1148

Query: 549  PKMYRKILQDPLRFP---------EGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPF 599
             +++R IL+  + +P         E    +AKDL++  L  DP +RLG NG  EIKNHP+
Sbjct: 1149 DQVFRNILEGKIDWPIFDSIEEEREYISPEAKDLIMKFLITDPHKRLGYNGTEEIKNHPY 1208

Query: 600  FSQLSWKRLWNKGYIPPYKPPVSDAADTRNFD------QEFTKEKPIDSVVD 645
            F  + W  ++++     Y P + D  DT  FD      Q+F  +   D+V++
Sbjct: 1209 FKDVKWDHVYDE--TASYVPNIEDPEDTDYFDLRGATLQDFGDDNDEDAVLE 1258

>Kwal_26.8751
          Length = 848

 Score =  116 bits (291), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 90/309 (29%), Positives = 144/309 (46%), Gaps = 54/309 (17%)

Query: 325 RINISVDYKP-----SKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKS 379
           + NIS  Y       S N+   + ++ +LK++G+GSFGKV                    
Sbjct: 12  KANISASYNKLYGQFSLNELQEVGNYKILKIVGEGSFGKV-------------------- 51

Query: 380 YIVSKSEVTHTLAERTVLARV---NCPFIV-----PLKFSFQSPEKLYLVLACIN----- 426
           Y+ S     H L  + V+ ++   N P +V       +F +    KLY V+   N     
Sbjct: 52  YLAS-----HCLTHQKVVLKMGSKNDPNVVREVFYHRQFDYSHITKLYEVIVTENYVWMA 106

Query: 427 -----GGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGH 481
                G EL+ +L  +    L       ++++ A+   H++  ++RDLK ENILLD +GH
Sbjct: 107 LEYCPGKELYEYLLAKKHIPLEECSELFSQIVGAVYYAHSMKCVHRDLKLENILLDKKGH 166

Query: 482 IALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKV-VDWWTLGILLYEMLTGL 540
             L DFG  +     +   +T CGT  Y+APEL+  + Y    +D W+LGI+LY M+ G 
Sbjct: 167 AKLTDFGFTR-ECATKGILETICGTTVYMAPELIERKPYEGYKIDTWSLGIILYTMIHGT 225

Query: 541 PPYYDEDVPKMYRKILQ-DPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPF 599
            P+ + D  K   KI+  +P    +  D + K+L+  LL +DP++R       ++  HPF
Sbjct: 226 MPFDEVDEVKTKYKIVHYNPTYDNDYIDSNGKELISQLLEKDPNQRPSLT---QVLQHPF 282

Query: 600 FSQLSWKRL 608
                 K L
Sbjct: 283 LQPYGLKIL 291

>Kwal_47.17252
          Length = 872

 Score =  116 bits (290), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 90/346 (26%), Positives = 160/346 (46%), Gaps = 62/346 (17%)

Query: 343 DDFDLLKVIGKGSFGKVMQVR---KRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLAR 399
           D + + + IGKGSF  V + R    RD     A+KA+ +S + +K  + +   E  +L +
Sbjct: 18  DKYLVQQEIGKGSFATVYKGRIASNRDLNDFIAIKAVSRSKLKNKKLLENLEIEIAILKK 77

Query: 400 VNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEG----RFELSRARF-------- 447
           +  P IV L    ++    +L++     G+L + ++K G    +  L R  F        
Sbjct: 78  IKHPHIVGLMDCERTGADFFLIMEYCALGDLTFLIKKRGGLIEKHPLVRTMFEKYPPPSE 137

Query: 448 ------------YTAELLCALETLHNLDVIYRDLKPENILL-----DYQGH--------- 481
                       Y  +L  AL  L + ++++RD+KP+N+LL     +Y            
Sbjct: 138 SHNGLNRVVVVSYLQQLSSALMFLRSKNLVHRDIKPQNLLLSTPLVNYSDRETFHKMGFV 197

Query: 482 -------IALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLY 534
                  + + DFG  +  + +    +T CG+P Y+APE+L  Q Y+   D W++G +LY
Sbjct: 198 GIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILDYQKYNAKADLWSVGTVLY 256

Query: 535 EMLTGLPPYYDEDVPKMYRKI--LQDPLRFPE--GFDRDAKDLLIGLLSRDPDRRLGCNG 590
           EM  G PP+   +  ++++KI    D + FP     D   ++L+ GLL+ DP +R+G N 
Sbjct: 257 EMCCGRPPFKASNHLELFKKIKRANDVISFPTHCKVDPQMRELICGLLTFDPSQRMGFNE 316

Query: 591 --AHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEF 634
             ++E+ N            + + +IP  +    D A++  F  E+
Sbjct: 317 FFSNEVVNEDLSP-------YEEEHIPDLENKSKDVAESNMFISEY 355

>KLLA0F09020g 836287..839073 weakly similar to sp|P43565
           Saccharomyces cerevisiae YFL033c RIM15 protein kinase
           involved in expression of meiotic genes, start by
           similarity
          Length = 928

 Score =  115 bits (289), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 52/155 (33%), Positives = 101/155 (65%), Gaps = 1/155 (0%)

Query: 341 TIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVL-AR 399
           +I D+D++K I KG++G V   +KR T + +A+K ++KS +++K++VT+  +ER ++  +
Sbjct: 698 SIRDYDVIKPISKGAYGSVYLAKKRVTGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQ 757

Query: 400 VNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETL 459
            + P++  L  +FQ+ E L+LV+  ++GG++   ++  G      A+ Y  E++  ++ +
Sbjct: 758 SDKPYVARLYATFQNKENLFLVMQYLSGGDMATLIKMMGNLPEKWAKQYICEVISGVDDM 817

Query: 460 HNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 494
           H   +I+ DLKP+N+L+D  GHI L DFGL ++ +
Sbjct: 818 HQNGIIHHDLKPDNLLIDSLGHIKLTDFGLSRMGL 852

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score =  113 bits (282), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 85/276 (30%), Positives = 122/276 (44%), Gaps = 32/276 (11%)

Query: 349 KVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVPL 408
           K +G G +  V +   + T +  A+K           +      E  +L  +N   IV L
Sbjct: 159 KELGSGHYAIVKEAINKITGQSVAVKIFHPQKNDDAKKTRQFREETKILMGLNHENIVKL 218

Query: 409 KFSFQSP-----EKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463
              F  P      + YLVL  I  GELF  + ++ +      R    ++L  L+ LH+ +
Sbjct: 219 LERFVEPLSKSQVQTYLVLEKIQDGELFDKIVRKTKLHQDETRALFKQILAGLKYLHDRN 278

Query: 464 VIYRDLKPENILLDYQGH-------------------IALCDFGLCKLNMKDQDKTDTFC 504
           +I+RD+KPENILL  +                     + + DFGL K   + Q  T T C
Sbjct: 279 IIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAKFTGEMQFTT-TLC 337

Query: 505 GTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDV-PKMYRKILQDPLRFP 563
           GTP Y+A E+L   GY+  VD W+ G+LLY  L G PP+ D+   P M  +ILQ    F 
Sbjct: 338 GTPSYVAAEVLTKTGYTSKVDLWSAGVLLYVCLCGFPPFSDQLAPPSMKEQILQGKFAFY 397

Query: 564 EGF----DRDAKDLLIGLLSRDPDRRLGCNGA--HE 593
             +    D     L+  LL  DP +R     A  HE
Sbjct: 398 SPYWDEIDDSVLHLISNLLVVDPAKRYSVRDAIGHE 433

>KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 633

 Score =  114 bits (285), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 55/149 (36%), Positives = 87/149 (58%), Gaps = 11/149 (7%)

Query: 492 LNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKM 551
           L++ + +++  F GTP+YLAPE +   G S   DWW++G + +E L G PP++   V ++
Sbjct: 52  LSLFNPNESKNFFGTPDYLAPETIKGTGESDTCDWWSVGCIFFEFLFGYPPFHGTTVDEV 111

Query: 552 YRKILQDPLRFPEGFDR---------DAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQ 602
           +  I+   +R+PE  D          DAKDL+I LL  DP++RLG +G+ EIK HP+F  
Sbjct: 112 FENIIGGVIRWPEFPDAETEMEYISPDAKDLVIKLLVLDPNKRLGASGSQEIKEHPYFKD 171

Query: 603 LSWKRLWNKGYIPPYKPPVSDAADTRNFD 631
           + W  ++++   P + P V    DT  FD
Sbjct: 172 VDWDHVYDEQ--PSFVPRVEHPEDTEYFD 198

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score =  113 bits (282), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 87/286 (30%), Positives = 144/286 (50%), Gaps = 35/286 (12%)

Query: 341 TIDDFDLLKVIGKGSFGKVMQVR-KRDTQKIYALKAIR---------KSYIVSKSEVTHT 390
            I D +L   IG+GSFG V   R K D+  + A+K +              VS+  V H+
Sbjct: 10  VIKDVELGGTIGEGSFGCVRSARLKFDSSVVVAVKFVHLPTCAESGLSQKDVSREVVLHS 69

Query: 391 LAER--TVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFY 448
              +   VL  ++C             E L+++L   +GG+LF  ++ +   +   A+FY
Sbjct: 70  KCSKHANVLRVIDCNV---------GGEYLWIMLEMADGGDLFDKIEPDVGVDPDVAQFY 120

Query: 449 TAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFC---- 504
             +L+ AL  LH++ V +RD+KPENILLD +G++ L DFGL     + +D T        
Sbjct: 121 FQQLIRALNYLHDVGVAHRDIKPENILLDKKGNLKLADFGLAS-QFRRKDGTLRVSTDQR 179

Query: 505 GTPEYLAPELLLNQG-YSKVVDWWTLGILLYEMLTG-----LPPYYDEDVPKMYRKILQD 558
           G+P Y+APE+L +QG Y+ + D W+ G+LL+ +LTG     +P   D++         + 
Sbjct: 180 GSPPYMAPEILSSQGYYANITDIWSAGVLLFVLLTGEIPWSIPAKEDDNYEWFVNNEGKV 239

Query: 559 PLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLS 604
            L   E  +    +LL  +L  DP +R+      ++++HP+ +  S
Sbjct: 240 SLGPWERVELRQMNLLRKILQPDPRKRVSL---EKLRHHPWLTSRS 282

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score =  114 bits (286), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 82/275 (29%), Positives = 135/275 (49%), Gaps = 17/275 (6%)

Query: 341 TIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSK-------SEVTHTLAE 393
           TI  + L + +G GS GKV   +   T    A+K I KS   +        S + + +  
Sbjct: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIER 76

Query: 394 RTVLARV-NCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAEL 452
             V+ ++ + P ++ L   +++   LYL+L     GELF  L   G      A     ++
Sbjct: 77  EIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQI 136

Query: 453 LCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAP 512
           +  +   H L +++RDLKPEN+LLD   +I + DFG+  L   D D  +T CG+P Y AP
Sbjct: 137 IIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQT-DADLLETSCGSPHYAAP 195

Query: 513 ELLLNQGYSKVV-DWWTLGILLYEMLTGLPPYYDE--DVPKMYRKILQDPLRFPEG--FD 567
           E++    Y     D W+ G++L+ +LTG  P+ +E  +V  +  K+ +     P      
Sbjct: 196 EIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEIS 255

Query: 568 RDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQ 602
           RDA+DL+  +L  DP +R+      +I +HP   +
Sbjct: 256 RDAQDLIGKILVVDPRQRIKI---RDILSHPLLKK 287

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score =  115 bits (287), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 97/155 (62%), Gaps = 1/155 (0%)

Query: 341 TIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVL-AR 399
           +I D+D+LK I KG++G V   RK+ T   +A+K +RKS +++K++VT+  +ER ++  +
Sbjct: 790 SIKDYDILKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQ 849

Query: 400 VNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETL 459
            + P++  L  SFQ+ + L+LV+  + GG+L   ++  G      A+ Y  E++  +  +
Sbjct: 850 SDKPYVARLFASFQNKDNLFLVMEYLPGGDLATLIKMMGYLPDQWAKQYLTEIVVGVNDM 909

Query: 460 HNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 494
           H   +I+ DLKPEN+L+D  GH+ L DFGL +  +
Sbjct: 910 HQNGIIHHDLKPENLLIDNAGHVKLTDFGLSRAGL 944

 Score =  102 bits (253), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 83/146 (56%), Gaps = 12/146 (8%)

Query: 496  DQDKTDTFCGTPEYLAPELLLNQGY-SKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRK 554
            D  +   F GTP+YLAPE +  +G  +K  DWW++G + +E+L G PP++ E    +++K
Sbjct: 1140 DSKQNKKFFGTPDYLAPETIEGKGEDNKQCDWWSVGCIFFELLLGYPPFHAETPDAVFKK 1199

Query: 555  ILQDPLRFPEGFDR---------DAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSW 605
            IL   +++PE  +          +AKDL+  LL  DP +RLG  G  EIK+HP+F  + W
Sbjct: 1200 ILSGVIQWPEFKNEEEEREFLTPEAKDLIEKLLVVDPAKRLGAKGIQEIKDHPYFKNVDW 1259

Query: 606  KRLWNKGYIPPYKPPVSDAADTRNFD 631
              ++++     + P + +  DT  FD
Sbjct: 1260 DHVYDEEA--SFVPTIDNPEDTDYFD 1283

>ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH]
           complement(731433..736142) [4710 bp, 1569 aa]
          Length = 1569

 Score =  115 bits (287), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 101/160 (63%), Gaps = 1/160 (0%)

Query: 341 TIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVL-AR 399
           +I D+D++K I KG++G V    KR T + +A+K +RKS +++K++VT+  +ER ++  +
Sbjct: 678 SIKDYDIIKPISKGAYGSVYLAYKRITGEYFAIKVLRKSDMIAKNQVTNVKSERVIMMVQ 737

Query: 400 VNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETL 459
              P++  L  +FQ+ E L+LV+  ++GG+L   ++  G      A+ Y  E++  ++ +
Sbjct: 738 SEKPYVAKLYATFQNKENLFLVMEYLSGGDLATLIKMMGNLPDKWAKQYITEVIIGVDDM 797

Query: 460 HNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDK 499
           H   +I+ DLKP+N+L+D  GH+ L DFGL ++ +  + K
Sbjct: 798 HMSGIIHHDLKPDNLLIDSNGHVKLTDFGLSRIGLIQRHK 837

 Score =  114 bits (286), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 85/145 (58%), Gaps = 11/145 (7%)

Query: 496  DQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKI 555
            D+D +  F GTP+YL+PE +L  G S   DWW++G +L+E L G PP++   V  +++ I
Sbjct: 994  DEDGSRRFFGTPDYLSPETILGTGESGASDWWSVGCILFEFLLGYPPFHASTVEDVFKNI 1053

Query: 556  LQDPLRFP---------EGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWK 606
            L   + +P         E    +AKDL++ LL  +P+ RLG NGA EIK HP+F  ++W 
Sbjct: 1054 LSGQIDWPSFPNKETELEYLSPEAKDLILKLLESNPEERLGANGAQEIKEHPYFKGINWS 1113

Query: 607  RLWNKGYIPPYKPPVSDAADTRNFD 631
            +++++     + P V +  DT  FD
Sbjct: 1114 KVYDEEA--SFVPTVDNPEDTDYFD 1136

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score =  112 bits (280), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 121/246 (49%), Gaps = 8/246 (3%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPF 404
           + +   IG+G+FG V +   R TQ+I A+K +   +  S  ++     E   LA +  P 
Sbjct: 18  YSIQSCIGRGNFGDVYKAVDRVTQEIVAIKVVNLEH--SDEDIELLAQEIFFLAELKSPL 75

Query: 405 IVPLKFSFQSPEKLYLVLACINGGELFYHLQKE--GRFELSRARFYTAELLCALETLHNL 462
           I     +      +++V+    GG     L++         +  F   E+   L+ LH  
Sbjct: 76  ITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQ 135

Query: 463 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQ--GY 520
             I+RD+K  NILL+ +G + L DFG+   +++   K DTF GTP ++APE++  +  GY
Sbjct: 136 RKIHRDIKAANILLNEEGMVKLGDFGVSG-HIRSTLKRDTFVGTPYWMAPEVVCCEVDGY 194

Query: 521 SKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKI-LQDPLRFPEGFDRDAKDLLIGLLS 579
           ++  D W+LGI  YE+L GLPP    D  K+   +  + P +    F   AKD + G L 
Sbjct: 195 NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSDAAKDFVAGCLV 254

Query: 580 RDPDRR 585
           + P  R
Sbjct: 255 KTPADR 260

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score =  114 bits (285), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 127/252 (50%), Gaps = 11/252 (4%)

Query: 340 LTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLAR 399
           LT   F   +VIG+G FG V +     T+++YA+K +  +    + EV     E   LA 
Sbjct: 20  LTPQLFKRTEVIGRGKFGVVYKAYHAKTKQVYAVKVL--NLDCPEDEVEDVQKEIQFLAS 77

Query: 400 V-NCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALET 458
           +   P I     S+    KL++++    GG L   L + G+ +         +LL AL  
Sbjct: 78  LKQVPNITRYYGSYLYDTKLWVIMEYCAGGSL-RTLLRPGKIDEKYLGVIVRKLLIALVY 136

Query: 459 LHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQ 518
           +H  +VI+RD+K  N+L+  +GH+ LCDFG+         K  T  GTP ++APE+++ +
Sbjct: 137 IHKDNVIHRDIKAANVLITNEGHVKLCDFGVAAQLTAANHKRQTMAGTPYWMAPEVIM-E 195

Query: 519 G--YSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQD-PLRFPEGFDRDA--KDL 573
           G  Y+   D W+LGI  YE+ TG PPY D +  +  + I +  P R  EG +     K+ 
Sbjct: 196 GVYYNTKADIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRL-EGRNYSPLLKEF 254

Query: 574 LIGLLSRDPDRR 585
           +   L  DP+ R
Sbjct: 255 IALCLDEDPEER 266

>Kwal_14.1159
          Length = 1521

 Score =  114 bits (286), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 101/155 (65%), Gaps = 1/155 (0%)

Query: 341 TIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVL-AR 399
           +I D+D++K I KG++G V   ++R T + +A+K ++KS +++K++VT+  +ER ++  +
Sbjct: 673 SIKDYDVIKPISKGAYGSVFLAKRRITGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQ 732

Query: 400 VNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETL 459
            N P++  L  +FQ+   L+LV+  ++GG+L   ++  G       + Y +E++  +E +
Sbjct: 733 SNKPYVAKLYATFQNRGNLFLVMEYLSGGDLGTLIKMMGSLPDQWVKQYISEVIYGVEDM 792

Query: 460 HNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 494
           H   +I+ DLKP+N+L+D +GH+ L DFGL ++ +
Sbjct: 793 HQSGIIHHDLKPDNLLIDQRGHLKLTDFGLSRMGL 827

 Score =  100 bits (248), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 11/135 (8%)

Query: 499  KTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQD 558
            K   F GTP+YLAPE +   G +   DWW++G +L+E + G PP++   V +++  IL  
Sbjct: 954  KNKKFFGTPDYLAPETIEGTGETDSSDWWSVGCMLFEFVFGYPPFHASTVEEVFSNILAG 1013

Query: 559  PLRFP----EGFDR-----DAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRLW 609
             + +P    E  +R     +A+DL+  LL  DPD+RLG NGA EI  HP+F  + W+ L+
Sbjct: 1014 NIDWPAFPDEATEREYISPEARDLIEKLLVVDPDKRLGANGAEEIFEHPYFQDVDWENLY 1073

Query: 610  NK--GYIPPYKPPVS 622
                 ++P    P S
Sbjct: 1074 KDTGSFVPDIAHPES 1088

>KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces
           cerevisiae YGL180w APG1 essential for autophagocytosis,
           start by similarity
          Length = 831

 Score =  113 bits (282), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 101/396 (25%), Positives = 179/396 (45%), Gaps = 65/396 (16%)

Query: 335 SKNKRLTIDDFDLLKVIGKGSFGKVMQ-VRKRDTQKIYALKAIRKSYIVSKSEVTHTLAE 393
           +K  RL  +++ + K IGKGSF  V + +  RD + I A+KA+ +S + +K  + +   E
Sbjct: 11  AKAIRLPTENYSVEKEIGKGSFAVVYKGLSLRDGRNI-AIKAVSRSKLKNKKLLENLEVE 69

Query: 394 RTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARF------ 447
             +L ++  P IV L    ++    YL++     G+L + ++K     L           
Sbjct: 70  IAILKKIKHPHIVGLIDCERTSSDFYLIMEYCALGDLTFFIKKRKNLVLKHPLIKTVFEH 129

Query: 448 ------------------YTAELLCALETLHNLDVIYRDLKPENILL-----DYQ----- 479
                             Y  +L  AL+ L + ++++RD+KP+N+LL     DY      
Sbjct: 130 YPPPSTEHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLLDYNDPKTF 189

Query: 480 ---GHIAL--------CDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWT 528
              G + +         DFG  +  + +    +T CG+P Y+APE+L  Q Y+   D W+
Sbjct: 190 HELGFVGIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNAKADLWS 248

Query: 529 LGILLYEMLTGLPPYYDEDVPKMYRKI--LQDPLRFPEGFDRDAK--DLLIGLLSRDPDR 584
           +G +LYEM  G PP+   +  ++++KI    D +  P     + K  +L+ GLL+ DPD 
Sbjct: 249 VGTVLYEMCCGRPPFKASNHLELFQKIKKANDEITVPSNCYIEPKLFNLIRGLLTFDPDS 308

Query: 585 RLGCNGAHEIKNHPFFSQLSWKRL--WNKGYIPPYKPPVSDAADTRNFDQEF----TKEK 638
           R+G           F +++  + L  + + Y P  +    D A++  F  E+     K++
Sbjct: 309 RMGFTDF-------FNNEVVTEDLTRYEQSYEPDLESKSKDVAESNMFVSEYLVKPLKQQ 361

Query: 639 PIDSVVDEYLSESVQKQFGGWTYVGSEQLGTSMEPN 674
               +      E+   Q G     G E+L T+  P+
Sbjct: 362 ESAHIPPTQTDENTSVQTGVRRTSGKERLATNHPPH 397

>Scas_573.10
          Length = 569

 Score =  111 bits (277), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 91/316 (28%), Positives = 145/316 (45%), Gaps = 70/316 (22%)

Query: 338 KRLTIDDFDLLKVIGKGSFGKVMQ-VRKR--------DTQKIYALKAIRKSYIVS---KS 385
           +++ +  + L++ +G+G+F KV + V +R        +  K  A+K I+K+ +V    K+
Sbjct: 112 EQVELQGYTLIEKVGEGAFSKVFRAVPQRNGPTSFLCENYKEVAIKIIKKTALVGDDPKA 171

Query: 386 EV----------THTLAERTVLARVN--------CPFIVPLKFSFQSPEKLYLVLACING 427
           ++          + T ++  VL  V+        CP IV      +S    Y+V   I+G
Sbjct: 172 DIHVAESHNRKHSKTSSKEQVLKEVSLHKAVSSGCPQIVQFIDFQESKTYYYIVQELIHG 231

Query: 428 GELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHI----- 482
           GE+F  + K   F    +R    +L  A++ LH+L V++RD+KPEN+L +    I     
Sbjct: 232 GEIFGEIVKYTYFSEDLSRHVIKQLALAVQHLHSLGVVHRDIKPENLLFEPIEFIPSKEP 291

Query: 483 -----------------------------ALCDFGLCKLNMKDQDKTDTFCGTPEYLAPE 513
                                         L DFGL K       KT   CGT  Y APE
Sbjct: 292 KLRKSDDPSTKSDEGLFVPGVGGGGIGVVKLADFGLSKQIFATNTKTP--CGTVGYTAPE 349

Query: 514 LLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRF--P--EGFDRD 569
           ++ ++ YS  VD W +G +LY ML G PP+YDE +  +  KI +    F  P  +     
Sbjct: 350 VVKDEHYSMKVDMWGVGCVLYTMLCGFPPFYDEKIDVLTEKISRGEYTFLRPWWDEISAG 409

Query: 570 AKDLLIGLLSRDPDRR 585
           AK+ +I LL  DP++R
Sbjct: 410 AKNAVIRLLEVDPNKR 425

>YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine protein
           kinase, related to Kin2p and S. pombe KIN1 [3195 bp,
           1064 aa]
          Length = 1064

 Score =  112 bits (281), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 134/280 (47%), Gaps = 30/280 (10%)

Query: 334 PSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIR---KSYIVSKSEVTHT 390
           P +  R ++ D++ ++ +G GS GKV   + R T ++ A+K +    K+++  +  +   
Sbjct: 109 PKQFHRKSLGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPP 168

Query: 391 LAERTVLAR-----------------------VNCPFIVPLKFSFQSPEKLYLVLACING 427
             E+ VL R                       +  P I  L          Y++   ++G
Sbjct: 169 KNEQDVLERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSG 228

Query: 428 GELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDF 487
           G+L  ++ + G     +AR +   +  AL  LH  ++++RDLK ENI++     I + DF
Sbjct: 229 GQLLDYIIQHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDF 288

Query: 488 GLCKLNMKDQDKT-DTFCGTPEYLAPELLLNQGYS-KVVDWWTLGILLYEMLTGLPPYYD 545
           GL   N+ D  K   TFCG+  + APELL    Y+   VD W+ G++L+ ++ G  P+ D
Sbjct: 289 GLS--NIYDSRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDD 346

Query: 546 EDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDRR 585
           E+   ++ KI Q  + +P+    +   LL  +L  DP RR
Sbjct: 347 ENSSVLHEKIKQGKVEYPQHLSIEVISLLSKMLVVDPKRR 386

>YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinase
           kinase (MEK) activated by high osmolarity through the
           Sln1p-Ypd1p-Ssk1p two-component osmosensor and the Sho1p
           osmosensor [2007 bp, 668 aa]
          Length = 668

 Score =  111 bits (277), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 86/285 (30%), Positives = 142/285 (49%), Gaps = 26/285 (9%)

Query: 321 NTLGRINIS---VDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIR 377
           N  G++++S   +D+    + R+T+D+ + L  +G G++G V +V  + T  I A K +R
Sbjct: 333 NFAGKLSLSSKGIDFSNGSSSRITLDELEFLDELGHGNYGNVSKVLHKPTNVIMATKEVR 392

Query: 378 KSYIVSKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGEL--FYHLQ 435
               + +++    L E  VL + N P+IV    +F     +Y+ +  ++GG L   Y   
Sbjct: 393 LE--LDEAKFRQILMELEVLHKCNSPYIVDFYGAFFIEGAVYMCMEYMDGGSLDKIYDES 450

Query: 436 KE-GRFELSRARFYTAELLCALETL---HNLDVIYRDLKPENILLDY-QGHIALCDFGLC 490
            E G  +  +  F    ++  L+ L   HN  +I+RD+KP NIL    QG + LCDFG+ 
Sbjct: 451 SEIGGIDEPQLAFIANAVIHGLKELKEQHN--IIHRDVKPTNILCSANQGTVKLCDFGVS 508

Query: 491 KLNMKDQDKTDTFCGTPEYLAPELL--LN---QGYSKVVDWWTLGILLYEMLTGLPPY-- 543
              +    KT+  C +  Y+APE +  LN     Y+   D W+LG+ + EM  G  PY  
Sbjct: 509 GNLVASLAKTNIGCQS--YMAPERIKSLNPDRATYTVQSDIWSLGLSILEMALGRYPYPP 566

Query: 544 --YDEDVPKMYRKILQDPLRFP-EGFDRDAKDLLIGLLSRDPDRR 585
             YD    ++   +   P R P + F  DA+D +   L + P+RR
Sbjct: 567 ETYDNIFSQLSAIVDGPPPRLPSDKFSSDAQDFVSLCLQKIPERR 611

>CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces
           cerevisiae YJL128c PBS2, hypothetical start
          Length = 677

 Score =  111 bits (277), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 86/300 (28%), Positives = 150/300 (50%), Gaps = 25/300 (8%)

Query: 321 NTLGRINIS---VDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIR 377
           N  G++++S   +D+    + R+T+D+   ++ +G G++G V +V  +    + A+K +R
Sbjct: 342 NFAGKLSLSSRGIDFSNGSSSRITLDELQFIEELGHGNYGTVSKVLHKPNNVLMAMKEVR 401

Query: 378 KSYIVSKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGEL--FYHLQ 435
               + +S+    L E  VL + N PFIV    +F     +Y+ +  ++GG L   Y   
Sbjct: 402 --LELDESKFRQILMELEVLHKCNSPFIVDFYGAFFIEGAVYMCMEYMDGGSLDKIYDEN 459

Query: 436 KE-GRFELSRARFYTAELLCALETLHNL-DVIYRDLKPENILLDY-QGHIALCDFGLCKL 492
            E G  +  +  F T  ++  L  L  + +VI+RD+KP NIL    QG + LCDFG+   
Sbjct: 460 PEMGGIDEPQLAFITNAVIQGLRELKEVHNVIHRDVKPTNILCSAKQGTVKLCDFGVSGN 519

Query: 493 NMKDQDKTDTFCGTPEYLAPELL--LNQG---YSKVVDWWTLGILLYEMLTGLPPYYDED 547
            +    KT+  C +  Y+APE +  LN     Y+   D W+LG+ + EM  G  PY  E 
Sbjct: 520 LVASLAKTNIGCQS--YMAPERIKSLNPDRGTYTVQSDIWSLGLSILEMALGRYPYPPET 577

Query: 548 VPKMYRKILQ----DPLRFP-EGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQ 602
              ++ ++       P + P + F  +A+D +   L + PDRR   +  +E   HP+ ++
Sbjct: 578 FDNIFSQLSAIVDGPPPKLPADKFSDEAQDFVSLCLQKIPDRRPNYSNLYE---HPWLAK 634

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score =  112 bits (279), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 124/250 (49%), Gaps = 9/250 (3%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARV-NCP 403
           F   +VIG+G FG V +     T ++YA+K +  +      EV     E   LA +    
Sbjct: 23  FKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVL--NLDSDSDEVEDVQREIQFLASLKQIS 80

Query: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463
            I     S+     L++++    GG L   L + G+ +         ELL AL+ +H  +
Sbjct: 81  NITRYYGSYLKDTSLWIIMEHCAGGSL-RSLLRPGKIDEKYIGVIMRELLVALKCIHKDN 139

Query: 464 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQG--YS 521
           VI+RD+K  N+L+  +G++ LCDFG+     +   +  T  GTP ++APE+++ +G  Y 
Sbjct: 140 VIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVIM-EGVYYD 198

Query: 522 KVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQD-PLRFPE-GFDRDAKDLLIGLLS 579
             VD W+LGI  YE+ TG PPY D +  +  + I++  P R  +  +    K+ +   L 
Sbjct: 199 TKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLD 258

Query: 580 RDPDRRLGCN 589
            DP  RL  +
Sbjct: 259 EDPKERLSAD 268

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score =  111 bits (278), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 81/280 (28%), Positives = 137/280 (48%), Gaps = 14/280 (5%)

Query: 323 LGRINISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIV 382
           + R+N++    P++        + L +VIGKG++G V +   R T ++ A+KAI      
Sbjct: 1   MHRVNVT----PAQRHTGQRKHYALKQVIGKGAYGVVYKAVNRATDQVIAIKAIEYENEE 56

Query: 383 SKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFEL 442
              E    +     L   N   IV      QS  +LY++L     G L   ++KE   E 
Sbjct: 57  ELHEHMLEIDLLKNLKHEN---IVKYHGFIQSSHELYILLEYCIRGSLRDLIKKEALSE- 112

Query: 443 SRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDT 502
           ++A+ Y  + L  L+ LH+  VI+RD+K  N+LL   G + L DFG+   + +  +   T
Sbjct: 113 AKAKTYVRQTLRGLQYLHDQGVIHRDIKAANLLLTENGVVKLADFGV---STRVNNMAMT 169

Query: 503 FCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRF 562
           + G+P ++APE++L +G S V D W+LG  + E+LTG PP+Y+         I+ D    
Sbjct: 170 YAGSPNWMAPEVMLGKGASTVSDIWSLGATVVELLTGNPPFYNLVNEAACYAIVNDVYYP 229

Query: 563 PEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQ 602
           PE    + K  +     ++  +R     AH++  H +  +
Sbjct: 230 PEHLSAECKAFMELCFQKNMFKR---PQAHQLLQHGWLKE 266

>Scas_707.3
          Length = 1598

 Score =  111 bits (278), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 98/180 (54%), Gaps = 18/180 (10%)

Query: 485  CDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYY 544
             D  L   +   QDK   F GTP+YLAPE +   G     DWW++G +++E+L G PP++
Sbjct: 989  SDLALFHPDDSKQDKK--FFGTPDYLAPETIEGTGEGDQCDWWSVGCIMFELLFGYPPFH 1046

Query: 545  DEDVPKMYRKILQDPLRFPEGFDR----------DAKDLLIGLLSRDPDRRLGCNGAHEI 594
                  ++RKIL   + +P+ FD           +AKDL++ LL  DP +RLG NGA EI
Sbjct: 1047 TNTPEGVFRKILSGKIEWPQ-FDSIEEEREILSPEAKDLIMKLLVVDPSKRLGANGADEI 1105

Query: 595  KNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVVDEYLSESVQK 654
            K HP+F  ++W  ++++     + P V +  DT  FD   T+   +++  D+Y  + + K
Sbjct: 1106 KQHPYFKDVNWDHVYDEEA--SFVPTVENPEDTDYFD---TRGAVLENFGDDYEDKEIPK 1160

 Score =  110 bits (276), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 54/161 (33%), Positives = 99/161 (61%), Gaps = 1/161 (0%)

Query: 335 SKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAER 394
           +KN   TI D+ +LK I KG++G V   RK+ T   +A+K ++KS +++K++VT+  +ER
Sbjct: 689 TKNLTPTIKDYTILKPISKGAYGSVYLARKKITGDYFAIKVLKKSDMIAKNQVTNVKSER 748

Query: 395 TVL-ARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELL 453
            ++  + + P++  L  +FQ+ E L+LV+  + GG+L   ++  G       + Y  E++
Sbjct: 749 AIMMVQSDKPYVARLFATFQNKENLFLVMEYLPGGDLATLIKMMGYLPDQWVKQYLTEII 808

Query: 454 CALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 494
             ++ +H   +I+ DLKP+N+L+D  GH+ L DFGL +  +
Sbjct: 809 VGVDDMHRNWIIHHDLKPDNLLIDNLGHVKLTDFGLSRAGL 849

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score =  111 bits (277), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 122/247 (49%), Gaps = 11/247 (4%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARV-NCP 403
           F   ++IG+G FG V +     TQ++YA+K +      ++ EV     E   L+ +   P
Sbjct: 16  FKRKEIIGRGKFGVVYKAFHVKTQQVYAIKVLNLDN--TEDEVEDIRKEIQFLSSLKQTP 73

Query: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463
            I     S+    KL++++    GG L   L + G  E         E+L AL ++H  +
Sbjct: 74  NITHYYGSYLIDTKLWVIMEYCAGGSL-RTLLRPGIIEEKYIGVIMREILVALISIHRDN 132

Query: 464 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQG--YS 521
           VI+RD+K  NIL+   G + LCDFG+     +   K  T  GTP ++APE+++ +G  Y 
Sbjct: 133 VIHRDIKAANILIANNGSVKLCDFGVAAQLSQSMLKRQTMAGTPYWMAPEVIM-EGVYYD 191

Query: 522 KVVDWWTLGILLYEMLTGLPPY-YDEDVPKMYRKILQDPLRFPEG--FDRDAKDLLIGLL 578
             VD W+LGI  YE+ TG PPY + E +  M       P R  EG  + +  K+ +   L
Sbjct: 192 TKVDIWSLGITAYEIATGNPPYCHMEAIRAMQMITKSKPPRL-EGREYSQPLKEFIALCL 250

Query: 579 SRDPDRR 585
             DP  R
Sbjct: 251 DEDPKER 257

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score =  108 bits (271), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 121/268 (45%), Gaps = 21/268 (7%)

Query: 340 LTIDDFDLLKVIGKGSFGKVMQVRKRDTQK-----------IYALKAIRKSYIVSKSEVT 388
           L++  F LL+ +GKG+FG V       + +             A+K I   +  S   + 
Sbjct: 2   LSLQQFQLLECVGKGNFGDVYLAHYLGSNQEPTDPKIPKNVPLAIKCINLEH--SNEPID 59

Query: 389 HTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFY 448
             L E   L+ ++CP+I     +F     LY+V+   + G L   L+   R       F 
Sbjct: 60  LLLKEIYFLSTLHCPYITHYYGTFTGDCNLYIVMEYCSNGSLLNLLRYYSRLTEQTTCFI 119

Query: 449 TAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLC---KLNMKDQ--DKTDTF 503
             ++  ALE LH   +I+RDLK  NILL+  G + L D G+    K N         +TF
Sbjct: 120 ILQVCHALEYLHEKRLIHRDLKAANILLNDDGEVRLADLGVTGQLKFNSTRHGGKNLNTF 179

Query: 504 CGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQ---DPL 560
            GTP ++APE++ NQ Y    D W+LGI   E+L G PP    D  K   +I +   D +
Sbjct: 180 VGTPFWMAPEIIKNQSYDGKCDIWSLGITTLELLNGKPPMSHLDSMKALMRIPKLNADSI 239

Query: 561 RFPEGFDRDAKDLLIGLLSRDPDRRLGC 588
                     KD +   L +DP++R  C
Sbjct: 240 LRNMDISPLGKDFIRSCLQQDPNQRPTC 267

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score =  109 bits (272), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 85/308 (27%), Positives = 145/308 (47%), Gaps = 54/308 (17%)

Query: 327 NISVDYKPSKNK---RLTIDDFDLLKVIGKGSFGKVMQVR--KRDTQKIYALKAIRKSYI 381
           N S DY  S ++   +L + ++ LL  IG+G+F +V +      D Q   A+KAI K  I
Sbjct: 100 NKSTDYSSSNHQYPEQLELHNYKLLNKIGEGAFSRVFKAVGINTDDQAPVAIKAIIKKGI 159

Query: 382 VS--------------KSEVTHTLAERTVLARVN--CPFIVPLKFSFQSPEKLYLVLACI 425
            S              + +V + +A   ++++ N  C   +  +   +S    YLV   +
Sbjct: 160 SSDAILKGNDRIQGSSRKKVLNEVAIHKLVSKNNPHCTKFIAFQ---ESANYYYLVTELV 216

Query: 426 NGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILL--------- 476
            GGE+F  + +   F    AR    ++  A++ +H + +++RD+KPEN+L          
Sbjct: 217 TGGEIFDRIVQLTCFSEDLARHVITQVAIAIKHMHYMGIVHRDVKPENLLFEPIPFYGLD 276

Query: 477 -DYQGH--------------IALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYS 521
            D Q                + L DFGL K    +  KT   CGT EY+A E+  ++ YS
Sbjct: 277 GDMQKEDEFTLGVGGGGIGLVKLMDFGLAKKLRNNTAKTP--CGTIEYVASEVFTSKRYS 334

Query: 522 KVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFP----EGFDRDAKDLLIGL 577
             VD W++G +L+ +L G PP+Y+++   + +KI +    F     +     AK+ +  L
Sbjct: 335 MKVDMWSIGCVLFTLLCGYPPFYEKNEKTLLKKISRGDYEFLAPWWDNISSGAKNAVTHL 394

Query: 578 LSRDPDRR 585
           L  DP++R
Sbjct: 395 LEVDPNKR 402

>CAGL0L06006g complement(670707..673535) similar to sp|P53104
           Saccharomyces cerevisiae YGL180w APG1 essential for
           autophagocytosis, hypothetical start
          Length = 942

 Score =  109 bits (273), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 81/289 (28%), Positives = 142/289 (49%), Gaps = 51/289 (17%)

Query: 349 KVIGKGSFGKVMQVR-KRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVP 407
           K IGKGSF  V +     D +   A+KA+ +S + +K  + +   E  +L ++  P IV 
Sbjct: 15  KEIGKGSFATVYRGHVTTDPKSHIAVKAVARSKLKNKKLLENLEIEIAILKKIKHPHIVG 74

Query: 408 LKFSFQSPEKLYLVLACINGGELFYHLQKEGRFE----------------------LSRA 445
           L    ++    YLV+     G+L + ++K    E                      L+RA
Sbjct: 75  LIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFNKYPPPSKEHNGLNRA 134

Query: 446 RF--YTAELLCALETLHNLDVIYRDLKPENILL-----DYQ--------GHIAL------ 484
               Y  +L  AL+ L + ++++RD+KP+N+LL     +Y+        G++ +      
Sbjct: 135 FVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLTNYRDSKTFHELGYVGIYNLPIL 194

Query: 485 --CDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPP 542
              DFG  +  +      +T CG+P Y+APE+L  Q Y+   D W++G +L+EM  G+PP
Sbjct: 195 KIADFGFARF-LPSTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLFEMCCGVPP 253

Query: 543 YYDEDVPKMYRKI--LQDPLRFPEGFDRD--AKDLLIGLLSRDPDRRLG 587
           +   +  ++++KI    D + FPE  + +   K+L+  LL+ DP +R+G
Sbjct: 254 FTASNHLELFKKIKRAHDEINFPEVCEVEDGLKELICSLLTFDPAKRIG 302

>Scas_580.6
          Length = 1015

 Score =  109 bits (272), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 76/249 (30%), Positives = 123/249 (49%), Gaps = 9/249 (3%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARV-NCP 403
           F   +VIG+G FG V +     T++IYA+K +  +    + EV     E   L+ +   P
Sbjct: 37  FRRTEVIGRGKFGIVYKGYHVRTKQIYAIKVL--NLDSDEDEVEDVQREVQFLSSLKQIP 94

Query: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463
            I     S+     L++++    GG L   L + G+ +         ELL AL+ +H  +
Sbjct: 95  NITRYYGSYLKDTSLWIIMEYCAGGSL-RSLLRPGKIDEKYIGVIMRELLVALKYIHKDN 153

Query: 464 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQG--YS 521
           VI+RD+K  N+L+  +G + LCDFG+     +   +  T  GTP ++APE+++ +G  Y 
Sbjct: 154 VIHRDIKAANVLITNEGSVKLCDFGVAAQLNQSTLRRQTMAGTPYWMAPEVIM-EGVYYD 212

Query: 522 KVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQD-PLRF-PEGFDRDAKDLLIGLLS 579
             VD W+LGI  YE+ TG PPY + +  +  + I +  P R     +    K+ +   L 
Sbjct: 213 TKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLD 272

Query: 580 RDPDRRLGC 588
            DP  RL  
Sbjct: 273 EDPKERLSA 281

>Scas_685.24
          Length = 515

 Score =  107 bits (267), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 75/267 (28%), Positives = 135/267 (50%), Gaps = 15/267 (5%)

Query: 326 INISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKS 385
           ++I  +Y P  +K     ++ + + +G+G+FG V +   R T K+ A+K +    + + +
Sbjct: 6   LSIRREYTPRISK---AHNYIVKECVGRGNFGDVYRAIDRTTNKVVAIKVVD---LENTN 59

Query: 386 EVTHTLAERTV-LARVNCPFIVPLKFSFQSPEKLYLVLACINGG---ELFYHLQKEGRFE 441
           E    LA+    LA +  P+I+    +      +++V+    GG   +L  +    G  E
Sbjct: 60  ERLEVLAQEIFFLAELKSPYIINYITTLLEDASMWIVMEYCGGGSCSDLLKYYFNNGLPE 119

Query: 442 LSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTD 501
             +  + T E+L  L+ LH    I+RD+K  NILL  +GH+ L DFG+    +K   +  
Sbjct: 120 -KKVAYITREILKGLQYLHEQKKIHRDIKAANILLTEEGHVKLGDFGVSG-QLKSTLRRG 177

Query: 502 TFCGTPEYLAPELLLN--QGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDP 559
           T  GTP ++APE+     +GY + +D W+LGI ++E+L G+PP    D  ++   + +  
Sbjct: 178 TIVGTPYWMAPEVASQNIEGYDEKIDIWSLGITVFELLKGVPPLVKLDPIRVLANLSRKS 237

Query: 560 LRFPEGFDRDAKDLLIGL-LSRDPDRR 585
               +G   DA    + L L ++P+ R
Sbjct: 238 APRLQGAYSDAAKSFVALCLIKNPNER 264

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score =  108 bits (271), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 116/241 (48%), Gaps = 6/241 (2%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPF 404
           + L ++IG+GS+G V +   + T +  A+K +         E+   ++E  +L  +N   
Sbjct: 22  YQLRQIIGRGSYGVVYKATNKKTAQEVAIKEVNYQ---DDDELVDIMSEIDLLKNLNHIN 78

Query: 405 IVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDV 464
           IV      Q    LY++L     G L   + +        A+ Y  + L  L  LH   V
Sbjct: 79  IVKYHGFIQKQHNLYIILEYCAKGSLKNLISRNRPMSEHEAKPYVRQTLNGLNYLHEQGV 138

Query: 465 IYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVV 524
           I+RD+K  NILLD +  + L DFG   ++ K  +   T  G+  ++APE++ N+G S + 
Sbjct: 139 IHRDIKAANILLDSENVVKLADFG---VSTKVNNTAMTLAGSLNWMAPEIIGNRGASTLS 195

Query: 525 DWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDR 584
           D W+LG  + E+LTG PP+++     +Y  I  D    P      AKD L    +++  +
Sbjct: 196 DIWSLGATVVELLTGNPPFHNLIDMNIYYAIENDSYFPPSSLSSGAKDFLQQCFAKNMYK 255

Query: 585 R 585
           R
Sbjct: 256 R 256

>Scas_707.36
          Length = 915

 Score =  108 bits (270), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 147/326 (45%), Gaps = 58/326 (17%)

Query: 328 ISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAI----RKSYIVS 383
           IS+ Y P    ++ ++ ++++K +G G  GKV   +     ++ A+K +    +K+Y   
Sbjct: 77  ISLSYDPVSKTQI-LNHYEIVKELGNGQHGKVKLAKDIRANQLVAIKMVNRYEKKTYFAG 135

Query: 384 --KSEVTHTLAERTVLARVNCPFIVPLKFSFQ--SPEKLYLVLACINGGELFY----HLQ 435
             +++      E  ++ + N   +V L       S  K+YLVL     G + +     L+
Sbjct: 136 PKRNDPNKIKKEIAIMKKCNNKHVVKLIEILDDLSSRKIYLVLEYCEKGPILWCPRDQLE 195

Query: 436 KEGR----FELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCK 491
            + R        RAR    +++  LE LH+  +I+RD+KP N+L+D  G + + DFG+  
Sbjct: 196 IDSRGPPQLSFQRAREIFRDVILGLEYLHSQGIIHRDIKPANLLMDKNGVVKISDFGVSL 255

Query: 492 LNMKDQDKTD------TFCGTPEYLAPELLLNQG-----------------YSKVVDWWT 528
               + D  D         GTP + APE+ L                     S  +D W 
Sbjct: 256 AANGNIDTNDDELELTKTVGTPVFYAPEICLGAAAMERFNLDKDELFNGSCISFKIDIWA 315

Query: 529 LGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFP--EGFDRD-------------AKDL 573
           LGI LY +L G+ P+  E   K++ KI+ + LRFP  E    +             AKDL
Sbjct: 316 LGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFPTFETLQDNHISEISHIREFVHAKDL 375

Query: 574 LIGLLSRDPDRRLGCNGAHEIKNHPF 599
           L  LL ++P +R+      +IK HPF
Sbjct: 376 LNKLLEKNPAKRISI---PDIKVHPF 398

>Kwal_56.23717
          Length = 858

 Score =  107 bits (268), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 119/233 (51%), Gaps = 16/233 (6%)

Query: 418 LYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLD 477
            Y++   ++GG+L  ++ + G      AR +   +  AL+ LH  ++++RDLK ENI++ 
Sbjct: 8   FYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENIMIS 67

Query: 478 YQGHIALCDFGLCKL-NMKDQDKTDTFCGTPEYLAPELLLNQGYS-KVVDWWTLGILLYE 535
             G I + DFGL  + N K Q    TFCG+  + APELL    Y+   VD W+ G++L+ 
Sbjct: 68  TSGEIKIIDFGLSNMYNPKKQ--LHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLFV 125

Query: 536 MLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIK 595
           ++ G  P+ DE+   ++ KI Q  + +P+    +   LL  +L  DP +R       ++ 
Sbjct: 126 LVCGKVPFDDENSSVLHEKIKQGKVEYPQHLSIEVISLLSKMLVVDPTKRASLK---QVV 182

Query: 596 NHPFFSQLSWKRLWN---KGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVVD 645
           NH +      +R ++     YIP   P  +DA D     + +  E  ID VV+
Sbjct: 183 NHQWM-----QRGYDFPAPSYIPHRVPLTADALDATVIKEMYRLEF-IDDVVE 229

>Kwal_55.21545
          Length = 865

 Score =  107 bits (266), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/247 (31%), Positives = 124/247 (50%), Gaps = 11/247 (4%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARV-NCP 403
           F   +VIG+G FG V +     T+++ A+K +  +   +  EV     E   L+ +   P
Sbjct: 19  FKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVL--NLDSADDEVEDVQKEIQFLSSLKQVP 76

Query: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463
            I     S+ +  KL++++    GG L   L + G+           ELL AL  +H   
Sbjct: 77  NITHYYGSYLNDTKLWVIMEYCAGGSL-RTLLRPGKIGEQYIGVIMRELLTALMHIHKDG 135

Query: 464 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQG--YS 521
           VI+RD+K  N+L+   GHI LCDFG+     + + +  T  GTP ++APE+++ +G  Y 
Sbjct: 136 VIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMAGTPYWMAPEVIM-EGVYYD 194

Query: 522 KVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQD-PLRFPEGFDRDA--KDLLIGLL 578
             VD W+LGI  YE+ TG PPY + +  +  + I +  P R  EG    +  K+++   L
Sbjct: 195 TKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRL-EGRQHSSALKEIIALCL 253

Query: 579 SRDPDRR 585
             DP  R
Sbjct: 254 DEDPKER 260

>Scas_582.1
          Length = 638

 Score =  105 bits (263), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 84/286 (29%), Positives = 145/286 (50%), Gaps = 26/286 (9%)

Query: 321 NTLGRINIS---VDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIR 377
           N  G++++S   +D+    + R+T+ + + ++ +G G++G V +V  + T  I A+K ++
Sbjct: 303 NFAGKLSLSSKGIDFSNGSSSRITLAELEFIEELGHGNYGNVSKVLHKPTNVIMAMKEVK 362

Query: 378 KSYIVSKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGEL--FYHLQ 435
               + +++    L E  VL +   P+IV    +F     +Y+ +  ++GG L   Y   
Sbjct: 363 LE--LDEAKFRQILMELEVLHKCKSPYIVDFYGAFFIEGAVYMCMEYMDGGSLDKIYDQD 420

Query: 436 KE--GRFELSRARFYTAEL--LCALETLHNLDVIYRDLKPENILLDY-QGHIALCDFGLC 490
            E  G  E   A   TA +  L  L+ +H+  +I+RD+KP NIL    QG I LCDFG+ 
Sbjct: 421 PEIGGIDEPQLAVIATAVIRGLKVLKDVHH--IIHRDVKPTNILCSAKQGTIKLCDFGVS 478

Query: 491 KLNMKDQDKTDTFCGTPEYLAPELL--LN---QGYSKVVDWWTLGILLYEMLTGLPPYYD 545
              +    KT+  C +  Y+APE +  LN     Y+   D W+LG+ + EM  G  PY  
Sbjct: 479 GNLVASMAKTNIGCQS--YMAPERIKSLNPDIATYTVQSDIWSLGLSILEMALGRYPYPP 536

Query: 546 EDVPKMYRKILQ----DPLRFPEG-FDRDAKDLLIGLLSRDPDRRL 586
           E    ++ ++       P + P G F ++A+D +   L + P+RRL
Sbjct: 537 ETFDNIFSQLSAIVDGPPPKLPAGKFSKEAQDFVSLCLQKVPERRL 582

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score =  106 bits (265), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 116/242 (47%), Gaps = 7/242 (2%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPF 404
           + L +VIG+GS+G V +   + T ++ A+K +      +  E+   +AE ++L  +N   
Sbjct: 25  YHLKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYE---NDEELNDIMAEISLLKNLNHNN 81

Query: 405 IVPLKFSFQSPEKLYLVLA-CINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463
           IV      +   +LY++L  C NG       +       + ++ Y  + L  L+ LH   
Sbjct: 82  IVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEG 141

Query: 464 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKV 523
           VI+RD+K  NILL     + L DFG+  +         T  GT  ++APE+L N+G S +
Sbjct: 142 VIHRDIKAANILLSADNTVKLADFGVSTI---VNSSALTLAGTLNWMAPEILGNRGASTL 198

Query: 524 VDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPD 583
            D W+LG  + EMLT  PPY++     +Y  +  D    P  F    KD L     ++  
Sbjct: 199 SDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSEPLKDFLSKCFVKNMY 258

Query: 584 RR 585
           +R
Sbjct: 259 KR 260

>ACL054W [995] [Homologous to ScYGL180W (APG1) - SH]
           complement(269703..272621) [2919 bp, 972 aa]
          Length = 972

 Score =  105 bits (263), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 79/289 (27%), Positives = 140/289 (48%), Gaps = 51/289 (17%)

Query: 349 KVIGKGSFGKVMQVRKRDTQK-IYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVP 407
           K IG+GSF  V +    D+     A+KA+ +S + +K  + +   E  +L ++  P IV 
Sbjct: 22  KEIGRGSFAVVYKGHLADSSAGNVAIKAVSRSKLRNKKLLENLEIEIAILKKIKHPHIVG 81

Query: 408 LKFSFQSPEKLYLVLACINGGELFYHLQKE----GRFELSRARF---------------- 447
           L    ++    YL++     G+L + ++K      +  L R  F                
Sbjct: 82  LLECERTGTDFYLMMEYCALGDLTFFIKKRRSLMDKHPLVRTLFEKYPPPSEHHNGLNRV 141

Query: 448 ----YTAELLCALETLHNLDVIYRDLKPENILL-----DY--------QGHIAL------ 484
               Y  +L  AL+ L + ++++RD+KP+N+LL     DY        +G + +      
Sbjct: 142 LVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSTPLVDYNDPAEFHARGFVGIYNLPIL 201

Query: 485 --CDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPP 542
              DFG  +  + +    +T CG+P Y+APE+L  Q Y+   D W++G +LYEM  G PP
Sbjct: 202 KIADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLYEMCCGKPP 260

Query: 543 YYDEDVPKMYRKI--LQDPLRFPE--GFDRDAKDLLIGLLSRDPDRRLG 587
           +   +  ++++KI    D ++FP+    +    DL+ GLL+ +P +R+G
Sbjct: 261 FKASNHLELFQKIKKANDVIQFPKHAALESAMVDLICGLLTFEPAKRMG 309

>Kwal_27.9763
          Length = 868

 Score =  105 bits (262), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 118/241 (48%), Gaps = 7/241 (2%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPF 404
           + L +V+GKG++G V +   R T K  A+K I       +    H L E  +L  +    
Sbjct: 23  YALKQVVGKGAYGIVYRAINRQTHKQVAIKVIEYD--EEEELNEHML-EIDLLKNLKHEN 79

Query: 405 IVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDV 464
           IV      Q   +L+++L   + G L   L K G  E  + + Y  + L  L+ LH+  V
Sbjct: 80  IVKYHGFIQKSHQLFILLEYCSQGSL-RDLIKRGPVEEQQCKTYIRQTLHGLKYLHDQGV 138

Query: 465 IYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVV 524
           I+RD+K  N+LLD Q  + L DFG+   + +  +   T+ G+P ++APE+++ QG S V 
Sbjct: 139 IHRDIKAANLLLDAQNVVKLADFGV---STRVNNLAMTYAGSPNWMAPEVMMGQGASTVS 195

Query: 525 DWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDR 584
           D W+LG  + E+LTG PP+++         I+ D    P       +  L     ++  +
Sbjct: 196 DIWSLGATVVEILTGNPPFHNLVNEAACYAIVHDVYIPPSTLSSSCRKFLRSCFQKNMFK 255

Query: 585 R 585
           R
Sbjct: 256 R 256

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score =  105 bits (261), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 75/259 (28%), Positives = 124/259 (47%), Gaps = 10/259 (3%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPF 404
           + L +VIG+G++G V +  KR T K  A+K I       +SE+   + E  +L  +    
Sbjct: 10  YALKQVIGRGAYGVVYRAVKRGTNKPCAIKQIE---FEDESELNEHMLEIDLLKNLRHQN 66

Query: 405 IVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDV 464
           IV  +   Q   +LY++L     G L   + K G         Y  + L  L+ LH   V
Sbjct: 67  IVEYRGFIQKAHELYIILEYCARGSL-RDILKHGPLLEDDTVNYVTQTLYGLQYLHEQGV 125

Query: 465 IYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVV 524
           I+RD+K  N+LL  +G + L DFG+   + +      T+ G+P ++APE++  QG S V 
Sbjct: 126 IHRDIKAANLLLTEEGIVKLADFGV---STRINRMAMTYAGSPNWMAPEVMTGQGASTVS 182

Query: 525 DWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDR 584
           D W+LG  + E+LTG PP+++         I+ +    P     + KD L     ++  +
Sbjct: 183 DIWSLGATVVELLTGNPPFHNLVNESACYAIVNEEYIPPLTLSAECKDFLSRCFQKNMFK 242

Query: 585 RLGCNGAHEIKNHPFFSQL 603
           R     A E+  H +  ++
Sbjct: 243 R---ATAQELLAHIWLKKI 258

>Scas_673.20*
          Length = 758

 Score =  105 bits (261), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 117/248 (47%), Gaps = 17/248 (6%)

Query: 348 LKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVP 407
           LK IG+G+ G V    +  T    A+K I    +  +  +     E  VL     P I+ 
Sbjct: 484 LKRIGEGASGIVYTAYEIGTDISVAIKQID---LKIQPRLQMIWTEMLVLKEYQHPNIIN 540

Query: 408 LKFSFQSPEKLYLVLACINGGEL-----FYHLQKEGRFELSRARFYTAELLCALETLHNL 462
              S+   + L++V+  ++GG L     F+   +E    + R      E L  L  LH+ 
Sbjct: 541 FINSYLLHDTLWIVMEYMDGGSLADIVSFFTPTEEQMATICR------ETLFGLNFLHSR 594

Query: 463 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSK 522
            +++RD+K +NILL   G I + DFG C    +   K  T  GTP ++APE++ ++ Y  
Sbjct: 595 GIVHRDIKSDNILLSMNGDIKITDFGFCGQLTESNTKRTTMVGTPYWMAPEVIASKEYGP 654

Query: 523 VVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDP---LRFPEGFDRDAKDLLIGLLS 579
            VD W+LGI++ EM+ G PPY  E   +    I  +    L+ PE      K+ +   L 
Sbjct: 655 KVDVWSLGIMIIEMIEGEPPYLHETPVRALYLITTNGKPILKEPEKVGPVLKNFMDECLR 714

Query: 580 RDPDRRLG 587
            DP+ RL 
Sbjct: 715 VDPEARLS 722

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score =  105 bits (261), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 80/266 (30%), Positives = 127/266 (47%), Gaps = 19/266 (7%)

Query: 346 DLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFI 405
           DL+K IG+G+ G V      +++   A+K +       K  +   L E  V+       I
Sbjct: 622 DLIK-IGQGASGGVYIAHDTESEDSVAIKQMNLEKQPKKELI---LNEILVMRESKHSNI 677

Query: 406 VPLKFSFQSPEKLYLVLACINGGELF----YHLQKEGRFELSRARFYTAELLCALETLHN 461
           V    S+ +   L++V+  + GG L     + L  EG+           E L  L+ LH+
Sbjct: 678 VNFIDSYLAKGDLWIVMEYMEGGSLTDVVTHCLLSEGQI-----GAVCRETLKGLQFLHS 732

Query: 462 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYS 521
             V++RD+K +NILL  +G+I L DFG C    ++  K  T  GTP ++APE++  + Y 
Sbjct: 733 KGVLHRDIKSDNILLSLKGNIKLTDFGFCAQINENNLKRTTMVGTPYWMAPEVVSRKEYG 792

Query: 522 KVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQD---PLRFPEGFDRDAKDLLIGLL 578
             VD W+LGI++ EM+ G PPY +E   +    I  +    L+ PE         L   L
Sbjct: 793 PKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPEALSDTLTKFLDWCL 852

Query: 579 SRDPDRRLGCNGAHEIKNHPFFSQLS 604
             DP  R     A E+ + PF ++++
Sbjct: 853 KVDPSERA---TATELLDDPFITEIA 875

>Scas_675.2
          Length = 527

 Score =  103 bits (256), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 86/279 (30%), Positives = 141/279 (50%), Gaps = 26/279 (9%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVR-KRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARV 400
           I D  L   IG+GSFG VM      D   I A+K +       K+ +T     R VL   
Sbjct: 12  IKDVVLGDTIGQGSFGCVMNAHLAVDPSVIIAVKYVHIP-TCKKNGLTEKDISREVLLHS 70

Query: 401 NC---PFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALE 457
            C   P ++ L     + + +++++   +GG+LF  ++ +   +   A+FY  +L+ A+ 
Sbjct: 71  RCSKNPNVLRLIDCNIAKDYMWMIMEMADGGDLFDKIEPDVGVDSEVAQFYFQQLVRAIS 130

Query: 458 TLHN-LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFC----GTPEYLAP 512
            LH    V +RD+KPENILLD  G++ L DFGL     + +D T        G+P Y+AP
Sbjct: 131 YLHEECGVAHRDIKPENILLDKNGNLKLADFGLSS-QYRRKDGTLRISTDQRGSPPYMAP 189

Query: 513 ELLLNQG-YSKVVDWWTLGILLYEMLTGLPPYYDEDVPKM-YRKILQD-------PLRFP 563
           E+L ++G Y+   D W++GILL+ +LTG  P+    + ++ +   LQ+       P    
Sbjct: 190 EILHSRGYYAHSTDIWSIGILLFVLLTGETPWELPVIEELNFASFLQNNGNLNLGPWAKI 249

Query: 564 EGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQ 602
           E F     +LL  +L  DP +R        +++HP+F++
Sbjct: 250 EFFHL---NLLRKILQPDPKKRATLK---ILRSHPWFTK 282

>Kwal_23.6325
          Length = 1542

 Score =  104 bits (260), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 83/275 (30%), Positives = 130/275 (47%), Gaps = 24/275 (8%)

Query: 349  KVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAER-TVLARVNCPFIVP 407
            + +G G+FG V      DT +I A+K I+     S  +V   + E  +VL  +N P +V 
Sbjct: 1253 QFVGGGAFGTVFSAVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEMLNHPNVVQ 1312

Query: 408  LKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRA-RFYTAELLCALETLHNLDVIY 466
                    +K+ L +    GG L   L + GR E     + Y  ++L  L  LH   V++
Sbjct: 1313 YYGVEVHRDKVNLFMEYCEGGSL-AQLLEHGRIEDEMVTQIYALQMLEGLAYLHQSSVVH 1371

Query: 467  RDLKPENILLDYQGHIALCDFGLCKL---------NMKDQDKTD---TFCGTPEYLAPEL 514
            RD+KPENILLD+ G I   DFG  +          N+  + K D   +  GTP Y++PE 
Sbjct: 1372 RDIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTPMYMSPES 1431

Query: 515  LLN--QGYSKVVDWWTLGILLYEMLTGLPPYY--DEDVPKMYRKILQDPLRFP--EGFDR 568
            +    +G     D W+LG ++ EM+TG  P++  D +   MY        + P  E    
Sbjct: 1432 ITGAKKGKFGSGDIWSLGCVILEMVTGRRPWFNLDNEWAIMYHVAAGHVPQLPTKEELSP 1491

Query: 569  DAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQL 603
               D L+  L +DP++R   + A E+  HP+  ++
Sbjct: 1492 QGIDFLLRCLKQDPNKR---STAMELLLHPWMIEI 1523

>CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomyces
           cerevisiae YHR030c SLT2, hypothetical start
          Length = 488

 Score =  102 bits (255), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 90/312 (28%), Positives = 152/312 (48%), Gaps = 53/312 (16%)

Query: 337 NKRLTIDD-FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVT-HTLAER 394
           N+  TID  F+L+K IG G++G V   R  +  +   +   + + I SK+ +   +L E 
Sbjct: 12  NQDFTIDKRFELIKEIGHGAYGIVCSARFTEASEETTVAIKKVTNIFSKTLLCKRSLREL 71

Query: 395 TVL------ARVNCPFIVPLKFSFQ-SPEKLYLVLACINGGELFYHLQKEGRFELSRARF 447
            +L        + C + + + F    S   LYL    +      + + K G+  L+ A +
Sbjct: 72  KLLRHFRGHKNITCLYDMDIVFYPDGSINGLYLYEELMECD--MHQIIKSGQ-ALTDAHY 128

Query: 448 --YTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTF-- 503
             +T ++LC L+ +H+ DV++RDLKP N+L++    + +CDFGL +   ++ ++ + F  
Sbjct: 129 QSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPEENNQFLT 188

Query: 504 --CGTPEYLAPELLLN-QGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQ--- 557
               T  Y APE++L+ QGY+K +D W+ G +L E L G P +  +D      +ILQ   
Sbjct: 189 EYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGKPLFKGKDYVDQLNRILQVLG 248

Query: 558 ----DPLR---------------------FPEGF---DRDAKDLLIGLLSRDPDRRLGCN 589
               + LR                     F E F   + DA DLL G+L+ DP +R+  +
Sbjct: 249 TPPDETLRRVGSKNVQDYIHQLGYIQKIPFSELFPNANEDALDLLEGMLAFDPQKRITVD 308

Query: 590 GAHEIKNHPFFS 601
            A E   HP+ +
Sbjct: 309 KALE---HPYLT 317

>CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent or
           sp|P38622 Saccharomyces cerevisiae YGL158w RCK1,
           hypothetical start
          Length = 514

 Score =  102 bits (255), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 89/321 (27%), Positives = 141/321 (43%), Gaps = 66/321 (20%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQ----KIYALKAIRKS----YIVSKSEVTHTLAE 393
           ++++ ++  IG+G+F +V +           K  A+K + K     + + K+    TL E
Sbjct: 64  LNNYRIISKIGEGAFSRVFKAVPLHNNLALPKFVAIKVVPKEDFHDHNLKKTSKLQTLNE 123

Query: 394 RTV---LARVNCPFIVPLKFSFQSPEKLY-LVLACINGGELFYHLQKEGRFELSRARFYT 449
             +   L + N P +V L   FQ  +K Y  +   I GGE+F  + K   F     R   
Sbjct: 124 LNIHLKLTKANVPNVVKL-LEFQVSKKYYYFIQEYIEGGEIFNQIVKYTYFSEDLTRHVI 182

Query: 450 AELLCALETLHNLDVIYRDLKPENILLD----------YQG------------------- 480
            ++  A++ LH  ++I+RD+KPEN++ +          YQ                    
Sbjct: 183 RQVATAVKGLHENNIIHRDIKPENLIFEPIIKEQTIHRYQKLRKSDDPKTKLDEGKFIPG 242

Query: 481 -------HIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELL---------LNQGYSKVV 524
                   + L DFGL +L    +    T CGT  YLAPE+L          N  YS  V
Sbjct: 243 IGGGGIGKVRLVDFGLSRLMDPAESGARTPCGTFGYLAPEVLNQYKVDPRTSNTSYSYKV 302

Query: 525 DWWTLGILLYEMLTGLPPYYDEDVPK--MYRKILQDPLRFP----EGFDRDAKDLLIGLL 578
           D W +G +LY ML G PP+Y+++  K  +  KI +   +F     +    +A+DL+  LL
Sbjct: 303 DIWAIGCILYTMLCGFPPFYEDEFSKESLGDKISRGNYKFLAPWWDEISIEAQDLIRNLL 362

Query: 579 SRDPDRRLGCNG--AHEIKNH 597
             DP +R   +   AH   NH
Sbjct: 363 QVDPAKRYDIDQLLAHPWLNH 383

>Kwal_0.155
          Length = 587

 Score =  103 bits (256), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 138/308 (44%), Gaps = 66/308 (21%)

Query: 338 KRLTIDDFDLLKVIGKGSFGKVMQ-VRKRDTQKIY--------ALKAIRKSYIVS----- 383
           ++L + D+ L+  IG+G+F KV + V +  + K +        A+K I K ++ S     
Sbjct: 150 EQLELQDYKLIAKIGEGAFSKVYRGVPQEHSSKSFLSRAFKQVAVKVISKKHLSSTHKDA 209

Query: 384 KSEVT---HTLAE----RTVLARVNCPFIVPLKFSFQSPEKLYLVLA-CINGGELFYHLQ 435
           KS+ T     L E    RTV A  N    V     FQ     Y ++   + GGE+F  + 
Sbjct: 210 KSKATSREQVLKEVAIHRTVSASENVVSFV----DFQESHNYYFIVQELLAGGEIFGEIV 265

Query: 436 KEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGH-------------- 481
           +   F    +R    +L  A++ +H + +++RD+KPEN+L ++  +              
Sbjct: 266 RLTYFSEDLSRHVIRQLALAVKHMHAMGIVHRDIKPENLLFEHVDYEPSPSPVLRKSDDP 325

Query: 482 --------------------IALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYS 521
                               + L DFGL K       KT   CGT  Y APE++ ++ YS
Sbjct: 326 KAKQDEGIFRPGIGGGGIGTVKLADFGLSKQIYSTNTKTP--CGTVGYTAPEVVKDERYS 383

Query: 522 KVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRF--P--EGFDRDAKDLLIGL 577
             VD W +G +LY +L G PP+YDE +  +  KI +    F  P  +     AK+ +  L
Sbjct: 384 MQVDMWGIGCVLYTVLCGFPPFYDEKIDVLTEKISRGEFTFLRPWWDEISDGAKNAVRRL 443

Query: 578 LSRDPDRR 585
           L  DP +R
Sbjct: 444 LEVDPSKR 451

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score =  104 bits (259), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 87/273 (31%), Positives = 124/273 (45%), Gaps = 24/273 (8%)

Query: 351  IGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERT-VLARVNCPFIVPLK 409
            IG GSFG V      DT  I A+K I+     S  ++  +L E   V+  +N P IV   
Sbjct: 1265 IGSGSFGTVYSAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEMRVMEILNHPNIVQYY 1324

Query: 410  FSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRA-RFYTAELLCALETLHNLDVIYRD 468
                  +K+ + +    G  L   L + GR E     + YT +LL  L  LH   V++RD
Sbjct: 1325 GVEVHRDKVNIFMEFCEGSSL-ASLLEHGRIEDEMVTQVYTLQLLEGLACLHQSGVVHRD 1383

Query: 469  LKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTF------------CGTPEYLAPELLL 516
            +KPENILLD  G I   DFG  KL  K+  K  +              GTP Y+APE + 
Sbjct: 1384 IKPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDANNKSTGGKDMIGTPMYMAPETVT 1443

Query: 517  NQGYSKVV--DWWTLGILLYEMLTGLPPY--YDEDVPKMYRKILQDPLRFP--EGFDRDA 570
             QG+ K    D W+LG ++ EM+TG  P+   D +   MY        +FP         
Sbjct: 1444 GQGHGKFGSDDIWSLGCVVLEMVTGRRPWANLDNEWAIMYHVAAGHLPQFPTKSEISSAG 1503

Query: 571  KDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQL 603
            +  +   L +D ++R     A E+   P+ SQ+
Sbjct: 1504 RKFISRCLIQDANKRA---TAMELLLDPWISQI 1533

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score =  103 bits (257), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 92/335 (27%), Positives = 152/335 (45%), Gaps = 67/335 (20%)

Query: 328 ISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAI-------RKSY 380
           IS+ Y P  +KR  ++ ++++K +G G  GKV   R   T+++ A+K +       RK +
Sbjct: 125 ISLTYDPV-SKRKVLNTYEIIKELGHGQHGKVKLGRDLVTKRLVAIKIVDRHEKKERKFF 183

Query: 381 IV---SKSEVTHTLAERTVLARVNCPFIVPLKFSFQ--SPEKLYLVLACINGGELFYH-- 433
                 K+E      E  ++ + +   +V L          K+YLVL   + GE+ +   
Sbjct: 184 SFKKPGKTENDKIKREIAIMKKCHHKHVVKLIEVLDDLKSRKIYLVLEYCSRGEVKWCPP 243

Query: 434 --LQKEGRFELSRARFYTAELL----CALETLHNLDVIYRDLKPENILLDYQGHIALCDF 487
             L+ E +     +  +T E+L      LE LH   +I+RD+KP N+LL   G + + DF
Sbjct: 244 DCLETEAKGPSPLSFQFTREILRGVVLGLEYLHYQGIIHRDIKPANLLLSETGIVKISDF 303

Query: 488 GLC----KLNMKDQDKT------DTFCGTPEYLAPELLLNQ-GYSKV------------- 523
           G+       N+   D+T          GTP + APE+ L +  + K              
Sbjct: 304 GVSLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELFKGSCI 363

Query: 524 ---VDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFD------------- 567
              +D W LG+ LY ++ G+ P+      +++ KI+ DP++FP+  D             
Sbjct: 364 SFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPKYSDMLKNNQVLQMTEE 423

Query: 568 ---RDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPF 599
                AKDLL  LL ++P +R+      EIK HPF
Sbjct: 424 AEYEAAKDLLTRLLEKNPIKRINI---EEIKRHPF 455

>KLLA0E15378g 1362851..1365025 some similarities with sp|P08018
           Saccharomyces cerevisiae YJL128c PBS2 tyrosine protein
           kinase of the MAP kinase kinase family, hypothetical
           start
          Length = 724

 Score =  102 bits (254), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 84/282 (29%), Positives = 145/282 (51%), Gaps = 21/282 (7%)

Query: 321 NTLGRINIS---VDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIR 377
           N  G++++S   VD+    + R+ +D+ + L+ +G G++G V +V  + T  I A+K +R
Sbjct: 391 NFAGKLSLSSKGVDFSNGSSFRIKLDELEFLEELGHGNYGNVSKVLHKPTHIIMAMKEVR 450

Query: 378 KSYIVSKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGEL--FYHLQ 435
               + +S+    L E  VL     P+IV    +F     +Y+ +  ++GG L   Y  +
Sbjct: 451 --LELDESKFRQILMELEVLHNCQSPYIVDFYGAFFIEGAVYMCMEYMDGGSLDKTYDDE 508

Query: 436 KEGRFELSRARFYTAELLCALETLHNL-DVIYRDLKPENILLDY-QGHIALCDFGLCKLN 493
           + G  +  +    T+ ++  L+ L ++ ++I+RD+KP NIL    QG I LCDFG+    
Sbjct: 509 QIGGIDEPQLARITSSVIQGLKELKDVHNIIHRDVKPTNILCSASQGTIKLCDFGVSGNL 568

Query: 494 MKDQDKTDTFCGTPEYLAPELL--LN---QGYSKVVDWWTLGILLYEMLTGLPPYYDEDV 548
           +    KT+  C +  Y+APE +  LN     YS   D W+LG+ + EM  G  PY  E  
Sbjct: 569 VASLAKTNIGCQS--YMAPERIKSLNPDKSTYSVQSDIWSLGLSILEMALGAYPYPPETF 626

Query: 549 PKMYRKILQ----DPLRFPEG-FDRDAKDLLIGLLSRDPDRR 585
             ++ ++       P + PEG F  DA++ +   L + P+RR
Sbjct: 627 DNIFSQLSAIVDGPPPKLPEGKFSADAQNFVSMCLQKIPERR 668

>Kwal_26.7355
          Length = 1446

 Score =  103 bits (256), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 83/281 (29%), Positives = 138/281 (49%), Gaps = 20/281 (7%)

Query: 335  SKNKRLTIDDFDLLK--VIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTL- 391
            SKN      +F  +K  +IGKGSFG V       T ++ A+K +      S+ E T ++ 
Sbjct: 1134 SKNSNGEYKEFAWIKGEMIGKGSFGSVFLGLNVTTGEMIAVKQVEVPRYGSQDETTLSVL 1193

Query: 392  ----AERTVLARVNCPFIVPLKFSFQSPEKLY-LVLACINGGELFYHLQKEGRFELSRAR 446
                +E   L  ++   IV     F++   +Y L L  + GG +   ++  G+F+ +  R
Sbjct: 1194 EALRSEVATLKDLDHTNIVQY-LGFENKNYVYSLFLEYVAGGSVGSLIRLYGKFDENLIR 1252

Query: 447  FYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTD-TFCG 505
            F   ++L  L  LH+  +++RD+K +N+LLD  G   + DFG+ K +      +D T  G
Sbjct: 1253 FLAVQVLRGLSYLHSKKILHRDMKADNLLLDVDGICKISDFGISKKSNNIYSNSDMTMRG 1312

Query: 506  TPEYLAPELL-LNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKI--LQDPLRF 562
            T  ++APE++   QGYS  VD W+LG ++ EM  G  P+ + +V     KI   +     
Sbjct: 1313 TVFWMAPEMVDTKQGYSAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPPI 1372

Query: 563  PEGFDR----DAKDLLIGLLSRDPDRRLGCNGAHEIKNHPF 599
            PE   +    + K+ L      +P++R     A E+ +HPF
Sbjct: 1373 PEDTQKIISAEGKEFLDACFEINPEKRP---TADELLSHPF 1410

>AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..32840)
           [2076 bp, 691 aa]
          Length = 691

 Score =  101 bits (252), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 84/282 (29%), Positives = 144/282 (51%), Gaps = 21/282 (7%)

Query: 321 NTLGRINIS---VDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIR 377
           N  G++++S   VD+    + R+T+D+ + L+ +G G++G V +V  + T  + A+K +R
Sbjct: 350 NFAGKLSLSSQGVDFSNGSSFRITLDELEFLEELGHGNYGTVSKVLHKPTNIMMAMKEVR 409

Query: 378 KSYIVSKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGEL--FYHLQ 435
               + +S+    L E  VL +   P+IV    +F     +Y+ +  ++GG L   Y   
Sbjct: 410 --LELDESKFRQILMELEVLHKCQSPYIVDFYGAFFIEGAVYMCMEFMDGGSLDKSYDPH 467

Query: 436 KEGRFELSRARFYTAELLCALETLHNL-DVIYRDLKPENILLDY-QGHIALCDFGLCKLN 493
           + G  E  +    T  ++  L+ L ++ ++I+RD+KP NIL    QG + LCDFG+    
Sbjct: 468 EIGGIEEPQLALITESVIRGLKELKDVHNIIHRDVKPTNILCSATQGTVKLCDFGVSGNL 527

Query: 494 MKDQDKTDTFCGTPEYLAPELL--LN---QGYSKVVDWWTLGILLYEMLTGLPPY----Y 544
           +    +T+  C +  Y+APE +  LN     YS   D W+LG+ + EM  G  PY    Y
Sbjct: 528 VASLARTNIGCQS--YMAPERIKSLNPDKATYSVQSDIWSLGLSIVEMALGAYPYPPETY 585

Query: 545 DEDVPKMYRKILQDPLRFP-EGFDRDAKDLLIGLLSRDPDRR 585
           D    ++   +   P R P + F  DA+D +   L + P+RR
Sbjct: 586 DNIFSQLSAIVDGPPPRLPKDTFSSDAQDFVRLCLQKIPERR 627

>CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 521

 Score =  100 bits (249), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 75/256 (29%), Positives = 121/256 (47%), Gaps = 17/256 (6%)

Query: 337 NKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTV 396
           +KR  I++      IG+G+FG V + +     ++ A+K +      S+ EV     E   
Sbjct: 2   SKRFVIEN-----CIGRGNFGDVYKAKDTWLNEVVAVKVVNLEN--SEEEVELLAQEIFF 54

Query: 397 LARVNCPFIVPLKFSFQSPEKLYLVLACINGGE----LFYHLQKEGRFELSRARFYTAEL 452
           LA +  P++     +      +++ +    GG     L YH          + RF T E+
Sbjct: 55  LAELKSPYVTNYIATVVEDVSMWIAMEYCGGGSVGDLLKYHYT--SGLPEHKTRFITREI 112

Query: 453 LCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAP 512
           L  L  LH+   I+RD+K  NILL  +G + L DFG+    +    + DTF GTP ++AP
Sbjct: 113 LKGLSYLHSQRKIHRDIKAANILLTDEGKVKLSDFGVSG-KLLSSFRRDTFVGTPYWMAP 171

Query: 513 ELLLN--QGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKI-LQDPLRFPEGFDRD 569
           E++ +  +GY +  D W+LGI + EML G PP    D  K+   +  + P +    F  D
Sbjct: 172 EIVAHDSEGYDERADIWSLGITVIEMLRGSPPLSKYDPMKVIANLPKRKPPKLHGDFSDD 231

Query: 570 AKDLLIGLLSRDPDRR 585
           AK  +   L ++   R
Sbjct: 232 AKHFVALCLIKESAIR 247

>Scas_711.25
          Length = 1515

 Score =  101 bits (252), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 84/286 (29%), Positives = 138/286 (48%), Gaps = 20/286 (6%)

Query: 330  VDYKPSKNKRLTIDDFDLLK--VIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSE- 386
            V    S+N +    +F  +K  +IGKGSFG V       T ++ A+K +      S+ E 
Sbjct: 1197 VSINKSRNSKGEYKEFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDEA 1256

Query: 387  ----VTHTLAERTVLARVNCPFIVPLKFSFQSPEKLY-LVLACINGGELFYHLQKEGRFE 441
                V    +E + L  ++   IV     F++ + +Y L L  + GG +   ++  GRF+
Sbjct: 1257 IISTVEALRSEVSTLKDLDHLNIVQY-LGFENKDNIYSLFLEYVAGGSVGSLIRMYGRFD 1315

Query: 442  LSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTD 501
                R    ++L  L  LH+  +++RD+K +N+LLD  G   + DFG+ + +      +D
Sbjct: 1316 EPLIRHLNTQVLRGLAYLHSRGILHRDMKADNLLLDQDGVCKISDFGISRKSKDIYSNSD 1375

Query: 502  -TFCGTPEYLAPELL-LNQGYSKVVDWWTLGILLYEMLTGLPPYYD-EDVPKMYR--KIL 556
             T  GT  ++APE++   QGYS  VD W+LG ++ EM  G  P+ + E V  M++  K  
Sbjct: 1376 MTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWSNYEVVAAMFKIGKSK 1435

Query: 557  QDPLRFPEGF---DRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPF 599
              P   P+      ++ +D L      DPD R     A  + +HPF
Sbjct: 1436 SAPPIPPDTLPLISQNGRDFLDACFEIDPDNRP---TADNLLSHPF 1478

>YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine
           protein kinase involved in induction of autophagy after
           nutrient limitation [2694 bp, 897 aa]
          Length = 897

 Score =  100 bits (249), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 79/309 (25%), Positives = 143/309 (46%), Gaps = 53/309 (17%)

Query: 331 DYKPSKNKRL--TIDDFDLLKVIGKGSFGKVMQVR-KRDTQKIYALKAIRKSYIVSKSEV 387
           D+  S N  L  +  ++   K IGKGSF  V +     D  +  A+K + ++ + +K  +
Sbjct: 8   DHTTSVNHNLMASAGNYTAEKEIGKGSFATVYRGHLTSDKSQHVAIKEVSRAKLKNKKLL 67

Query: 388 THTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQK----------- 436
            +   E  +L ++  P IV L    ++    YL++     G+L + L++           
Sbjct: 68  ENLEIEIAILKKIKHPHIVGLIDCERTSTDFYLIMEYCALGDLTFLLKRRKELMENHPLL 127

Query: 437 -----------EGRFELSRARF--YTAELLCALETLHNLDVIYRDLKPENILLD-----Y 478
                      E    L RA    Y  +L  AL+ L + ++++RD+KP+N+LL      Y
Sbjct: 128 RTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGY 187

Query: 479 QGH----------------IALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSK 522
                              + + DFG  +  + +    +T CG+P Y+APE+L  Q Y+ 
Sbjct: 188 HDSKSFHELGFVGIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNA 246

Query: 523 VVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKI--LQDPLRFPE--GFDRDAKDLLIGLL 578
             D W++G +++EM  G PP+   +  ++++KI    D + FP     + + K+L+  LL
Sbjct: 247 KADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKELICSLL 306

Query: 579 SRDPDRRLG 587
           + DP +R+G
Sbjct: 307 TFDPAQRIG 315

>CAGL0D02244g complement(229504..230967) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, hypothetical start
          Length = 487

 Score = 99.0 bits (245), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 93/327 (28%), Positives = 150/327 (45%), Gaps = 59/327 (18%)

Query: 334 PSKNKRLTI------DDFDLLK-VIGKGSFGKVM-----------QVRKRDTQKIYALKA 375
           PS  K++TI      D++++   V+G G+FG V+           +  ++ T K YA+K 
Sbjct: 135 PSLPKKITINYTENVDNWNISNIVVGNGTFGYVLIAYMGIGAHSGKSSQKITPKCYAVKI 194

Query: 376 IRKSYIVSKSEVTHTLAERTVLARVNCPFIVPL-KFSFQSPEKLYLVLACINGGELFYHL 434
           +       K +++    E  +L ++N P I+ + K        LY+    I GG+LF +L
Sbjct: 195 V-------KMKLSKLDKEAKILMQLNHPNIIKVFKTHTDKSNNLYIFQELIPGGDLFSYL 247

Query: 435 QKEGRF---ELSRARFYTAELLCALETLHNLDVIYRDLKPENILL---DYQGHIALCDFG 488
            K         + A  +  ++L AL+ LH   +++RDLK +NILL   +    I L DFG
Sbjct: 248 AKGDCLMPISQTEALVFVYQILHALKYLHTKGIVHRDLKLDNILLCTPEPFTKIVLADFG 307

Query: 489 LCKLNMKDQDKTDTFCGTPEYLAPEL-----------------LLNQGYSKVVDWWTLGI 531
           + +     + +  T  GTPEY APE+                 L  QGY    D W+LG+
Sbjct: 308 IARTVTTMKSRMFTVVGTPEYCAPEVGFKANRKAYHSFFRAATLEQQGYDSKCDLWSLGV 367

Query: 532 LLYEMLTGLPPYYDED-----VPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRL 586
           + + MLTG+ P+Y +      V      IL   +      D  A++ +  LL  + D+RL
Sbjct: 368 ITHIMLTGISPFYGDGTEQSIVENAKAGILNFNVSQWSTIDIMAQNFVSKLLEVNVDKRL 427

Query: 587 GCNGAHEIKNHPFFS--QLSWKRLWNK 611
            C    +  NH + S  Q S K ++ K
Sbjct: 428 DC---EQCFNHLWISKHQKSLKEIYEK 451

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score =  100 bits (248), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/248 (31%), Positives = 121/248 (48%), Gaps = 29/248 (11%)

Query: 313  NHHWVTLENTLGRINISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYA 372
            N + +TL ++L   N+S+ ++    KR           IG GSFG V      DT  I A
Sbjct: 1174 NQYLLTLASSLS--NVSIKWQ----KR---------SFIGGGSFGSVYSAVNLDTGDILA 1218

Query: 373  LKAIRKSYIVSKSEVTHTLA-ERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELF 431
            +K I+ +   +  +V  ++  E TVL  +N P +V         +++ + +    GG L 
Sbjct: 1219 VKEIKFNDRKTIKQVFPSIRDEMTVLEMLNHPNVVQYYGVEVHRDRVNIFMEYCEGGSL- 1277

Query: 432  YHLQKEGRFELSRA-RFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLC 490
              L   GR E     + Y+ ++L  L  LH   V +RD+KPENILLD+ G I   DFG  
Sbjct: 1278 ASLLAHGRIEDEMVTQVYSLQMLEGLAYLHESGVDHRDIKPENILLDFNGIIKYVDFGAA 1337

Query: 491  ---------KLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVV--DWWTLGILLYEMLTG 539
                     KLN++   + +   GTP Y++PE +   GY K    D W+LG ++ EM+TG
Sbjct: 1338 KVLASNGSKKLNLEQHMEGEKMIGTPMYMSPEAISGTGYGKFGSDDIWSLGCVILEMVTG 1397

Query: 540  LPPYYDED 547
              P+ + D
Sbjct: 1398 RRPWANLD 1405

>KLLA0F23507g complement(2198603..2200066) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, start by similarity
          Length = 487

 Score = 97.8 bits (242), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 67/227 (29%), Positives = 114/227 (50%), Gaps = 29/227 (12%)

Query: 349 KVIGKGSFGKVMQVRKRD--TQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIV 406
           +++G G+FG V+   K D   ++  A K +  +  V  +  T  + E T+L ++N P I+
Sbjct: 143 RIVGSGTFGHVLVAEKVDHNMKRQVAKKTVSYAVKVINTAKTRMVKEATILEKLNHPNII 202

Query: 407 PLKFS-FQSPEKLYLVLACINGGELFYHLQKEGRF---ELSRARFYTAELLCALETLHNL 462
            +  S   +   +Y+    I+GG+LF +L K         + +     ++L AL+ LH+ 
Sbjct: 203 RIHQSCVDALGNVYIFQDLISGGDLFSYLAKGDCLVPISETESLIIIYQILLALKFLHSN 262

Query: 463 DVIYRDLKPENILL---DYQGHIALCDFGLCK-LNMKDQDKTDTFCGTPEYLAPELLL-- 516
            +++RDLK +NILL   +    + L DFG+ K L+   +++  T  GTPEY APE+    
Sbjct: 263 GIVHRDLKLDNILLHTPEPCTKVVLADFGIAKELSQNTKERMHTVVGTPEYCAPEVGFKA 322

Query: 517 -----------------NQGYSKVVDWWTLGILLYEMLTGLPPYYDE 546
                            N GY    D W+LG++ + MLTG+ P+Y +
Sbjct: 323 DRNIYRSFSRTATLDPDNNGYDSKCDIWSLGVITHIMLTGISPFYGD 369

>CAGL0B03509g complement(349638..351431) similar to sp|P38623
           Saccharomyces cerevisiae YLR248w RCK2
           Ca/calmodulin-dependent or sp|P38622 Saccharomyces
           cerevisiae YGL158w RCK1, start by similarity
          Length = 597

 Score = 98.2 bits (243), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 102/224 (45%), Gaps = 40/224 (17%)

Query: 400 VNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETL 459
             CP+IV      ++    YL+   ++GGE+F  + +        +R    ++  A+  +
Sbjct: 238 AGCPYIVGFIDFQETKHYYYLIQELLDGGEIFNEIVRLTYLSEDLSRHVIKQVALAVRHM 297

Query: 460 HNLDVIYRDLKPENIL---LDY-------------------------------QGHIALC 485
           H+L +++RD+KPEN+L   ++Y                                G + L 
Sbjct: 298 HSLGIVHRDIKPENLLFKSIEYIPSKKRTFRKSDDPATKADEGVFIPTIGGGGIGIVKLA 357

Query: 486 DFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYD 545
           DFGL K     Q  T T CGT  Y APE++ ++ YS  VD W +G +LY ML G PP+YD
Sbjct: 358 DFGLSKQIF--QKNTKTPCGTIGYTAPEVVKDEKYSMQVDMWGIGCVLYTMLCGFPPFYD 415

Query: 546 EDVPKMYRKILQDPLRFPEGF----DRDAKDLLIGLLSRDPDRR 585
           E +  +  KI +    F E +       AK  +  LL  DP +R
Sbjct: 416 EKIDVLTEKISRGEYTFLEPWWDEISPGAKHCVKKLLEVDPRKR 459

>Kwal_33.14081
          Length = 580

 Score = 97.8 bits (242), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 142/282 (50%), Gaps = 21/282 (7%)

Query: 321 NTLGRINIS---VDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIR 377
           N  G++++S   VD+    + R+T+D+ + L+ +G G++G V +V  + T  I A+K +R
Sbjct: 247 NFAGKLSLSSQGVDFSNGSSFRITLDELEFLEELGHGNYGNVSKVLHKPTNVIMAMKEVR 306

Query: 378 KSYIVSKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGEL--FYHLQ 435
               + +S+ T  L E  VL +   P+IV    +F     +Y+ +  ++GG L   Y   
Sbjct: 307 LE--LDESKFTQILMELEVLHKCQSPYIVDFYGAFFIEGAVYMCMEYMDGGSLDKSYDSD 364

Query: 436 KEGRFELSRARFYTAELLCALETLHNL-DVIYRDLKPENILLD-YQGHIALCDFGLCKLN 493
             G  +     +    ++  L+ L ++ ++I+RD+KP N+L    QG + LCDFG+    
Sbjct: 365 VLGGIDEPELAYIANAIIQGLKELKDVHNIIHRDVKPTNVLCSAAQGTVKLCDFGVSGNL 424

Query: 494 MKDQDKTDTFCGTPEYLAPELLLN-----QGYSKVVDWWTLGILLYEMLTGLPPY----Y 544
           +    KT+  C +  Y+APE + +       Y+   D W+LG+ + EM  G  PY    +
Sbjct: 425 VASLAKTNIGCQS--YMAPERIKSFNPDKATYTVQSDIWSLGLSILEMAIGTYPYPVETF 482

Query: 545 DEDVPKMYRKILQDPLRFPEG-FDRDAKDLLIGLLSRDPDRR 585
           D    ++   +   P + P+G F   A+D +   L + P+RR
Sbjct: 483 DNIFSQLSAIVDSPPPQLPKGRFSPMAQDFVNMCLQKIPERR 524

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 99.0 bits (245), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 83/292 (28%), Positives = 141/292 (48%), Gaps = 26/292 (8%)

Query: 327  NISVDYKPSKNKRLTIDDFDLLK--VIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSK 384
            N  V    +KN +    +F  +K  +IGKGSFG V       T ++ A+K +      S+
Sbjct: 1155 NHMVSINKAKNSKGEYKEFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQ 1214

Query: 385  SE-----VTHTLAERTVLARVNCPFIVPLKFSFQSPEKLY-LVLACINGGELFYHLQKEG 438
            +E     V    +E + L  ++   IV     F++   +Y L L  + GG +   ++  G
Sbjct: 1215 NEAILSTVEALRSEVSTLKDLDHLNIVQY-LGFENKNNIYSLFLEYVAGGSVGSLIRMYG 1273

Query: 439  RFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQD 498
            RF+    +  T ++L  L  LH+  +++RD+K +N+LLD  G   + DFG+ + +     
Sbjct: 1274 RFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKDIYS 1333

Query: 499  KTD-TFCGTPEYLAPELL-LNQGYSKVVDWWTLGILLYEMLTGLPPYYD-EDVPKMYR-- 553
             +D T  GT  ++APE++   QGYS  VD W+LG ++ EM  G  P+ + E V  M++  
Sbjct: 1334 NSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIG 1393

Query: 554  ------KILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPF 599
                   I +D L       +  ++ L      +P++R   N   E+ +HPF
Sbjct: 1394 KSKSAPPIPEDTLPL---ISQIGRNFLDACFEINPEKRPTAN---ELLSHPF 1439

>Kwal_56.23841
          Length = 432

 Score = 96.3 bits (238), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 94/335 (28%), Positives = 147/335 (43%), Gaps = 69/335 (20%)

Query: 348 LKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERT-----VLARVNC 402
           L  +G G+FG V       T +  A+K I K +       T  LA+RT     +L  +  
Sbjct: 26  LNPVGMGAFGLVCSANDTYTNQSVAIKKIMKPF------STAVLAKRTYRELKLLKHLRH 79

Query: 403 PFIVPLKFSFQSP-EKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHN 461
             ++ L+  F SP E +Y V   + G +L   LQ     E    +++  ++L  L+ +H+
Sbjct: 80  ENLICLEDIFLSPLEDIYFVTE-LQGTDLHRLLQTRP-LEKQFVQYFLYQILRGLKYVHS 137

Query: 462 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDT-FCGTPEYLAPELLLN-QG 519
             VI+RDLKP NIL++    + +CDFGL ++    QD   T +  T  Y APE++L  Q 
Sbjct: 138 AGVIHRDLKPSNILINENCDLKICDFGLARI----QDPQMTGYVSTRYYRAPEIMLTWQK 193

Query: 520 YSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKIL----------------------- 556
           Y+  VD W+ G +  EM+ G P +  +D    +  I                        
Sbjct: 194 YNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSVNTLKFV 253

Query: 557 -----QDPLRFPEGF---DRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRL 608
                +DP+ F E F   + DA DLL  +L  DP++R+    A +  +HP          
Sbjct: 254 TSLPHRDPVPFSERFKNVEPDAVDLLEKMLVFDPNKRI---TAADALSHP---------- 300

Query: 609 WNKGYIPPYKPPVSDAADTRNFDQEFT-KEKPIDS 642
               Y+ PY  P  +      FD  F   + P+D+
Sbjct: 301 ----YLAPYHDPTDEPVADAKFDWHFNDADLPVDT 331

>Scas_619.5*
          Length = 510

 Score = 97.1 bits (240), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 84/297 (28%), Positives = 143/297 (48%), Gaps = 55/297 (18%)

Query: 349 KVIGKGSFGKVMQVRKRD--------TQKIYALKAIR-KSYIVSKSEVTHTLAERTVLAR 399
           ++IG G+FG V+   K+         ++  +A+K I+ + Y V K        E  +L +
Sbjct: 172 RIIGNGTFGNVLVAFKKSEIVASDVYSRPNFAVKVIKLRKYKVDK--------EAKILLK 223

Query: 400 VNCPFIVPLKFSFQS--PEKLYLVLACINGGELFYHLQK-EGRFELSRAR--FYTAELLC 454
           +N   I+ + ++F       LY+    I GG+LF +L K E    +S         ++L 
Sbjct: 224 LNHANIIKIHYTFNDLMNNNLYIFQDLIPGGDLFSYLAKGECLTAISETETLIIVYQILK 283

Query: 455 ALETLHNLDVIYRDLKPENILL---DYQGHIALCDFGLCK-LNMKDQDKTDTFCGTPEYL 510
           AL  +H   +++RDLK +NILL   +    I L DFG+ K L++K+  + +T  GTPEY 
Sbjct: 284 ALHYIHGRGIVHRDLKLDNILLCSPEPCTRIVLADFGIAKDLSLKNT-RMNTIVGTPEYC 342

Query: 511 APEL-------LLNQ-------------GYSKVVDWWTLGILLYEMLTGLPPYYDED--- 547
           APE+       +++Q             GY    D W+LG++ + MLTG+ P+Y +    
Sbjct: 343 APEVGFKATRSIIDQSCSRANTIDQSMNGYDSKCDIWSLGVITHIMLTGISPFYGDGSEN 402

Query: 548 --VPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQ 602
             +  + R  L   ++     + +AK  +  LL  D D+RL    + +   HP+ S+
Sbjct: 403 SIIQNVKRGKLDFSMKPWNNVNHNAKQFVEKLLEIDADKRLDSKQSFQ---HPWISR 456

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 98.2 bits (243), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 115/242 (47%), Gaps = 32/242 (13%)

Query: 343 DDFDLLKVIGKGSFGKVMQVRKR-DTQKIYALKAI------RKSYIVSKSEVTHTLAERT 395
           D F+    IG+G+ G V     R D  +  A+K +      +K  IV++  V  +   + 
Sbjct: 564 DKFETYLKIGQGASGGVYLSHSRSDKSQCVAIKQMNLEKQPKKELIVNEIMVMSSSKHQN 623

Query: 396 VLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELF----YHLQKEGRFELSRARFYTAE 451
           ++  ++         S+ S   L++V+  + GG L     Y +  EG+           E
Sbjct: 624 IVNYID---------SYLSGLDLWVVMEYMEGGCLTDVVTYCVLTEGQIGA-----VCRE 669

Query: 452 LLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLA 511
           +L  LE LH+  V++RD+K +N+LL   G I L DFG C        K  T  GTP ++A
Sbjct: 670 VLQGLEFLHSKGVLHRDIKSDNVLLSMNGDIKLTDFGFCAQVNDTVIKRTTMVGTPYWMA 729

Query: 512 PELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDED-------VPKMYRKILQDPLRFPE 564
           PE++  + Y   VD W+LGI++ EM+ G PPY +E        +    R  +Q+P R  +
Sbjct: 730 PEIVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGRPEVQEPDRLSK 789

Query: 565 GF 566
            F
Sbjct: 790 DF 791

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 97.8 bits (242), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 75/249 (30%), Positives = 115/249 (46%), Gaps = 23/249 (9%)

Query: 351 IGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVPLKF 410
           IG+G+ G V    +  T    A+K +       K  +   + E  V+     P IV    
Sbjct: 626 IGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELI---INEILVMKGSKHPNIVNFID 682

Query: 411 SFQSPEKLYLVLACINGGELF----YHLQKEGRFELSRARFYTAELLCALETLHNLDVIY 466
           S+     L++++  + GG L     + +  EG+           E L  LE LH+  V++
Sbjct: 683 SYVLKGDLWVIMEYMEGGSLTDVVTHCILTEGQI-----GAVCRETLSGLEFLHSKGVLH 737

Query: 467 RDLKPENILLDYQGHIALCDFGLC----KLNMKDQDKTDTFCGTPEYLAPELLLNQGYSK 522
           RD+K +NILL  +G I L DFG C    +LN+K      T  GTP ++APE++  + Y  
Sbjct: 738 RDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRT----TMVGTPYWMAPEVVSRKEYGP 793

Query: 523 VVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQD---PLRFPEGFDRDAKDLLIGLLS 579
            VD W+LGI++ EM+ G PPY +E   +    I  +    L+ PE      K  L   L 
Sbjct: 794 KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLC 853

Query: 580 RDPDRRLGC 588
            +P+ R   
Sbjct: 854 VEPEDRASA 862

>Scas_668.22
          Length = 893

 Score = 97.4 bits (241), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 114/245 (46%), Gaps = 15/245 (6%)

Query: 351 IGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVPLKF 410
           IG+G+ G V    +  + +  A+K +       K  +   + E  V+     P IV    
Sbjct: 617 IGQGASGGVYIANEIGSNESVAIKQMNLEKQPKKELI---INEILVMKGSRHPNIVNFID 673

Query: 411 SFQSPEKLYLVLACINGGELF----YHLQKEGRFELSRARFYTAELLCALETLHNLDVIY 466
           S+     L++++  + GG L     + +  EG+           E L  L+ LH+  V++
Sbjct: 674 SYLLDGDLWVIMEYMEGGSLTDVVTHCILTEGQIGA-----VCRETLSGLQFLHSKGVLH 728

Query: 467 RDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDW 526
           RD+K +NILL   G I L DFG C    +   K  T  GTP ++APE++  + Y   VD 
Sbjct: 729 RDIKSDNILLSISGDIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVVSRKEYGPKVDI 788

Query: 527 WTLGILLYEMLTGLPPYYDEDVPKMYRKILQD---PLRFPEGFDRDAKDLLIGLLSRDPD 583
           W+LGI++ EM+ G PPY +E   +    I  +    L+ PE      ++ L   L  DP+
Sbjct: 789 WSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKEPENLSAVLRNFLDWCLKVDPE 848

Query: 584 RRLGC 588
           +R   
Sbjct: 849 QRASA 853

>ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH]
           (1386601..1388079) [1479 bp, 492 aa]
          Length = 492

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 85/310 (27%), Positives = 142/310 (45%), Gaps = 51/310 (16%)

Query: 349 KVIGKGSFGKVMQVRKRDTQKI-----YALKAIR---------KSYIVSKSEVT--HTLA 392
           +V+G G+FG+V+   ++          YA+K IR          S +V  + V+   T  
Sbjct: 147 QVVGSGTFGQVLVAERKSAHSKHRPLNYAVKVIRMKREALAKEASILVRLNHVSGIETTG 206

Query: 393 ERTVLARVNCPFIVPLKFSF-QSPEKLYLVLACINGGELFYHLQKE---GRFELSRARFY 448
           E  VL R   P ++ +  +F    + +Y+    + GG+LF +L K+        + A   
Sbjct: 207 EEHVLTRGQ-PNVIKVHDTFVDENDNIYIFEDLVAGGDLFSYLAKKDCLAPISETEALVI 265

Query: 449 TAELLCALETLHNLDVIYRDLKPENILL---DYQGHIALCDFGLCKLNMKDQDKTDTFCG 505
             ++L AL+ LH+  +++RDLK +NILL   +    I L DFG+ K     + +  T  G
Sbjct: 266 VYQILQALKFLHSKGIVHRDLKLDNILLCTPEPCSRIVLADFGIAKDLPSTRVRMHTIVG 325

Query: 506 TPEYLAPEL-----------------LLNQGYSKVVDWWTLGILLYEMLTGLPPYY-DED 547
           TPEY APE+                 +  QGY    D W+LG++ + MLTG+ P+Y D  
Sbjct: 326 TPEYCAPEVGFRVDRNSYRNFSRTASMEQQGYDFKCDLWSLGVMTHIMLTGISPFYGDGT 385

Query: 548 VPKMYRKILQDPLRFPE----GFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQ- 602
              + R +    L F      G    AK  +  LL  + ++R+      +   HP+ ++ 
Sbjct: 386 EASIIRNVKIGKLNFGTKQWVGVSDTAKSFVRQLLEVNAEKRM---SVQDCFKHPWIAKH 442

Query: 603 -LSWKRLWNK 611
               +R++NK
Sbjct: 443 RSHLERIYNK 452

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 81/264 (30%), Positives = 134/264 (50%), Gaps = 27/264 (10%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVN 401
           ID   L + IGKGSF  V    KR + ++     I   +I   S     +++  VL  V 
Sbjct: 12  IDGLQLGRTIGKGSFAFV----KRASLEVDPSTVIAVKFIHLPSCEKQGMSQEDVLREVK 67

Query: 402 ----CP-FIVPLKF--SFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLC 454
               C  F+  LK      S   L++ +    GG+LF  ++ +   +   A+FY  +L+ 
Sbjct: 68  LHSRCSNFVNVLKVIDCNLSDPFLWIAMELAEGGDLFDKIEPDIGVDSEVAQFYYKQLIK 127

Query: 455 ALETLHN-LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFC----GTPEY 509
           A+  LH+   V +RD+KPENILLD  G++ L DFGL  L  K +D +        G+  Y
Sbjct: 128 AISYLHDTCGVAHRDIKPENILLDKDGNLKLADFGLASL-FKRKDGSKRISRDQRGSLPY 186

Query: 510 LAPELLLNQG-YSKVVDWWTLGILLYEMLTGLPPY---YDEDVPKMYRKILQDPLRFPEG 565
           +APE++   G Y+ + D W++G+LL+ +LTG  P+   +++D  + +R  ++   +  +G
Sbjct: 187 MAPEIIYCDGYYADMTDIWSIGVLLFVLLTGETPWELPHEDD--ETFRNFIKGEGKLDQG 244

Query: 566 ----FDRDAKDLLIGLLSRDPDRR 585
                D    +LL  +L  DP++R
Sbjct: 245 SWLKIDFVELNLLRKILQPDPEKR 268

>CAGL0M11748g 1167306..1168649 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1, start by
           similarity
          Length = 447

 Score = 95.1 bits (235), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 93/335 (27%), Positives = 144/335 (42%), Gaps = 69/335 (20%)

Query: 348 LKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERT-----VLARVNC 402
           L  +G G+FG V       T +  A+K I K +       T  LA+RT     +L  +  
Sbjct: 26  LNPVGMGAFGLVCSATDTLTNQQVAIKKIMKPF------ATAVLAKRTYRELKLLKHLRH 79

Query: 403 PFIVPLKFSFQSP-EKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHN 461
             ++ L+  F SP E +Y V   + G +L   LQ     E    +++  ++L  L+ +H+
Sbjct: 80  ENLICLQDIFLSPLEDIYFVTE-LQGTDLHRLLQTRP-LEKQFVQYFHYQILRGLKYVHS 137

Query: 462 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDT-FCGTPEYLAPELLLN-QG 519
             V++RDLKP NIL++    + +CDFGL ++    QD   T +  T  Y APE++L  Q 
Sbjct: 138 AGVVHRDLKPSNILINENCDLKICDFGLARI----QDPQMTGYVSTRYYRAPEIMLTWQK 193

Query: 520 YSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKIL----------------------- 556
           Y   VD W+ G +  EM+ G P +  +D    +  I                        
Sbjct: 194 YDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPSDVIDTICSENTLKFV 253

Query: 557 -----QDPLRFPEGF---DRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRL 608
                +DP+ F E F   + DA DLL  +L  DP +R+    A +   HP          
Sbjct: 254 TSLPHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRI---TAADALAHP---------- 300

Query: 609 WNKGYIPPYKPPVSDAADTRNFDQEFT-KEKPIDS 642
               Y+ PY  P  +      FD  F   + P+D+
Sbjct: 301 ----YLAPYHDPTDEPVAEAKFDWHFNDADLPVDT 331

>Scas_713.38
          Length = 432

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 95/335 (28%), Positives = 145/335 (43%), Gaps = 69/335 (20%)

Query: 348 LKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERT-----VLARVNC 402
           L  +G G+FG V       T +  A+K I K +       T  LA+RT     +L  +  
Sbjct: 26  LNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPF------STAVLAKRTYRELKLLKHLRH 79

Query: 403 PFIVPLKFSFQSP-EKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHN 461
             ++ L+  F SP E +Y V   + G +L   LQ     E    +++  ++L  L+ +H+
Sbjct: 80  ENLICLQDIFLSPLEDIYFVTE-LQGTDLHRLLQTRP-LEKQFVQYFLYQILRGLKYVHS 137

Query: 462 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDT-FCGTPEYLAPELLLN-QG 519
           + VI+RDLKP NIL++    + +CDFGL ++    QD   T +  T  Y APE++L  Q 
Sbjct: 138 VGVIHRDLKPSNILINENCDLKICDFGLARI----QDPQMTGYVSTRYYRAPEIMLTWQK 193

Query: 520 YSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKIL----------------------- 556
           Y   VD W+ G +  EM+ G P +  +D    +  I                        
Sbjct: 194 YDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSENTLKFV 253

Query: 557 -----QDPLRFPEGF---DRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRL 608
                +DP+ F E F   + DA DLL  +L  DP +R+    A E   HP          
Sbjct: 254 TSLPHRDPIPFSERFKTVEPDAVDLLGKMLVFDPKKRV---TAAEALAHP---------- 300

Query: 609 WNKGYIPPYKPPVSDAADTRNFDQEFT-KEKPIDS 642
               Y+ PY  P  +      FD  F   + P+D+
Sbjct: 301 ----YLAPYHDPTDEPVADCKFDWHFNDADLPVDT 331

>Scas_618.15
          Length = 620

 Score = 95.9 bits (237), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 82/332 (24%), Positives = 135/332 (40%), Gaps = 64/332 (19%)

Query: 299 INLKFDSAANIRLYNHHWVTLENTLGRINISVDYK----PSKNKRLTIDDFD---LLKVI 351
           I  KF   A ++ Y      L N +G+   +V Y+    P   K     +      +K+I
Sbjct: 143 ITYKFKEQAELKGYK-----LLNKIGKGAFAVVYRAIPDPQNGKSSYFKEVCNEVAIKII 197

Query: 352 GKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVPLKFS 411
            K    + ++  +RDT  + + + + K   + K            +A   C  +V     
Sbjct: 198 KKVDLSEDLKDHERDTSHVSSREQVLKEACLHK------------VASSECSEVVGFIDF 245

Query: 412 FQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKP 471
            ++    Y+V   ++GGE++  + +   F     R    +L  A++ LH++ +I+RD+KP
Sbjct: 246 VETKSYYYIVQEYLHGGEIYDQIVRLTYFSEDLTRHVIRQLAHAVKHLHSMGIIHRDIKP 305

Query: 472 ENILLDYQGHI----------------------------------ALCDFGLCKLNMKDQ 497
           EN+L +   HI                                   L DFGL K      
Sbjct: 306 ENLLFEPIQHIPSTHVKLRKTDNPFTKVDEGMFRPAIGGGGIGAVKLTDFGLSK--QLST 363

Query: 498 DKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQ 557
           + T+T CGT  Y APEL+ N  Y   +D W +G +LY +L G PP+Y +    + RKI  
Sbjct: 364 ETTNTPCGTISYAAPELIRNHQYDNKIDLWGIGCVLYTLLCGFPPFYADQHKSVTRKIRH 423

Query: 558 DPLRFP----EGFDRDAKDLLIGLLSRDPDRR 585
               F     +     AK+ +  LL  D  +R
Sbjct: 424 GEYHFLSPWWDEISSGAKNCVKHLLEVDVSKR 455

>AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH]
           (807470..808831) [1362 bp, 453 aa]
          Length = 453

 Score = 94.7 bits (234), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 95/335 (28%), Positives = 144/335 (42%), Gaps = 69/335 (20%)

Query: 348 LKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERT-----VLARVNC 402
           L  +G G+FG V       TQ+  A+K I K +       T  LA+RT     +L  +  
Sbjct: 32  LNPVGMGAFGLVCSAVDTYTQQPVAIKKIMKPF------STAVLAKRTYRELKLLKHLRH 85

Query: 403 PFIVPLKFSFQSP-EKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHN 461
             ++ L+  F SP E +Y V   + G +L   LQ     E    +++  ++L  L+ +H+
Sbjct: 86  ENLICLEDIFLSPLEDIYFVTE-LQGTDLHRLLQTRP-LEKQFLQYFLYQILRGLKYVHS 143

Query: 462 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDT-FCGTPEYLAPELLLN-QG 519
             VI+RDLKP NIL++    + +CDFGL ++    QD   T +  T  Y APE++L  Q 
Sbjct: 144 AGVIHRDLKPSNILINENCDLKICDFGLARI----QDPQMTGYVSTRYYRAPEIMLTWQK 199

Query: 520 YSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKIL----------------------- 556
           Y+  VD W+ G +  EM+ G P +  +D    +  I                        
Sbjct: 200 YNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIDTICSENTLKFV 259

Query: 557 -----QDPLRFPEGFDR---DAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRL 608
                +DP+ F E F     DA DLL  +L  DP +R+    A     HP          
Sbjct: 260 TSLPHRDPVPFTERFKNLKPDAVDLLEKMLVFDPKKRITAGDA---LTHP---------- 306

Query: 609 WNKGYIPPYKPPVSDAADTRNFDQEFT-KEKPIDS 642
               Y+ PY  P  +      FD  F   + P+D+
Sbjct: 307 ----YLAPYHDPTDEPVADAKFDWNFNDADLPVDT 337

>Kwal_27.9773
          Length = 406

 Score = 94.0 bits (232), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 134/285 (47%), Gaps = 45/285 (15%)

Query: 343 DDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNC 402
           +++ +L+ IG+GSFG V +V    T ++   K I+  ++ SK E    ++E  +L+++  
Sbjct: 17  NEYQVLEEIGRGSFGSVRKVVHVPTNRVLVRKEIKYGHMNSK-ERQQLISECAILSQLKH 75

Query: 403 PFIVPLKFSFQSPEKLYLVLA-CING--GELFYHLQKEGRFELSRA-------------R 446
             IV         + LY  +  C NG   ++  H +KE ++   R              R
Sbjct: 76  ENIVEFYEWDSDVDVLYFYMEYCSNGDLSQMISHFKKERKYIPERLVWSVMVQVLVALYR 135

Query: 447 FYTAELLCALETLHNLD---------VIYRDLKPENILL---------------DYQG-H 481
            +    L  LET+++           VI+RDLKP NI L               DY    
Sbjct: 136 CHYGSDLAPLETIYDRMKPPVKGSNVVIHRDLKPGNIFLSTERVPDARVALQAFDYSKIS 195

Query: 482 IALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLP 541
           + L DFGL K      +   T+ GTP Y++PE+L++Q YS + D W+LG ++YEM T  P
Sbjct: 196 VKLGDFGLAKSLGASVEFATTYVGTPYYMSPEVLMDQPYSPLSDIWSLGCVIYEMCTLRP 255

Query: 542 PYYDEDVPKMYRKILQDPL-RFPEGFDRDAKDLLIGLLSRDPDRR 585
           P+  +   ++ R+I      R P+ +  + + L+   +  DP+ R
Sbjct: 256 PFQAKTYTELQRRIKTAKFDRIPDYYSDELQMLIESCI--DPNLR 298

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 96.3 bits (238), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 76/272 (27%), Positives = 127/272 (46%), Gaps = 15/272 (5%)

Query: 329  SVDYKPSKNKRLTIDDFDLLK--VIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSE 386
            +++   SKN R    +F  +K  +IGKGSFG V       T ++ A+K +      +++E
Sbjct: 1133 TIEINKSKNARGEYKEFAWMKGEMIGKGSFGAVYLSLNITTGEMMAVKQVEVPKYGTQNE 1192

Query: 387  VTHTLAER-----TVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFE 441
            +   + E        L  ++   IV    S        L L  + GG +   ++  GRF+
Sbjct: 1193 LVKDMVEALKSEVATLKDLDHLNIVQYLGSEIRGNIYSLFLEYVAGGSVGSLIRLYGRFD 1252

Query: 442  LSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTD 501
                R    ++L  L+ LH+  +++RD+K +N+LLD  G   + DFG+ K +      +D
Sbjct: 1253 EKLIRHLNTQVLSGLKYLHSKGILHRDMKADNLLLDEDGICKISDFGISKKSKNIYSNSD 1312

Query: 502  -TFCGTPEYLAPELL-LNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDP 559
             T  GT  ++APE++   QGYS  VD W+LG ++ EM  G  P+ + +V     +I +  
Sbjct: 1313 MTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSK 1372

Query: 560  LRFP------EGFDRDAKDLLIGLLSRDPDRR 585
               P      +      KD L      DP++R
Sbjct: 1373 SAPPIPDDTIQLISSKGKDFLSKCFEIDPEKR 1404

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 96.3 bits (238), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 71/230 (30%), Positives = 116/230 (50%), Gaps = 12/230 (5%)

Query: 335  SKNKRLTIDDFDLLK--VIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLA 392
            S+N R    +F  +K  +IGKGSFG V       T ++ A+K +      S+ E   ++ 
Sbjct: 1026 SRNSRGEYKEFAWIKGEIIGKGSFGAVYLALNVTTGEMLAVKQVTVPEFSSQDESAISMV 1085

Query: 393  ER-----TVLARVNCPFIVPLKFSFQSPEKLY-LVLACINGGELFYHLQKEGRFELSRAR 446
            E      + L  +N   IV     F+    +Y L L  + GG +   ++  GRF+    R
Sbjct: 1086 EALKSEVSTLKDLNHVNIVQY-LGFEEKNGIYSLFLEYVAGGSVGSLIRMYGRFDDQLIR 1144

Query: 447  FYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTD-TFCG 505
              T ++L  L  LH+  +++RD+K +N+LLD  G   + DFG+ + +      +D T  G
Sbjct: 1145 HLTKQVLEGLAYLHSKGILHRDMKADNLLLDNDGVCKISDFGISRKSNNIYSNSDMTMRG 1204

Query: 506  TPEYLAPELL-LNQGYSKVVDWWTLGILLYEMLTGLPPYYD-EDVPKMYR 553
            T  ++APE++    GYS  VD W+LG ++ EM  G  P+ + E V  M++
Sbjct: 1205 TVFWMAPEMVDTAHGYSAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFQ 1254

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 94.7 bits (234), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 114/217 (52%), Gaps = 21/217 (9%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVR-KRDTQKIYALKAIR----KSYIVSKSEVTHTLAERTV 396
           I D  L   +G+G+F  V     + D   I A+K I     K   +S  ++T     + V
Sbjct: 12  IKDVVLGDTVGQGAFACVKNAHLQMDPSIILAVKFIHVPTCKKMGLSDKDIT-----KEV 66

Query: 397 LARVNC---PFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELL 453
           + +  C   P ++ L     S E ++++L   +GG+LF  ++ +   +   A+FY  +L+
Sbjct: 67  VLQSKCSKHPNVLRLIDCNVSKEYMWIILEMADGGDLFDKIEPDVGVDSDVAQFYFQQLV 126

Query: 454 CALETLH-NLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFC----GTPE 508
            A+  LH    V +RD+KPENILLD  G++ L DFGL     + +D T        G+P 
Sbjct: 127 SAINYLHVECGVAHRDIKPENILLDKNGNLKLADFGLAS-QFRRKDGTLRVSMDQRGSPP 185

Query: 509 YLAPELLLNQG--YSKVVDWWTLGILLYEMLTGLPPY 543
           Y+APE+L ++   Y+   D W++GILL+ +LTG  P+
Sbjct: 186 YMAPEVLYSEEGYYADRTDIWSIGILLFVLLTGQTPW 222

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 95.5 bits (236), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 100/204 (49%), Gaps = 13/204 (6%)

Query: 408 LKFSFQSPEKLYLVLACINGGELFYHLQKE-----GRFELSRARF-YTAELLC-ALETLH 460
           L+   ++ + L++V+  + GG L   ++           LS  +  Y     C  L+ LH
Sbjct: 645 LEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTNGSAYSPLSEPQIAYIVRETCKGLKFLH 704

Query: 461 NLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGY 520
           + ++I+RD+K +N+LLD +  + + DFG C      + K  T  GTP ++APE++  + Y
Sbjct: 705 DKNIIHRDIKSDNVLLDTKARVKITDFGFCAKLTDQRSKRATMVGTPYWMAPEVVKQKEY 764

Query: 521 SKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQD---PLRFPEGFDRDAKDLLIGL 577
              VD W+LGI+  EML G PPY +ED  K    I  +    L+ P+    + K  L   
Sbjct: 765 DAKVDVWSLGIMAIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPQSLSLEIKRFLSVC 824

Query: 578 LSRDPDRRLGCNGAHEIKNHPFFS 601
           L  D   R       E+ +H FF+
Sbjct: 825 LCVDVKYRAST---EELLHHSFFN 845

>KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_1
           Kluyveromyces lactis MAP kinase, start by similarity
          Length = 495

 Score = 94.4 bits (233), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 96/366 (26%), Positives = 161/366 (43%), Gaps = 81/366 (22%)

Query: 337 NKRLTIDD-FDLLKVIGKGSFGKVMQVRKRDT--QKIYALKAIRKSY---IVSKSEVTHT 390
           N+  T+D  F L+K IG GS+G V   R  +   +   A+K +   +   ++ K  +   
Sbjct: 16  NQDFTVDKRFQLIKEIGHGSYGIVCSARFTEAADETTVAIKKVTNVFSKTLLCKRSLREL 75

Query: 391 LAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELF--------YHLQKEGRFEL 442
              R      N   +  +   FQ P+ ++      NG  L+        + + K G+  L
Sbjct: 76  KLLRHFRGHKNITCLYDMDIVFQ-PDGMF------NGLYLYEELMECDMHQIVKSGQ-PL 127

Query: 443 SRARF--YTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKT 500
           + A +  +  ++LC L+ +H+ DV++RDLKP N+L++    + +CDFGL +   ++  + 
Sbjct: 128 TDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVEN 187

Query: 501 DTF----CGTPEYLAPELLLN-QGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKI 555
           + F      T  Y APE++L+ QGY+K +D W+ G +L E+L G P +  +D      +I
Sbjct: 188 NQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSCGCILAELLGGKPIFKGKDYVDQLNRI 247

Query: 556 LQDPLRFPE------------------GF-------------DRDAKDLLIGLLSRDPDR 584
           LQ     PE                  G+             + DA +LL G+LS DP  
Sbjct: 248 LQVLGTPPEETLKRIGSKNVQDYIHQLGYIPKIPFSTLYPNANPDALNLLEGMLSFDPQL 307

Query: 585 RLGCNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPIDS-- 642
           R+  + A +   HP+ S      +W+         P  +   T  FD  F     I+   
Sbjct: 308 RITVDDALQ---HPYLS------IWHD--------PADEPICTEKFDFSFESVNEIEQLK 350

Query: 643 --VVDE 646
             V+DE
Sbjct: 351 QMVIDE 356

>Kwal_47.17263
          Length = 1127

 Score = 95.5 bits (236), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 85/330 (25%), Positives = 148/330 (44%), Gaps = 62/330 (18%)

Query: 328 ISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAI--------RKS 379
           IS++Y P  +KR  ++ ++++  +G+G  GKV   R   T+++ A+K +        R S
Sbjct: 89  ISLEYDP-ISKRKVLNTYEIIGELGQGQHGKVKLARDLVTKQLVAIKIVDRNGGKSNRFS 147

Query: 380 YIVSKSEVTHTLAERTVLARVNCPFIVPLK--FSFQSPEKLYLVLACINGGELFY----H 433
           +  + +       E  ++ + +   +V L       +  K+YLVL   + GE+ +     
Sbjct: 148 FKKNTNGSDKIKREIAIMKKCHHEHVVKLVEVLDDSTSRKIYLVLEYCSKGEVKWCPGDQ 207

Query: 434 LQKEGR----FELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGL 489
           L+ E R        RAR     ++  LE LH   +I+RD+KP N+L+   G + + DFG+
Sbjct: 208 LETEARGPPLLTFQRAREIFRGVVLGLEYLHYQGIIHRDIKPANLLISESGTVKISDFGV 267

Query: 490 CKLNMK--------DQDKTDTFCGTPEYLAPELLLNQGYSKV-----------------V 524
                K        D+ +     GTP + APE+ L    S+                  +
Sbjct: 268 SFAASKSGAGYGSLDELELAKTAGTPAFFAPEICLGHEASERFAPDRPSSDHGSIISYNI 327

Query: 525 DWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRF-------PEGFDR--------D 569
           D W +G+ L+ +L G+ P++ E   +++ KI+   L           G  +         
Sbjct: 328 DIWAIGVTLHCLLFGMLPFFSEFELELFDKIINQELVLKTYEEMASNGISKISNQEEYEA 387

Query: 570 AKDLLIGLLSRDPDRRLGCNGAHEIKNHPF 599
           AKDLL  LL+++P +R+      EIK HPF
Sbjct: 388 AKDLLGRLLTKNPFKRIKI---AEIKKHPF 414

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score = 94.0 bits (232), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 64/207 (30%), Positives = 97/207 (46%), Gaps = 10/207 (4%)

Query: 343 DDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNC 402
           +  D L ++G+G+ G V + + R+  KI+ALK I  + I +         E         
Sbjct: 177 EQIDTLGILGEGTGGSVTKCKLRNGSKIFALKTI--ATIENDGSEKQIFRELQFNKSCKS 234

Query: 403 PFIVPL--KFSFQSPEKLYLVLACINGGEL---FYHL-QKEGRFELSRARFYTAELLCAL 456
            FIV     F+ +    +++ +  + G  L   + HL  K GR            +L  L
Sbjct: 235 DFIVRYYGMFACEETSTIFIAMEYMGGRSLDSVYKHLLSKGGRIGEKVLGKIAESVLRGL 294

Query: 457 ETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLL 516
             LH   +I+RD+KP+NIL +  G I LCDFG+    +       TF GT  Y+APE + 
Sbjct: 295 FYLHERKIIHRDIKPQNILFNEIGQIKLCDFGVSGEAVNSL--ATTFTGTSYYMAPERIQ 352

Query: 517 NQGYSKVVDWWTLGILLYEMLTGLPPY 543
            Q YS   D W+LG+ L E+  G  P+
Sbjct: 353 GQPYSVTSDVWSLGLTLLEVAQGHSPF 379

>Kwal_26.7861
          Length = 955

 Score = 95.1 bits (235), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 78/259 (30%), Positives = 120/259 (46%), Gaps = 20/259 (7%)

Query: 351 IGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVPLKF 410
           IG+G+ G V    +  T    A+K +       K  +   + E  V+       IV    
Sbjct: 673 IGQGASGGVYTAYEVGTNASVAIKQMNLEKQPKKELI---INEILVMKASKHANIVNFID 729

Query: 411 SFQSPEKLYLVLACINGGELF----YHLQKEGRF-ELSRARFYTAELLCALETLHNLDVI 465
           S+     L++V+  + GG L     + +  EG+   +SR      E L  L+ LH+  VI
Sbjct: 730 SYLLRGDLWVVMEYMEGGSLTDVVTHCILTEGQIGAVSR------ETLKGLQFLHSKGVI 783

Query: 466 YRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVD 525
           +RD+K +N+LL   G I L DFG C    +   K  T  GTP ++APE++  + Y   VD
Sbjct: 784 HRDIKSDNVLLSMSGEIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVVSRKEYGPKVD 843

Query: 526 WWTLGILLYEMLTGLPPYYDEDVPKMYRKILQD---PLRFPEGFDRDAKDLLIGLLSRDP 582
            W+LGI++ EM+ G PPY +E   +    I  +    L+  +    D K  L   L  +P
Sbjct: 844 IWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKDADSLSDDLKSFLGWCLHVNP 903

Query: 583 DRRLGCNGAHEIKNHPFFS 601
           D R     A ++ + PF S
Sbjct: 904 DERA---TASQLLSDPFIS 919

>KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent ser/thr
           protein kinase, start by similarity
          Length = 546

 Score = 94.0 bits (232), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 65/213 (30%), Positives = 98/213 (46%), Gaps = 41/213 (19%)

Query: 412 FQSPEKLYLVLA-CINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLK 470
           FQ  EK Y ++   + GGE+F  + K   F    +R    +L  A++ +H L +++RD+K
Sbjct: 211 FQESEKYYYIIQELLAGGEIFGEIVKYTYFSEDLSRHVIRQLANAVKYMHQLGIVHRDIK 270

Query: 471 PENILLD----------------------------------YQGHIALCDFGLCKLNMKD 496
           PEN+L +                                    G + L DFGL K     
Sbjct: 271 PENLLFEPIDFIPNPKPKLRSSDDPSTKLDEGVFRPGIGGGGIGVVKLADFGLSKQIY-- 328

Query: 497 QDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKIL 556
           Q  T T CGT  Y APE++ ++ YS  VD W +G +LY +L G PP++DE +  +  KI 
Sbjct: 329 QTNTKTPCGTVGYTAPEVVKDERYSMQVDMWGVGCVLYTVLCGFPPFFDEKIDVLTEKIS 388

Query: 557 QDPLRF--P--EGFDRDAKDLLIGLLSRDPDRR 585
           +    F  P  +     AK+ +  LL  DP +R
Sbjct: 389 RGEYTFLRPWWDQISDGAKNCVRKLLEVDPAKR 421

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 94.7 bits (234), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 102/204 (50%), Gaps = 13/204 (6%)

Query: 408 LKFSFQSPEKLYLVLACINGGELFYHLQKE-----GRFELSRAR--FYTAELLCALETLH 460
           L+   ++ + L++V+  + GG L   ++       G+  L+  +  +   E    L+ LH
Sbjct: 663 LEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTGSSGQSPLTEPQIAYIVRETCQGLKFLH 722

Query: 461 NLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGY 520
           +  +I+RD+K +N+LLD +G + + DFG C      + K  T  GTP ++APE++  + Y
Sbjct: 723 DKHIIHRDIKSDNVLLDTRGRVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREY 782

Query: 521 SKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQD---PLRFPEGFDRDAKDLLIGL 577
            + VD W+LGI+  EML   PPY +E+  K    I  +    L+ PE    + K  L   
Sbjct: 783 DEKVDVWSLGIMTIEMLESEPPYLNEEPLKALYLIATNGTPKLKHPEYLSLEIKRFLSVC 842

Query: 578 LSRDPDRRLGCNGAHEIKNHPFFS 601
           L  D   R       E+ +H FF+
Sbjct: 843 LCVDVKYRAST---EELLHHSFFN 863

>Scas_707.34
          Length = 905

 Score = 94.7 bits (234), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 83/320 (25%), Positives = 146/320 (45%), Gaps = 71/320 (22%)

Query: 337 NKRLTI----DDFDLLKVIGKGSFGKV------------MQVRKRDTQKI-----YALKA 375
           N+R TI    D + + K IGKGSF  V            +     D+  I     +A+K 
Sbjct: 26  NERTTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKI 85

Query: 376 IRKSYIVSKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQ 435
           + +S + +K  + +   E  +L +++ P IV L    ++ +  YL++   + G+L + ++
Sbjct: 86  VPRSKLKNKKLLENLEIEIAILKKISHPHIVKLIDFERTSKDFYLIMEYCSLGDLTFLIK 145

Query: 436 KEGRF----------------------ELSRARF--YTAELLCALETLHNLDVIYRDLKP 471
           K  +                        L +A    Y  +L  AL+ L + ++++RD+KP
Sbjct: 146 KRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKNLVHRDIKP 205

Query: 472 ENILL-----DYQGH----------------IALCDFGLCKLNMKDQDKTDTFCGTPEYL 510
           +N+LL     +Y                   + + DFG  +  + +    +T CG+P Y+
Sbjct: 206 QNLLLSAPLINYNDPKSFHDLGFVGIYNLPILKIADFGFARF-LPNTSMAETLCGSPLYM 264

Query: 511 APELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKI--LQDPLRFPE--GF 566
           APE+L  Q Y+   D W++G +LYEM  G PP+   +  ++Y+KI    D + FP     
Sbjct: 265 APEILNYQKYNAKADLWSVGTVLYEMCYGNPPFKASNHLELYKKIKKANDLIYFPTYIEI 324

Query: 567 DRDAKDLLIGLLSRDPDRRL 586
           D + K L+  LL+ DP  R+
Sbjct: 325 DNNLKSLISKLLTFDPQERI 344

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 94.4 bits (233), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 98/203 (48%), Gaps = 13/203 (6%)

Query: 408 LKFSFQSPEKLYLVLACINGGELFYHLQ-------KEGRFELSRARFYTAELLCALETLH 460
           L+   ++ + L++V+  + GG L   ++        E      +  +   E    L+ LH
Sbjct: 577 LEAYLKTEDDLWVVMEYMEGGSLTDVIENSIGSDASESPMTEPQIAYIVRETCQGLKFLH 636

Query: 461 NLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGY 520
           +  +I+RD+K +N+LLD  G + + DFG C      + K  T  GTP ++APE++  + Y
Sbjct: 637 DKHIIHRDIKSDNVLLDTHGRVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREY 696

Query: 521 SKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQD---PLRFPEGFDRDAKDLLIGL 577
            + VD W+LGI+  EML G PPY +E+  K    I  +    L+ PE    + K  L   
Sbjct: 697 DEKVDVWSLGIMTIEMLEGEPPYLNEEPLKALYLIATNGTPKLKHPELLSLEIKRFLSVC 756

Query: 578 LSRDPDRRLGCNGAHEIKNHPFF 600
           L  D   R       E+ +H FF
Sbjct: 757 LCVDVRYRAST---EELLHHSFF 776

>AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH]
           (291129..292676) [1548 bp, 515 aa]
          Length = 515

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 79/277 (28%), Positives = 133/277 (48%), Gaps = 26/277 (9%)

Query: 342 IDDFDLLKVIGKGSFGKVMQVRKR-DTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARV 400
           I + +L + IG+G+F  V     R D Q I A+K +      ++      L  R V+ + 
Sbjct: 12  IKELELGETIGQGTFAFVKTASLRADPQTIVAVKFVHVERCKARGMTDEDLT-REVVLQT 70

Query: 401 NCP---FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALE 457
            C     +V +     S E L++ +   +GG+LF  ++ +   +   ARFY  +L+ AL 
Sbjct: 71  RCAGHRHVVRVLDCNVSREYLWIAMELADGGDLFDKIEPDVGVDSEVARFYYQQLVRALT 130

Query: 458 TLHN-LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD-------QDKTDTFCGTPEY 509
            LH    V +RD+KPEN+LLD  G++ + DFGL     +        +D+     GT  Y
Sbjct: 131 HLHEACGVAHRDIKPENMLLDRAGNLKVADFGLATRFRRRDGTRRLARDRR----GTLPY 186

Query: 510 LAPELLLNQGY-SKVVDWWTLGILLYEMLTGLPPYYDEDVPK-MYRKILQDPLRFPEG-- 565
           LAPE++  + Y +   D W+ G+L++ +LTG  P+ +  V   M+R  + D     +G  
Sbjct: 187 LAPEVVGERAYHADTADIWSAGVLVFVLLTGETPWSEPSVDDGMFRAFVADGGNLSDGPW 246

Query: 566 --FDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFF 600
                   +LL  +L + P  R       +++ HP+F
Sbjct: 247 GKIGLVELNLLRKMLQQRPAARATLA---QLRQHPWF 280

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 87/307 (28%), Positives = 141/307 (45%), Gaps = 49/307 (15%)

Query: 338 KRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAI-----RKSYIVS-KSEVTHTL 391
           KR  +++F++L  +G G +GKV   R   T  + A+K +     R  Y +  K E     
Sbjct: 43  KRQILNNFEILATLGNGQYGKVKLARDLGTGALVAIKILNRFEKRSGYSLQLKVENPRVN 102

Query: 392 AERTVLARVNCPFIVPLKFSFQSPE--KLYLVLACINGGELFYHLQKEGRFEL------- 442
            E  V+ R +   +V L      PE  K+YLVL   + G + +    E + E+       
Sbjct: 103 QEIEVMKRCHHENVVELYEILNDPESTKVYLVLEYCSRGPVKWC--PENKMEIKAVGPSI 160

Query: 443 ---SRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLC------KLN 493
               ++R    +++  LE LH+  + +RD+KP N+L+   G + + DFG+         N
Sbjct: 161 LTFQQSRKVVLDVVSGLEYLHSQGITHRDIKPSNLLISSNGTVKISDFGVAMSTATGSTN 220

Query: 494 MK---DQDKTDTFCGTPEYLAPELLLNQ---GYSKVVDWWTLGILLYEMLTGLPPYYDED 547
           ++   +Q       GTP + APEL   +     S  +D W+LG+ +Y +L G  P+    
Sbjct: 221 IQSSHEQLLKSRALGTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPFNANS 280

Query: 548 VPKMYRKILQDPLRFPEGFD--------------RDAKDLLIGLLSRDPDRRLGCNGAHE 593
             +++  I+  PL FP   +               DAKDLL  LL +DPD+R+      +
Sbjct: 281 GLELFDSIINKPLEFPSYEEMLNGATSGITMEEYTDAKDLLKKLLQKDPDKRIKL---AD 337

Query: 594 IKNHPFF 600
           IK HPF 
Sbjct: 338 IKVHPFM 344

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 93.6 bits (231), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 86/289 (29%), Positives = 136/289 (47%), Gaps = 26/289 (8%)

Query: 330  VDYKPSKNKRLTIDDFDLLK--VIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEV 387
            V    SKN +    +F  +K  +IGKGSFG V       T ++ A+K +      S+ E 
Sbjct: 1107 VSINKSKNSKGEYREFAWIKGEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDET 1166

Query: 388  T-----HTLAERTVLARVNCPFIVPLKFSFQSPEKLY-LVLACINGGELFYHLQKEGRFE 441
            T       ++E + L  ++   IV     F++   +Y L L  + GG +   ++  G F+
Sbjct: 1167 TVNNAEALISEVSTLKDLDHLNIVQY-LGFENKNCIYSLFLEYVAGGSVGSLIRLYGHFD 1225

Query: 442  LSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLC-KLNMKDQDKT 500
                RF T ++L  L  LH   +++RD+K +N+LLD  G   + DFG+  K N    +  
Sbjct: 1226 EQLIRFLTTQVLEGLAYLHLRGILHRDMKADNLLLDNDGVCKISDFGISRKSNNIYSNSE 1285

Query: 501  DTFCGTPEYLAPELL-LNQGYSKVVDWWTLGILLYEMLTGLPPYYD-EDVPKMYR----- 553
             T  GT  ++APE++   QGYS  VD W+LG ++ EM  G  P+ + E V  M++     
Sbjct: 1286 MTMRGTVFWMAPEMVDTTQGYSAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSK 1345

Query: 554  ---KILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPF 599
                I +D L       +D +  L      DP+ R     A  + +HPF
Sbjct: 1346 SAPPIPEDTLPH---ISQDGRAFLDDCFMIDPEERP---TADTLLSHPF 1388

>Kwal_23.5576
          Length = 504

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 124/237 (52%), Gaps = 19/237 (8%)

Query: 337 NKRLTIDD-FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVT-HTLAER 394
           N+  T+D  F L+K IG G++G V   R  +  +   +   + + + SK+ +   +L E 
Sbjct: 14  NQEFTVDKRFQLIKEIGHGAYGIVCSARFIEAAEETNVAIKKVTNVFSKTLLCKRSLREL 73

Query: 395 TVL------ARVNCPFIVPLKFSFQSP-EKLYLVLACINGGELFYHLQKEGRFELSRARF 447
            +L        + C + + + FS  +    LYL    +      + + K G+  L+ A +
Sbjct: 74  KLLRHFRGHKNITCLYDMDIVFSPNNTFNGLYLYEELMECD--IHQIIKSGQ-PLTDAHY 130

Query: 448 --YTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTF-- 503
             +  +LLCAL+ +H+ DV++RDLKP N+L++    + +CDFGL +   ++  + + F  
Sbjct: 131 QSFIYQLLCALKYIHSADVLHRDLKPGNLLVNADCQLKVCDFGLARGYSENPVENNQFLT 190

Query: 504 --CGTPEYLAPELLLN-QGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQ 557
               T  Y APE++L+ QGY+K +D W+ G +L E+L G P +  +D      +ILQ
Sbjct: 191 EYVATRWYRAPEIMLSYQGYTKAIDIWSCGCILAELLGGKPIFKGKDYVDQLNRILQ 247

>CAGL0I04422g 394159..395427 some similarities with sp|P22209
           Saccharomyces cerevisiae YAR018c KIN3 ser/thr protein
           kinase, hypothetical start
          Length = 422

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/277 (27%), Positives = 126/277 (45%), Gaps = 67/277 (24%)

Query: 344 DFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCP 403
           D+ ++K IG+GSFG V +V    TQ++   K I+  ++ SK E    +AE T+L+++   
Sbjct: 13  DYQVVKEIGRGSFGSVHKVIHVPTQQVLVRKDIKYGHMNSK-ERQQLIAECTILSQLKHE 71

Query: 404 FIVPLKFSF---QSPEKLYLVLACINGGEL---FYHLQKEGRFELSRARF-YTAELLCAL 456
            IV   +S+   +  E LYL +   + G+L     H ++E ++   +  +   A++L AL
Sbjct: 72  NIVEF-YSWDFNEQQEVLYLYMEYCSRGDLSGMIKHYKQEHKYIPEKVVWGILAQMLTAL 130

Query: 457 ETLHNLD---------------------VIYRDLKPENILLDY----------------- 478
              H  +                     VI+RDLKP NI L Y                 
Sbjct: 131 YKCHYGEELPSLTTIYDRMKPPSKGRNIVIHRDLKPGNIFLSYDDNSSDSTDKADIAQSN 190

Query: 479 --------------------QGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQ 518
                               Q  + + DFGL K      D   T+ GTP Y++PE+L++Q
Sbjct: 191 WYRKPNNRGGDESKLTTDYSQVVVKVGDFGLAKSLATSVDFATTYVGTPYYMSPEVLMDQ 250

Query: 519 GYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKI 555
            YS + D W+LG ++YEM +  PP+  ++  ++  KI
Sbjct: 251 PYSPLSDIWSLGCVIYEMCSLHPPFLAKNYLELQTKI 287

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 93.2 bits (230), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/134 (38%), Positives = 76/134 (56%), Gaps = 11/134 (8%)

Query: 418 LYLVLACINGGELF----YHLQKEGRF-ELSRARFYTAELLCALETLHNLDVIYRDLKPE 472
           L++V+  + GG L     + +  EG+   +SR      E L  L+ LH+  VI+RD+K +
Sbjct: 768 LWVVMEYMEGGSLTDVVTHCILTEGQIGAVSR------ETLKGLQFLHSKGVIHRDIKSD 821

Query: 473 NILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGIL 532
           NILL   G I L DFG C    +   K  T  GTP ++APE++  + Y   VD W+LGI+
Sbjct: 822 NILLSMNGDIKLTDFGFCAQINEVNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIM 881

Query: 533 LYEMLTGLPPYYDE 546
           + EM+ G PPY +E
Sbjct: 882 IIEMIEGEPPYLNE 895

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 92.8 bits (229), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 74/133 (55%), Gaps = 9/133 (6%)

Query: 418 LYLVLACINGGELF----YHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPEN 473
           L++++  + GG L     + +  EG+         + E L  L  LH+  VI+RD+K +N
Sbjct: 753 LWVIMEYMEGGSLTDVVTHCILTEGQIAA-----VSRETLRGLHFLHSKGVIHRDIKSDN 807

Query: 474 ILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILL 533
           ILL   G+I L DFG C    +   K  T  GTP ++APE++  + Y   VD W+LGI++
Sbjct: 808 ILLSMDGNIKLTDFGFCAQINETNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMI 867

Query: 534 YEMLTGLPPYYDE 546
            EM+ G PPY +E
Sbjct: 868 IEMIEGEPPYLNE 880

>KLLA0F20053g 1867209..1868543 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1 ser/thr protein
           kinase of MAP kinase (MAPK) family, start by similarity
          Length = 444

 Score = 90.9 bits (224), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 93/335 (27%), Positives = 144/335 (42%), Gaps = 69/335 (20%)

Query: 348 LKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERT-----VLARVNC 402
           L  +G G+FG V       T +  A+K I K +       T  LA+RT     +L  +  
Sbjct: 25  LNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPF------STSVLAKRTYRELKLLKHLRH 78

Query: 403 PFIVPLKFSFQSP-EKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHN 461
             ++ L+  F SP E +Y V   + G +L   LQ     E    +++  ++L  L+ +H+
Sbjct: 79  ENLICLEDIFLSPLEDIYFVTE-LQGTDLHRLLQTRP-LEKQFVQYFLYQILRGLKYVHS 136

Query: 462 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDT-FCGTPEYLAPELLLN-QG 519
             VI+RDLKP NIL++    + +CDFGL ++    QD   T +  T  Y APE++L  Q 
Sbjct: 137 AGVIHRDLKPSNILINENCDLKICDFGLARI----QDPQMTGYVSTRYYRAPEIMLTWQK 192

Query: 520 YSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKIL----------------------- 556
           Y+  VD W+ G +  EM+ G P +  +D    +  I                        
Sbjct: 193 YNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIDTICSENTLKFV 252

Query: 557 -----QDPLRFPEGF---DRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRL 608
                +DP+ F   F   + DA DLL  +L  DP +R+    A +   HP+ S       
Sbjct: 253 TSLPHRDPVPFSSRFQNLEPDAIDLLEKMLVFDPKKRI---TAADALAHPYLS------- 302

Query: 609 WNKGYIPPYKPPVSDAADTRNFDQEFT-KEKPIDS 642
                  PY  P  +      FD  F   + P+D+
Sbjct: 303 -------PYHDPTDEPIAEAKFDWNFNDADLPVDT 330

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 91.3 bits (225), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 119/237 (50%), Gaps = 21/237 (8%)

Query: 349 KVIGKGSFGKVMQVRKRDTQKIYALKAIRKSY-----IVSKSEVTHTLAERTVLARVNCP 403
           ++I  GSF  V   +   T +  ALK +RK +     +   + + H   E  +L R+   
Sbjct: 11  RLIQSGSFSVVHHAQDCQTGQDVALKYVRKPHDNPEQLQKVAALVHN--EYAILRRLGTH 68

Query: 404 F-IVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTA--ELLCALETLH 460
             I  L   ++  +    VL     G+L+  ++        R  F++   +L  A+   H
Sbjct: 69  RNICQLLDFYEDADTYVFVLEYCAYGDLYDFIKAIRERPTMRINFHSFLFQLCSAISYCH 128

Query: 461 NLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFC-GTPEYLAPELLLNQG 519
           + DV +RD+KPEN+L+D +G + L DFGL ++    +D    +C GT +YLAPE  L + 
Sbjct: 129 SKDVSHRDIKPENVLMDDRGQVKLTDFGLSQIGSVSKD----YCIGTEKYLAPETFLREY 184

Query: 520 YSK-VVDWWTLGILLYEMLTGLPPY--YDEDVPKM---YRKILQDPLRFPEGFDRDA 570
           ++    D+W+LGI ++ ++ G  P+     D PK    +++ ++DP RF E +  DA
Sbjct: 185 HNTFATDYWSLGITIFCLMFGSCPFESASSDAPKRSANFQRFIRDPHRFVESYYLDA 241

>Kwal_14.2497
          Length = 418

 Score = 90.1 bits (222), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 102/186 (54%), Gaps = 14/186 (7%)

Query: 426 NGGELFYHLQKEGRFELSRARFYTAELLCALETLHN-LDVIYRDLKPENILLDYQGHIAL 484
           +GG+LF  ++ +   +   ARFY  +L+ A++ LHN   V +RD+KPEN+LLD +G++ L
Sbjct: 5   SGGDLFDKIEPDVGVDSEVARFYFKQLINAIDHLHNRCGVAHRDIKPENLLLDERGNLKL 64

Query: 485 CDFGLC-KLNMKDQDK---TDTFCGTPEYLAPELLLNQG-YSKVVDWWTLGILLYEMLTG 539
            DFGL  +   KD  K   +DT    P Y+APE++ ++  Y+   D W+ G+L++ +LTG
Sbjct: 65  ADFGLASQFKRKDGSKRIMSDTRGSLP-YMAPEIVYSKSYYADSTDIWSCGVLVFVLLTG 123

Query: 540 LPPYYDEDVPKMYRKILQDPLRFPEG----FDRDAKDLLIGLLSRDPDRRLGCNGAHEIK 595
             P+        +   L++      G     D    +LL  +L  DP RR     A ++K
Sbjct: 124 ETPWDSPSDDSRFDDFLENSGGIASGSWAKIDISQLNLLRKMLHPDPARRA---TAEQLK 180

Query: 596 NHPFFS 601
           +H ++S
Sbjct: 181 SHNWYS 186

>Kwal_27.12559
          Length = 414

 Score = 89.7 bits (221), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 93/362 (25%), Positives = 155/362 (42%), Gaps = 59/362 (16%)

Query: 291 HLDSLQIPINLKFDSAANIRLYNHHWVTLENTLGRINIS-VDYKPSKNKRLTIDDFDLLK 349
           H+ S ++P +   DS A  R        +    G +++S V     K    T  ++++++
Sbjct: 17  HISSKEVPQSKGADSLAKDR------TEIPELPGAVSVSAVRTIYQKANFSTPGNYEIIQ 70

Query: 350 VIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVL------ARVNCP 403
           V+GKGS+G V+    +         AI+K   +   E+    A R +          N  
Sbjct: 71  VLGKGSYGVVVSAIDKGEDGKPRRLAIKKVTNIFNREILLKRAIRELKFLNFFKGHKNIV 130

Query: 404 FIVPLKFSFQSP-EKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNL 462
            +V L+   + P + LY     ++  +L   +    +F     + +  ++LC L+ +H+ 
Sbjct: 131 SLVDLEIVSEKPYDGLYCYQELVDY-DLARVIHSTVQFSEFHIKHFLYQILCGLKYIHSA 189

Query: 463 DVIYRDLKPENILLDYQGHIALCDFGLCK-------LNMKDQDKTDTFCGTPEYLAPELL 515
           DVI+RDLKP NIL    G++ +CDFGL +           D+    ++  T  Y APEL+
Sbjct: 190 DVIHRDLKPGNILCSIGGNLKICDFGLARGIAPQYFEQKSDEIHITSYVATRWYRAPELI 249

Query: 516 L-NQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQ---DPLR---------- 561
           L ++ Y+K +D W +G +L E     P +   D      +IL+    P R          
Sbjct: 250 LSHRRYTKAIDIWAVGCILAEFYGRKPIFMGHDSLHQVSEILKVLGSPCRETVAKYCSAR 309

Query: 562 -------------------FPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQ 602
                              +P+    DA+ LL  LL+ DPD+R G   A     HPFF  
Sbjct: 310 SWEIFSGRSEVKKMPWSSVYPKSCS-DAQALLDMLLTWDPDKRPGVEVA---LCHPFFED 365

Query: 603 LS 604
           +S
Sbjct: 366 VS 367

>AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W
           (RCK1) - SH] complement(289989..291593) [1605 bp, 534
           aa]
          Length = 534

 Score = 90.9 bits (224), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 84/308 (27%), Positives = 131/308 (42%), Gaps = 69/308 (22%)

Query: 345 FDLLKVIGKGSFGKVMQ-VRKRDTQKIY--------ALKAIRKSYIVSKSEVT------- 388
           + LL  IG+G+F +V + V  +D    Y        A+K I K  + + +  T       
Sbjct: 91  YKLLGKIGEGAFSEVYRAVPLKDGPNAYLSSRYKQVAVKVISKKRLSTTASTTGRRRDKR 150

Query: 389 ------------HTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLA-CINGGELFYHLQ 435
                         L E T+   V+    +     FQ  E  Y ++   + GGE+F  + 
Sbjct: 151 EEAGENKATSREQVLKEITIHKAVSSGENIVTFIDFQETESYYFIVQELLAGGEIFGEIV 210

Query: 436 KEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENIL---LDY-------------- 478
           +   F    +R    +L  A++ +H+L +++RD+KPEN+L   +D+              
Sbjct: 211 RLTYFSEDLSRHVIRQLALAVKHMHSLGIVHRDIKPENLLFSPIDFIPSKRQQLRQSDDP 270

Query: 479 -----------------QGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYS 521
                             G I L DFGL K        T T CGT  Y APE++ ++ YS
Sbjct: 271 KTKQDEGLFRPGIGGGGIGVIKLADFGLSKQIYATN--TTTPCGTVGYTAPEVVKDERYS 328

Query: 522 KVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRF--P--EGFDRDAKDLLIGL 577
             VD W +G +LY +L G PP+YDE +  +   I +    F  P  +     AK+ +  L
Sbjct: 329 MKVDMWGIGCVLYTVLCGFPPFYDEKIDVLTELISKGQYTFLRPWWDEISPGAKNAVRRL 388

Query: 578 LSRDPDRR 585
           L  DPD+R
Sbjct: 389 LEVDPDKR 396

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 90.9 bits (224), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 96/207 (46%), Gaps = 9/207 (4%)

Query: 343 DDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNC 402
           D  + L V+G+G+ G V + + R   KI+ALK I  +    +        E         
Sbjct: 234 DQIEELGVLGEGAGGSVTKCKLRHGSKIFALKTI-TTLTTDQESQKQIFRELQFNKSCKS 292

Query: 403 PFIVPLKFSFQSPE--KLYLVLACINGGEL---FYHLQKEGRFELSRARFYTAE-LLCAL 456
            +IV     F   E   +Y+ +  + G  L   + HL K G     +     AE +L  L
Sbjct: 293 DYIVRYYGMFTDEEHSSIYIAMEYMGGRSLDAIYKHLLKHGGRVGEKVLGKIAESVLRGL 352

Query: 457 ETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLL 516
             LH   +I+RD+KP+NILL+  G + LCDFG+    +       TF GT  Y+APE + 
Sbjct: 353 SYLHQRKIIHRDIKPQNILLNEAGQVKLCDFGVSGEAVNSL--ATTFTGTSYYMAPERIQ 410

Query: 517 NQGYSKVVDWWTLGILLYEMLTGLPPY 543
            Q YS   D W+LG+ L E+     P+
Sbjct: 411 GQPYSVTSDVWSLGLTLLEVAQAHFPF 437

>Kwal_23.5290
          Length = 819

 Score = 91.3 bits (225), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 97/203 (47%), Gaps = 13/203 (6%)

Query: 408 LKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRA-------RFYTAELLCALETLH 460
           L+   ++ + L++V+  + GG L   ++       S +        +   E    L+ LH
Sbjct: 603 LEAYLKTEDDLWVVMEYMEGGSLTDLIENSPANGSSHSPLTEPQIAYIVRETCQGLKFLH 662

Query: 461 NLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGY 520
           +  +I+RD+K +N+LLD +  + + DFG C      + K  T  GTP ++APE++  + Y
Sbjct: 663 DKHIIHRDIKSDNVLLDNRARVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREY 722

Query: 521 SKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQD---PLRFPEGFDRDAKDLLIGL 577
            + VD W+LGI+  EML G PPY +ED  K    I  +    L+ PE      K  L   
Sbjct: 723 DEKVDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIATNGTPKLKQPEVLSLKIKRFLSVC 782

Query: 578 LSRDPDRRLGCNGAHEIKNHPFF 600
           L  D   R       E+ +H FF
Sbjct: 783 LCVDVKYRAST---EELLHHSFF 802

>YHR030C (SLT2) [2317] chr8 complement(168882..170336)
           Serine/threonine protein kinase of MAP kinase family
           involved in the cell wall integrity (low-osmolarity)
           pathway and in G2 phase cell-cycle checkpoint control
           [1455 bp, 484 aa]
          Length = 484

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 84/313 (26%), Positives = 146/313 (46%), Gaps = 55/313 (17%)

Query: 337 NKRLTIDD-FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVT-HTLAER 394
           N+  ++D  F L+K IG G++G V   R  +  +   +   + + + SK+ +   +L E 
Sbjct: 14  NQDFSVDKRFQLIKEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVFSKTLLCKRSLREL 73

Query: 395 TVL------ARVNCPFIVPLKFSFQ-SPEKLYLVLACINGGELFYHLQKEGRFELSRARF 447
            +L        + C + + + F    S   LYL    +      + + K G+  L+ A +
Sbjct: 74  KLLRHFRGHKNITCLYDMDIVFYPDGSINGLYLYEELMECD--MHQIIKSGQ-PLTDAHY 130

Query: 448 --YTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTF-- 503
             +T ++LC L+ +H+ DV++RDLKP N+L++    + +CDFGL +   ++  +   F  
Sbjct: 131 QSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENSQFLT 190

Query: 504 --CGTPEYLAPELLLN-QGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQ--- 557
               T  Y APE++L+ QGY+K +D W+ G +L E L G P +  +D      +ILQ   
Sbjct: 191 EYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGKPIFKGKDYVNQLNQILQVLG 250

Query: 558 ----DPLR-------------------------FPEGFDRDAKDLLIGLLSRDPDRRLGC 588
               + LR                         +P   +  A DLL  +L+ DP +R+  
Sbjct: 251 TPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNA-NSQALDLLEQMLAFDPQKRITV 309

Query: 589 NGAHEIKNHPFFS 601
           + A E   HP+ S
Sbjct: 310 DEALE---HPYLS 319

>Kwal_55.20326
          Length = 750

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 116/271 (42%), Gaps = 37/271 (13%)

Query: 351 IGKGSFGKVMQVRKRDTQKIYALK-------------------------------AIRKS 379
           IG GSFG V       T ++ A+K                               A++ S
Sbjct: 464 IGSGSFGSVYLGMNAQTGELMAVKQVELQPTAVAAGVVSVPDEVKKQYNQNANGSAVKNS 523

Query: 380 YIVSKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGR 439
             V +  V     E  +L  +    IV    S Q    L + L  + GG +   L   G 
Sbjct: 524 SQVHRKMVDALQHEMGLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNSYGP 583

Query: 440 FELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCK----LNMK 495
           FE    R +T ++L  L  LH  D+I+RD+K  NIL+D +G + + DFG+ K    LN +
Sbjct: 584 FEEPLIRNFTRQILIGLSYLHRKDIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNQQ 643

Query: 496 DQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKI 555
            Q+K  +  G+  ++APE++     +K  D W++G ++ EM TG  P+ D    +   KI
Sbjct: 644 -QNKRASLQGSVYWMAPEVVKQVVTTKKADIWSVGCVIIEMFTGKHPFPDFSQMQAIFKI 702

Query: 556 LQDPL-RFPEGFDRDAKDLLIGLLSRDPDRR 585
             +     P     +AKD L+     D  +R
Sbjct: 703 GTNTFPDSPSWSSNEAKDFLLKTFELDYRKR 733

>Scas_713.21
          Length = 641

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 85/293 (29%), Positives = 140/293 (47%), Gaps = 39/293 (13%)

Query: 339 RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTV-- 396
           R+T ++  +++++GKG   KV +V+ R T K YALK I    +    E   T  ER +  
Sbjct: 315 RITDEELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIEL 370

Query: 397 LARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFY--HLQKEGRFELSRARFYTAELLC 454
           L R+     V     ++  +++  VL      +L +  H +    F+++  R  + E++ 
Sbjct: 371 LKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIE 430

Query: 455 ALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKT-----DTFCGTPEY 509
            ++ +H+ D+++ DLKP N +   +G + L DFG+     K  D T     +T  GTP Y
Sbjct: 431 CIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN---KIADNTLNVYRNTQMGTPNY 486

Query: 510 LAPELLLNQGYS-----------KVVDWWTLGILLYEMLTGLPPY-----YDEDVPKMYR 553
           +APE L++Q YS           K  D W+ G +LY+M  G PPY     +D  +  M  
Sbjct: 487 MAPETLISQNYSNNNNNLLWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNP 546

Query: 554 KILQD-PLRFPEG--FDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQL 603
            I  D P   P G    +    L+   L+RDP  R   +   EI++  FF+ +
Sbjct: 547 NIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTD---EIQHCSFFNPM 596

>Scas_598.6
          Length = 790

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 96/203 (47%), Gaps = 13/203 (6%)

Query: 408 LKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRA-------RFYTAELLCALETLH 460
           L+   ++ + L++V+  + GG L   ++       S +        +   E    L+ LH
Sbjct: 574 LEAYLKTEDDLWVVMEFMEGGSLTDIIENSPATGSSSSPLTEPQIAYIVRETCQGLKFLH 633

Query: 461 NLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGY 520
           +  +I+RD+K +N+LLD    + + DFG C      + K  T  GTP ++APE++  + Y
Sbjct: 634 DKHIIHRDIKSDNVLLDNNARVKITDFGFCAKLTDQRSKRATMVGTPYWMAPEVVKQREY 693

Query: 521 SKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQD---PLRFPEGFDRDAKDLLIGL 577
            + VD W+LGI+  EML   PPY +ED  K    I  +    L+ PE    + K  L   
Sbjct: 694 DEKVDVWSLGIMTIEMLESEPPYLNEDPLKALYLIATNGTPKLKNPESLSLEIKRFLSVC 753

Query: 578 LSRDPDRRLGCNGAHEIKNHPFF 600
           L  D   R       E+ +H FF
Sbjct: 754 LCVDVRYRAST---EELLHHGFF 773

>AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH]
           (1043479..1044750) [1272 bp, 423 aa]
          Length = 423

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 84/308 (27%), Positives = 137/308 (44%), Gaps = 58/308 (18%)

Query: 334 PSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAE 393
           P K      ++F +L+ IG+GSFG V +V    T K+   K I+  ++ SK E    +AE
Sbjct: 16  PQKLGHSQPNEFKVLEEIGRGSFGSVRKVLHVPTSKLMVRKEIKYGHMNSK-ERQQLIAE 74

Query: 394 RTVLARVNCPFIVPL------------KFSFQSPEKLYLVL---ACINGGELFYHLQKEG 438
            T+LA +    IV                 + + E LYL +   +C +  ++  H +   
Sbjct: 75  CTILAGLRHENIVEFYNWDHASSRTGNSVDYGNGEVLYLYMEYCSCGDLSQMIKHYKGMR 134

Query: 439 RFELSRARFYTA-ELLCALETLH------NLDVIY--------------------RDLKP 471
           ++   R  +  A +LL AL   H       LD IY                    RDLKP
Sbjct: 135 KYVPERDIWRIAVQLLLALYKCHTSCDLPQLDTIYDKISKSAIESEAGKVTSVIHRDLKP 194

Query: 472 ENILLDYQG------------HIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQG 519
            NI L   G             + L DFGL K      +   T+ GTP Y++PE+L++Q 
Sbjct: 195 GNIFLTGDGVGGRGSVDYSKVEVKLGDFGLAKSLQSAIEFATTYVGTPYYMSPEVLMDQP 254

Query: 520 YSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQ-DPLRFPEGFDRDAKDLLIGLL 578
           YS + D W+LG ++YE+     P+   +  ++ R I + D    P+ + ++ + L+I  +
Sbjct: 255 YSPLSDIWSLGCVIYELCALRVPFPARNFMELQRMIQRADVQPLPDYYSKELQQLVISCI 314

Query: 579 SRDPDRRL 586
             +P+ +L
Sbjct: 315 --NPNEKL 320

>ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH]
           (146098..147402) [1305 bp, 434 aa]
          Length = 434

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 130/281 (46%), Gaps = 33/281 (11%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVL------A 398
           +++L+++GKGS+G V+              AI+K   + + EV    A R +        
Sbjct: 73  YEVLQMLGKGSYGTVVSAIDNLNANYPIRIAIKKITNIFQREVLLKRAIRELKFMHYFKG 132

Query: 399 RVNCPFIVPLKFSFQSP-EKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALE 457
             N   ++ L+   + P + LY     I+  +L   +    +F     + +T ++LC ++
Sbjct: 133 HKNIVSLINLEIVNEKPYDGLYCYQELIDY-DLARVIHSNVQFSEFHIKHFTYQILCGVK 191

Query: 458 TLHNLDVIYRDLKPENILLDYQGHIALCDFGLCK------LNMKDQDKTDTFCGTPEYLA 511
            +H+ DVI+RDLKP NIL    G + +CDFGL +       N K  +    +  T  Y A
Sbjct: 192 YIHSADVIHRDLKPGNILCSISGQLKICDFGLARGISPLFTNTKTSNHITNYVATRWYRA 251

Query: 512 PELLL-NQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDA 570
           PEL+L ++ Y+K +D W +G +L E     P +  +D      +I++             
Sbjct: 252 PELILSHKRYNKSIDMWAIGCILAEFYGRKPIFMGQDSMHQISEIVK------------- 298

Query: 571 KDLLIGLLSRDPDRRLGCNGAHEI--KNHPFFSQLSWKRLW 609
              ++G  SRD   + G + A++I     P ++++ W  ++
Sbjct: 299 ---VLGTPSRDTIIKYGSSRAYDIFCPPKPQYAKIPWAEIY 336

>Kwal_55.22001
          Length = 363

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 92/322 (28%), Positives = 144/322 (44%), Gaps = 55/322 (17%)

Query: 349 KVIGKGSFGKVMQV-RKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVP 407
           K IG G+FG V+Q     D  K Y   AI+K      ++  +   E  +L   + P +V 
Sbjct: 30  KKIGHGAFGTVVQAFLTPDNNKWYGPFAIKKV----PAQTEYKSRELEILRIADHPNVVK 85

Query: 408 LKFSFQ--SPE--KLY--LVLACI-NGGELFYHLQKEGRFEL--SRARFYTAELLCALET 458
           L++ F   SP+  KLY  L + C+    +L  H     + EL     + YT ++   +  
Sbjct: 86  LEYFFTHTSPQDNKLYQHLAMECLPETLQLEIHRYASNKLELPLKHTKLYTYQIARGMLY 145

Query: 459 LHNLDVIYRDLKPENILLDYQ-GHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLN 517
           LH L + +RD+KP N+L+D   G + +CDFG  K   ++Q      C    Y APEL++ 
Sbjct: 146 LHALGICHRDIKPSNVLVDPNTGVLKICDFGSAKKLEQNQPSISYICSR-FYRAPELIVG 204

Query: 518 -QGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKI--------------------- 555
              Y+  +D W LG ++ EML G   +  ++     R+I                     
Sbjct: 205 CTQYTTQIDIWGLGCVMGEMLIGKAVFQGQEPLLQLREISKLLGPPDKKFLFFSNPSYDG 264

Query: 556 --LQDPL-------RFPEGFDR---DAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQL 603
                PL       RF + F +   +  DLL+ +L+ +P+RRL       I  HPFF  L
Sbjct: 265 PLFSKPLFTGSVQERFEKHFGQAGPEGIDLLMKILTYEPERRL---SPRRILAHPFFEDL 321

Query: 604 SWKR-LWNKGYI-PPYKPPVSD 623
             +R  + +G+  P Y P + D
Sbjct: 322 KKERYFFPRGHTQPKYLPELFD 343

>AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -
           SH] (1066272..1067981) [1710 bp, 569 aa]
          Length = 569

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 83/310 (26%), Positives = 142/310 (45%), Gaps = 66/310 (21%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVT-HTLAERTVLAR---- 399
           F L+K IG G++G V   R  ++ +   +   + + + SK+ +   +L E  +L      
Sbjct: 23  FQLIKEIGYGAYGIVCSARFMESVEDTTVAIKKVTNVFSKALLCKRSLRELKLLRHFRGH 82

Query: 400 --VNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQ--------KEGRFELSRARF-- 447
             + C + + +         + L     NG +L+  L         K G+  L+ A +  
Sbjct: 83  KNITCLYDMDI---------VLLPDGSFNGLDLYEELMEWDMHQIIKSGQ-PLTDAHYQS 132

Query: 448 YTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTF---- 503
           +  ++LC L+ +H+ DV++RDLKP N+L++    + +CDFGL +   ++  + D F    
Sbjct: 133 FVYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPIENDQFLTEY 192

Query: 504 CGTPEYLAPELLLN-QGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRF 562
             T  Y APE++L+ QGY++ +D W+ G +L E+L G P +  +D      +ILQ     
Sbjct: 193 VATRWYRAPEIMLSYQGYTRAIDVWSCGCVLAELLGGRPIFKGKDYVDQLNRILQVLGTP 252

Query: 563 PEG------------------------FDR-------DAKDLLIGLLSRDPDRRLGCNGA 591
           PE                         F+R       DA DLL  +L+ DP  R+  + A
Sbjct: 253 PEETLKRIGSKNVQDYIHQLGYIPKVPFERLYPNANPDAADLLERMLALDPKTRITVDEA 312

Query: 592 HEIKNHPFFS 601
            E   HP+ S
Sbjct: 313 LE---HPYLS 319

>Scas_602.11
          Length = 1186

 Score = 89.7 bits (221), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 92/395 (23%), Positives = 161/395 (40%), Gaps = 105/395 (26%)

Query: 306 AANIRLYNHHWVTLENTLGRIN--------ISVDYKPSKNKRLTIDDFDLLKVIGKGSFG 357
            A    +N+ + TL+  LGR +        IS+ Y P  +KR  ++ ++++K +G G  G
Sbjct: 126 TAPFNTFNNKFATLDEKLGRTSTKVKETNRISLTYDP-ISKRKVLNTYEIIKELGHGQHG 184

Query: 358 KVMQVRKRDTQKIYALKAIRK----------SYIVSKSEVTHTLA-ERTVLARVNCPFIV 406
           KV   +   T ++ A+K + +           +   K +    +  E  ++ +++   +V
Sbjct: 185 KVKLAKDLLTSQLVAIKIVDRHEKLRLTNFFKFNKRKQQNDDRIKREIAIMKKLHHKHVV 244

Query: 407 PLKFSFQ--SPEKLYLVLACINGGELFYH----LQKEGR----FELSRARFYTAELLCAL 456
            L          K+YLVL     GE+ +     L+ E +         AR     ++  L
Sbjct: 245 KLIEVLDDLKSRKIYLVLEYCAQGEIKWCPKDCLETEAKGPPLLSFQSAREIIRGVILGL 304

Query: 457 ETLHNLDVIYRDLKPENILLDYQGHIALCDFGLC-------------------------- 490
           E LH   +I+RD+KP N+L+D +G + + DFG+                           
Sbjct: 305 EYLHYQGIIHRDIKPANLLVDEEGTVKISDFGVSLASRSSGNSTANSSSVLGGTPRNLSR 364

Query: 491 -------KLNMKDQDKTDTF-----CGTPEYLAPELLLN-QGYSK--------------- 522
                    N  D +  D        GTP + APE+ L  + + K               
Sbjct: 365 SSTESMNTTNNNDDESIDEVELAKTAGTPAFFAPEICLGEEAFDKFSLRKNEMFKGSCIS 424

Query: 523 -VVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFP----------------EG 565
            ++D W LGI  Y +L G+ P+  +   +++ KI+ +PL FP                E 
Sbjct: 425 FMIDIWALGITFYCLLFGMLPFISDFELELFEKIVGEPLTFPSYEELQANRVSNVCSIEE 484

Query: 566 FDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFF 600
           ++  AK++L  LL ++P +R       E+K HPF 
Sbjct: 485 YEA-AKNVLQRLLEKNPSKRCSI---LELKYHPFI 515

>Scas_688.14
          Length = 479

 Score = 87.8 bits (216), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 82/319 (25%), Positives = 147/319 (46%), Gaps = 67/319 (21%)

Query: 337 NKRLTIDD-FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVT-HTLAER 394
           N+  T+D  F L+K IG G++G V   R  +  +   +   + + + SKS +   +L E 
Sbjct: 14  NQDFTVDKRFQLIKEIGHGAYGIVCSARFAEAVEDTTVAIKKVTNVFSKSLLCKRSLREL 73

Query: 395 TVL------ARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRA--- 445
            +L        + C + + + F    P+  +      NG  L+  L +    ++ ++   
Sbjct: 74  KLLRHFRGHKNITCLYDMDIVFY---PDGTF------NGLYLYEELMECDMHQIIKSSQP 124

Query: 446 ------RFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDK 499
                 + +  ++LC L+ +H+ DV++RDLKP N+L++    + +CDFGL +   ++  +
Sbjct: 125 LTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVE 184

Query: 500 TDTF----CGTPEYLAPELLLN-QGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRK 554
            + F      T  Y APE++L+ QGY+K +D W+ G +L E L G P +  +D      +
Sbjct: 185 NNQFLTEYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGKPIFKGKDYVDQLTR 244

Query: 555 ILQ-------DPLR-------------------------FPEGFDRDAKDLLIGLLSRDP 582
           ILQ       + LR                         +P+  +  A DLL  +L+ DP
Sbjct: 245 ILQVLGTPPDETLRRIGSKNVQDYIHQLGYIPKVPFVNLYPDA-NPQALDLLEKMLAFDP 303

Query: 583 DRRLGCNGAHEIKNHPFFS 601
            +R+  + A E   HP+ S
Sbjct: 304 QKRITTDEALE---HPYLS 319

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 89.4 bits (220), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 80/263 (30%), Positives = 116/263 (44%), Gaps = 32/263 (12%)

Query: 351  IGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAER-TVLARVNCPFIVPLK 409
            IG G+FG+V      +  +I A+K I+     +  ++   + E  TVL  +N P IV   
Sbjct: 1040 IGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLNHPNIVQYY 1099

Query: 410  FSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRA-RFYTAELLCALETLHNLDVIYRD 468
                  +K+ + +    GG L   L   GR E     + YT ELL  L  LH   V++RD
Sbjct: 1100 GVEVHRDKVNIFMEYCEGGSL-ASLLDHGRIEDEMVTQVYTFELLEGLAYLHQSGVVHRD 1158

Query: 469  LKPENILLDYQGHIALCDFGLCKLNMKDQDKT----------------DTFCGTPEYLAP 512
            +KPENILLD+ G I   DFG  +  +  + +T                +   GTP Y+AP
Sbjct: 1159 IKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYMAP 1218

Query: 513  ELLLN---QGYSKVVDWWTLGILLYEMLTGLPPY--YDEDVPKMYRKILQDPLRFPEGFD 567
            E +     +G     D W LG ++ EM TG  P+   D +   MY        R P+  +
Sbjct: 1219 ETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNLDNEWAIMYHVAAG---RIPQLPN 1275

Query: 568  RD-----AKDLLIGLLSRDPDRR 585
            RD      +  L   L +DP  R
Sbjct: 1276 RDEMTAAGRAFLERCLVQDPTMR 1298

>Scas_683.6
          Length = 377

 Score = 86.7 bits (213), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 86/307 (28%), Positives = 138/307 (44%), Gaps = 56/307 (18%)

Query: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSE-VTHTLAERTVLARVN-- 401
           + L+ +IG+G++G V     + +    A+K I+     SK+  VT TL E  +L   N  
Sbjct: 13  YQLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQP---FSKAMFVTRTLREIKLLTYFNNH 69

Query: 402 ---CPFIVPLK-FSFQSPEKLYLV--LACINGGELFYHLQKEGRFELSRARFYTAELLCA 455
                 +  +K  S    + +YLV  L   +   +  +            +++T ++L A
Sbjct: 70  ENIISILDKIKPISMDKFQAVYLVQELMETDLQRVISNNNTNKSLTDDHIQYFTYQILRA 129

Query: 456 LETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCG-------TPE 508
           L+++H+  VI+RDLKP N+LL+    + +CDFGL +      D   T  G       T  
Sbjct: 130 LKSIHSAKVIHRDLKPSNLLLNSNCDLKICDFGLSRCLTSSNDSKKTLVGFMTEYVATRW 189

Query: 509 YLAPELLLN-QGYSKVVDWWTLGILLYEMLTGLP--PYYD-----------------EDV 548
           Y APE++L  Q Y+  +D W++G +L EM+TG P  P  D                 ED 
Sbjct: 190 YRAPEIMLTFQEYTTAMDIWSVGCILAEMVTGRPLFPGRDYHHQLWLILEVLGTPSLEDF 249

Query: 549 PKMYRK-----ILQDPLRFPEGFD---------RDAKDLLIGLLSRDPDRRLGCNGAHEI 594
            ++  K     I   PL+ P  +D          D  DLL  +L  +P++R+    A E 
Sbjct: 250 EQIKSKRAREYIANLPLKPPMAWDIVLSNTNLNPDLIDLLTKMLMFNPNKRI---SAAEA 306

Query: 595 KNHPFFS 601
             HP+ S
Sbjct: 307 LQHPYLS 313

>Kwal_26.8703
          Length = 444

 Score = 87.4 bits (215), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 101/205 (49%), Gaps = 9/205 (4%)

Query: 350 VIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVPL- 408
           V+G+G+ G V + + +    ++ALK I  +    +++    L E       +  +IV   
Sbjct: 162 VLGEGAGGSVTKCKLKGGSMVFALKTITTANSDPETQ-KQVLRELQFNRSCSSEYIVRYY 220

Query: 409 -KFSFQSPEKLYLVLACINGGEL---FYHL-QKEGRFELSRARFYTAELLCALETLHNLD 463
             F+ +S   +Y+ +  + G  L   + HL ++ GR            +L  L  L    
Sbjct: 221 GMFAEESTSSIYIAMEYMGGKSLDAIYKHLLERGGRIGEKVLGKIAESVLKGLSYLQERK 280

Query: 464 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKV 523
           +I+RD+KP+NILL+  G + LCDFG+  + +       TF GT  Y+APE +  Q YS  
Sbjct: 281 IIHRDIKPQNILLNEAGQVKLCDFGVSGVAVNSL--ATTFTGTSFYMAPERIQGQPYSVT 338

Query: 524 VDWWTLGILLYEMLTGLPPYYDEDV 548
            D W+LG+ L E+  G  P+  +++
Sbjct: 339 SDVWSLGLTLLEVAQGQFPFGSDNM 363

>KLLA0D09328g complement(788565..791705) some similarities with
           sp|P38990 Saccharomyces cerevisiae YER129w PAK1 DNA
           polymerase alpha suppressing protein kinase,
           hypothetical start
          Length = 1046

 Score = 88.6 bits (218), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 82/335 (24%), Positives = 146/335 (43%), Gaps = 69/335 (20%)

Query: 328 ISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKS-------- 379
           +S++Y P  +KR  ++ +++++ +G G  GKV   R   T+++ A+K + +         
Sbjct: 99  VSLEYDPI-SKRKVLNTYEIIEELGHGQHGKVKLARDLVTKQLVAIKIVNRHKKRTFNDK 157

Query: 380 ----YIVSKSEVTHTLAERTVLARVNC--PFIVPL--KFSFQSPEKLYLVLACINGGELF 431
               +   +S +     +R +     C    +V L          K+YLVL   + GE+ 
Sbjct: 158 FSNRFKTPQSGIEDEKIKREIAIMKKCHHEHVVKLIEVLDDAKSRKIYLVLEYCSKGEIK 217

Query: 432 YH----LQKEGR----FELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIA 483
           +     ++ + R        R R     +L  LE LH   +I+RD+KP N+LL   G + 
Sbjct: 218 WCPGDVIETKARGPPLLSFQRTREIFRGVLLGLEYLHFQGIIHRDIKPANLLLSEDGIVK 277

Query: 484 LCDFGLCKLNMKDQDKTDTF--------CGTPEYLAPELLLNQGYSK------------- 522
           + DFG+  L       TD+          GTP + APE+ L +   K             
Sbjct: 278 ISDFGVS-LAFSSDSSTDSLNELELAKTAGTPAFFAPEICLVEDTIKKFDLDPNSKEPII 336

Query: 523 --VVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDR------------ 568
               D W +GI L+ +L G+ P+  +   +++ KI+ +PL F E + +            
Sbjct: 337 SFPTDIWAMGITLHCLLFGMLPFISDYELELFDKIVNEPLVF-EPYQKIEQCQVSQVECK 395

Query: 569 ----DAKDLLIGLLSRDPDRRLGCNGAHEIKNHPF 599
               +A++LL  LL ++P +R+    A   K HP+
Sbjct: 396 EEYEEAQNLLNKLLEKNPKKRMAIQDA---KKHPW 427

>Scas_720.94
          Length = 1683

 Score = 88.6 bits (218), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 80/271 (29%), Positives = 115/271 (42%), Gaps = 39/271 (14%)

Query: 351  IGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAER-TVLARVNCPFIVPLK 409
            IG G+FG V      D  +I A+K I+     +  ++   + E  TVL  +N P IV   
Sbjct: 1367 IGGGTFGTVYSAVNLDNGEILAVKEIKIQDSKTMKKIFPLVKEEMTVLEMLNHPNIVQYY 1426

Query: 410  FSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRA-RFYTAELLCALETLHNLDVIYRD 468
                  +K+ + +    GG +   L + GR E     + YT ELL  L  LH   V++RD
Sbjct: 1427 GVEVHRDKVNIFMEYCEGGSM-ASLLEHGRIEDEMVTQVYTLELLEGLAYLHQAGVVHRD 1485

Query: 469  LKPENILLDYQGHIALCDFGLCKLNMKDQDKTDT-------------------------F 503
            +KPENILLD+ G I   DFG  +   K+  K                             
Sbjct: 1486 IKPENILLDFNGIIKYVDFGAARKIAKNGTKVTNINSKSKDDDEPDEKDTEGGANSVHDM 1545

Query: 504  CGTPEYLAPELLLNQGYSKVV-----DWWTLGILLYEMLTGLPPY--YDEDVPKMYRKIL 556
             GTP Y+APE +   GY         D W+ G ++ EM+TG  P+   D +   +Y    
Sbjct: 1546 LGTPMYMAPESI--TGYKNKTKFGSDDIWSFGCVVLEMITGRRPWANLDNEWAIIYHVAA 1603

Query: 557  -QDP-LRFPEGFDRDAKDLLIGLLSRDPDRR 585
             Q P L +P       +  L   L +DP +R
Sbjct: 1604 GQTPQLPYPNEVSPAGRRFLQRCLVQDPIKR 1634

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 96/201 (47%), Gaps = 11/201 (5%)

Query: 350 VIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLAR-VNCPFIVPL 408
           V+G+G+ G V + + R  +K++ALK I  + +    E    L       +     +IV  
Sbjct: 185 VLGEGAGGSVAKCKLRTGKKVFALKTI--NILNGDPEFQKQLLRELQFNKSFKSEYIVRY 242

Query: 409 --KFSFQSPEKLYLVLACINGG--ELFYH--LQKEGRFELSRARFYTAELLCALETLHNL 462
              F+ +    +Y+ +  + G   E  Y   L + GR         +  +L  L  LH  
Sbjct: 243 FGMFTDEQNSSIYIAMEYMGGKSLEAIYKELLSRGGRISEKVLGKISEAVLRGLSYLHEK 302

Query: 463 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSK 522
            VI+RD+KP+NILL+  G + LCDFG+    +       TF GT  Y+APE +  Q YS 
Sbjct: 303 KVIHRDIKPQNILLNEDGQVKLCDFGVSGEAVNSL--ATTFTGTSYYMAPERIQGQPYSV 360

Query: 523 VVDWWTLGILLYEMLTGLPPY 543
             D W+LG+ + E+  G  P+
Sbjct: 361 TCDVWSLGLTILEVAQGHFPF 381

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 102/224 (45%), Gaps = 29/224 (12%)

Query: 351 IGKGSFGKVMQVRKRDTQKIYALKAIR-KSYIVSKSE--VTHTLAERTV----------- 396
           IG GSFG V       T ++ A+K +  K  I + ++  V    AE+ V           
Sbjct: 395 IGSGSFGTVYLGMNAQTGELMAVKQVEIKPAIAATADANVEDKNAEKNVAKAPSTNLHRK 454

Query: 397 -----------LARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRA 445
                      L  +    IV    S Q    L + L  + GG +   L   G FE    
Sbjct: 455 MIDALQHEMSLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLSNYGPFEEPLI 514

Query: 446 RFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCK----LNMKDQDKTD 501
             +T ++L  +  LH  ++I+RD+K  NIL+D +G + + DFG+ K    LN ++QDK  
Sbjct: 515 VNFTRQILIGVAYLHRKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNQENQDKRT 574

Query: 502 TFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYD 545
           +  G+  +++PE++     +   D W+ G ++ EM TG  PY D
Sbjct: 575 SLQGSVYWMSPEVVKQTATTSKADIWSTGCVVIEMFTGKHPYPD 618

>KLLA0E11979g complement(1060048..1061892) some similarities with
           sp|P25333 Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, hypothetical
           start
          Length = 614

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 101/203 (49%), Gaps = 12/203 (5%)

Query: 349 KVIGKGSFGKVMQVRKRDTQKI-----YALKAIRKSYIVSKSEVTHTL-AERTVLARVNC 402
           +VIGKGSFG V    K++ + +     YA+K  R+    +  + +  L +E  + + +  
Sbjct: 334 EVIGKGSFGVVRICHKKNLKSVSGEILYAVKEFRRRPTENPVKYSKRLTSEFCISSSLKH 393

Query: 403 PFIVPLKFSFQSPEKLYL-VLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHN 461
             I+     FQ  +  Y  V+   +GG+LF  +   G+ E   A  +  +L+  +  +HN
Sbjct: 394 TNIIETLDLFQDAKGDYCEVMEYCSGGDLFTLIIAAGKLEYQEADCFLKQLITGVVYMHN 453

Query: 462 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDK----TDTFCGTPEYLAPELLLN 517
           + V +RDLKPEN+LL + G + + DFG  +      +K    +   CG+  Y+APE    
Sbjct: 454 MGVCHRDLKPENLLLTHDGTLKITDFGNSECFRMAWEKEIHLSGGVCGSGPYIAPEEYTQ 513

Query: 518 QGYS-KVVDWWTLGILLYEMLTG 539
           + +  + VD W  G++   M TG
Sbjct: 514 EEFDPRAVDIWACGVIYMAMRTG 536

>Kwal_27.11803
          Length = 246

 Score = 82.8 bits (203), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 96/200 (48%), Gaps = 42/200 (21%)

Query: 440 FELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDK 499
           FE+S  +++  +LL  +   H   +++RDLKP+N+L++ +G + L DFGL +      + 
Sbjct: 49  FEMSLVKYFEWQLLQGVAFCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNT 108

Query: 500 TDTFCGTPEYLAPELLL-NQGYSKVVDWWTLGILLYEMLTGLP----------------- 541
             +   T  Y AP++L+ ++ YS  +D W+ G +L EM+TG P                 
Sbjct: 109 FSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGRPLFPGTNDEEQLKLIFET 168

Query: 542 ---------------PYYDEDVPKMYRK----ILQDPLRFPEGFDRDAKDLLIGLLSRDP 582
                          P Y+  +P+   K    +LQ   R  E  D    DLL GLL  +P
Sbjct: 169 MGTPTERTWPGVSTLPKYNPQLPQHLPKDLGALLQSQTR--EKMDLTLIDLLYGLLQPNP 226

Query: 583 DRRLGCNGAHEIKNHPFFSQ 602
           DRRL    A +  NHP+F++
Sbjct: 227 DRRL---SAKQALNHPWFAE 243

>Kwal_33.13222
          Length = 148

 Score = 80.1 bits (196), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/112 (34%), Positives = 67/112 (59%), Gaps = 1/112 (0%)

Query: 412 FQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKP 471
           +++   LY+VL  +  GELF  L + G    + A  +  +++  +   H L +++RDLKP
Sbjct: 16  WETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKP 75

Query: 472 ENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKV 523
           EN+LLD++ +I + DFG+  L  KD+   +T CG+P Y APE++     S++
Sbjct: 76  ENLLLDHKFNIKIADFGMAALESKDK-LLETSCGSPHYAAPEIVSGTALSRL 126

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,788,709
Number of extensions: 1038015
Number of successful extensions: 4570
Number of sequences better than 10.0: 670
Number of HSP's gapped: 3673
Number of HSP's successfully gapped: 755
Length of query: 674
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 566
Effective length of database: 12,857,365
Effective search space: 7277268590
Effective search space used: 7277268590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)