Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_717.6890890840000.0
YMR102C83488716690.0
CAGL0K03377g97898115060.0
Scas_721.12885162011451e-143
YKL121W8525199741e-118
Kwal_26.76557434919281e-112
ABL024W7345988392e-99
Sklu_2430.99662618102e-93
KLLA0B12804g8526697332e-83
CAGL0K11638g5922584213e-43
CAGL0H08932g902601671e-11
YCR084C (TUP1)713981616e-11
AGL234W6291001562e-10
Kwal_23.6429750981491e-09
YGL137W (SEC27)889601464e-09
CAGL0E00561g8361121447e-09
KLLA0F10263g682981438e-09
KLLA0B01958g890601421e-08
KLLA0D02530g7071291392e-08
Sklu_2160.3760511393e-08
AFL118W832601383e-08
ADL082C5691111374e-08
Scas_704.40608821374e-08
CAGL0L00781g6731131365e-08
AER114W6331271341e-07
Scas_629.126711141331e-07
YIL046W (MET30)640821293e-07
CAGL0J04818g6541201293e-07
Scas_571.46012081294e-07
Scas_719.526281231294e-07
KLLA0F27511g623831275e-07
Kwal_23.57696272101275e-07
Scas_630.6621981251e-06
YDL145C (COP1)1201591251e-06
Sklu_2442.23032411212e-06
Scas_624.111205591242e-06
Kwal_0.2123031231202e-06
YLR429W (CRN1)651671213e-06
CAGL0C03608g643981213e-06
ADR077C1204591214e-06
KLLA0D04840g3032411184e-06
AAL009C3032411175e-06
KLLA0F04884g1212591197e-06
YNL006W (LST8)3032411167e-06
Scas_695.153271241167e-06
Kwal_56.245261210591188e-06
CAGL0H03729g3031161141e-05
CAGL0I03718g1201591152e-05
Scas_720.83d9152081143e-05
Kwal_27.120537551171133e-05
AEL246C815731133e-05
KLLA0E12287g3261271103e-05
Sklu_2382.21261911134e-05
KLLA0D07546g6471591124e-05
Scas_721.328221161124e-05
YMR116C (ASC1)3191101095e-05
CAGL0M05335g8061071116e-05
Sklu_2318.1711981106e-05
AAR057W922881107e-05
Scas_592.4*318931071e-04
Scas_721.115*318931071e-04
KLLA0E23529g826731072e-04
CAGL0B01529g3692021052e-04
YBR198C (TAF5)798831062e-04
AFR199C334801042e-04
Sklu_2406.114261421043e-04
CAGL0M02277g4271141034e-04
Scas_721.73251301024e-04
CAGL0G04345g711971034e-04
KLLA0E24508g327721015e-04
Scas_658.14421641025e-04
AAL157C4791051026e-04
YCR072C515561018e-04
KLLA0E04741g4591011008e-04
Kwal_33.15136473801009e-04
KLLA0F11231g43474990.001
CAGL0M08646g337104980.001
Sklu_2173.251556990.001
Kwal_56.2447812961781000.001
Scas_700.27*433158980.001
KLLA0E11297g512111980.002
KLLA0D16390g936113990.002
CAGL0M06193g316121970.002
Scas_711.1169570980.002
Sklu_1963.231471970.002
Sklu_2431.1274973980.002
YKR036C (CAF4)659141970.002
Kwal_23.632451482970.002
KLLA0F15598g47879960.002
Scas_707.22730126960.003
Scas_659.947583950.003
Kwal_27.12239316121940.003
Kwal_26.8628422151940.004
KLLA0C08547g51556950.004
YCR057C (PWP2)923174940.005
YDR364C (CDC40)455164930.006
YLL011W (SOF1)48980930.007
Kwal_23.624091393930.007
AGL196C93572930.008
AGL024W756108930.008
Kwal_26.773650779920.008
Kwal_56.2416372958920.009
KLLA0E21263g42983910.009
YBR175W (SWD3)31574900.010
Kwal_27.12586509113910.010
Kwal_26.877643362910.011
AER263C51356910.011
KLLA0F05159g123170920.011
CAGL0D05588g477105910.011
Scas_692.2548864910.012
CAGL0A02772g441164900.012
YLR129W (DIP2)94372910.012
ADL322C501115900.012
CAGL0J08998g1281241910.013
CAGL0C02937g46788900.014
YDL195W (SEC31)1273241910.014
Kwal_27.1266772193900.014
Scas_603.558972900.014
AEL314W71597900.015
CAGL0E02805g84097890.019
Scas_713.5098372890.019
CAGL0K09284g91182890.020
CAGL0G03399g36975880.020
ABL044C51871880.022
Scas_581.362659890.022
CAGL0D02090g277107860.025
Kwal_47.1746580072880.025
Scas_720.4575526880.027
Kwal_23.503574474870.034
ACR137W42563860.036
CAGL0K12188g53538870.037
KLLA0E03982g37249860.040
Kwal_23.5351474148860.044
Kwal_27.1038553673860.044
KLLA0F22000g793113860.045
Scas_720.9551556860.047
YDR142C (PEX7)37560850.048
Scas_718.6*54699860.049
AEL269C455177850.049
KLLA0F21406g70576850.064
Kwal_26.895345890840.065
Sklu_2317.336845840.068
Scas_442.2*795189840.078
ADL218C40359830.079
Scas_397.241067830.088
YBL008W (HIR1)840201840.091
YFL009W (CDC4)77974830.092
Kwal_56.23920937150830.10
CAGL0L02629g79574830.11
Kwal_26.757021862800.11
Sklu_2420.2441158820.12
YNL035C38959820.12
AGR168W825116830.12
Scas_605.18424123820.12
Scas_685.1138468820.12
YKL021C (MAK11)46865820.13
Kwal_27.1155040752810.13
Sklu_2416.545993820.13
YPL151C (PRP46)45162810.14
Sklu_1880.347189810.16
Scas_660.851060810.17
CAGL0J06512g54572810.17
AGR207C32074800.18
KLLA0E18139g326132800.19
ACR097W46779800.20
Sklu_2384.332879790.21
Kwal_33.1559171465800.21
AGR180W806103800.21
Scas_699.5494103790.27
KLLA0F13772g52062790.31
KLLA0C08976g91147790.32
KLLA0B02827g94272790.33
Kwal_56.2389536761780.34
YKL213C (DOA1)71577780.36
CAGL0J03476g517213780.36
Kwal_55.21450503164780.37
CAGL0G01628g37636780.38
YJL112W (MDV1)714170780.42
Sklu_1926.550977780.42
Scas_719.3094075780.43
YGR200C (ELP2)78865780.44
KLLA0B14410g70688780.45
KLLA0E07073g45291770.53
Kwal_33.1547578373770.54
Scas_601.238936760.57
YOR269W (PAC1)49473760.62
YOR212W (STE4)42343760.64
Scas_693.3637546760.66
Scas_595.3*555102760.66
Sklu_1659.2613114760.67
CAGL0K00275g71565760.77
Sklu_2379.7379127750.77
CAGL0K00957g79348750.82
AER255C46751750.87
AAR078W56274750.88
KLLA0D00814g40862750.89
Scas_465.4100278750.90
YBR103W (SIF2)535109750.95
Sklu_675.1308130740.99
AER035W1006124751.0
CAGL0C00737g81659751.0
CAGL0K11836g52244741.1
Kwal_14.1597380195741.1
Scas_715.22607179741.1
AER448W714179741.1
Kwal_34.1581834968731.2
ADR090W123366741.2
CAGL0M04279g940150741.2
KLLA0A08866g42387741.2
Scas_544.452492741.3
Kwal_14.88439560731.3
Scas_701.45127675741.3
Kwal_47.19083324137731.3
YPL247C52383731.4
Sklu_1985.356895721.9
KLLA0C16533g51291721.9
KLLA0E07942g39062712.0
ACR194C513101722.0
Kwal_56.24661561102722.1
Kwal_26.897544590712.2
CAGL0H00781g51386722.2
YDL156W52293712.3
ADL184W44992712.7
KLLA0D17116g44386712.8
CAGL0C01441g100580712.8
YNL317W (PFS2)46592702.9
Scas_512.353446712.9
CAGL0M09845g93672712.9
Scas_684.751185703.0
Scas_692.2945671703.2
Scas_670.2243757703.5
YMR093W (UTP15)51372703.5
Kwal_56.2303542446703.5
CAGL0F01793g36424693.9
Kwal_47.1757243431693.9
KLLA0C14190g59590703.9
Sklu_2435.1357574694.2
Scas_631.1747437694.5
Kwal_56.23685110277695.0
KLLA0D06787g436136685.0
KLLA0E08415g42236685.7
ACR166W38862685.8
CAGL0E00979g42181676.4
Kwal_27.1158582397686.9
YPL183C101376687.1
Scas_652.1634526677.4
Kwal_56.2433241886677.5
KLLA0E21879g333123668.3
YPR178W (PRP4)46530678.5
KLLA0F06754g344112668.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_717.68
         (908 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_717.68                                                          1545   0.0  
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...   647   0.0  
CAGL0K03377g complement(306529..309465) similar to sp|Q03177 Sac...   584   0.0  
Scas_721.128                                                          445   e-143
YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containi...   379   e-118
Kwal_26.7655                                                          362   e-112
ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH] com...   327   2e-99
Sklu_2430.9 YMR102C, Contig c2430 15497-18397                         316   2e-93
KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177 Saccha...   286   2e-83
CAGL0K11638g complement(1123343..1125121) weakly similar to sp|Q...   166   3e-43
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    69   1e-11
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    67   6e-11
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    65   2e-10
Kwal_23.6429                                                           62   1e-09
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    61   4e-09
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    60   7e-09
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    60   8e-09
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    59   1e-08
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    58   2e-08
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         58   3e-08
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    58   3e-08
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    57   4e-08
Scas_704.40                                                            57   4e-08
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    57   5e-08
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    56   1e-07
Scas_629.12                                                            56   1e-07
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    54   3e-07
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    54   3e-07
Scas_571.4                                                             54   4e-07
Scas_719.52                                                            54   4e-07
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    54   5e-07
Kwal_23.5769                                                           54   5e-07
Scas_630.6                                                             53   1e-06
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    53   1e-06
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            51   2e-06
Scas_624.11                                                            52   2e-06
Kwal_0.212                                                             51   2e-06
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    51   3e-06
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    51   3e-06
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    51   4e-06
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    50   4e-06
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    50   5e-06
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    50   7e-06
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    49   7e-06
Scas_695.15                                                            49   7e-06
Kwal_56.24526                                                          50   8e-06
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    49   1e-05
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    49   2e-05
Scas_720.83d                                                           49   3e-05
Kwal_27.12053                                                          48   3e-05
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    48   3e-05
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    47   3e-05
Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement         48   4e-05
KLLA0D07546g complement(647984..649927) some similarities with s...    48   4e-05
Scas_721.32                                                            48   4e-05
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    47   5e-05
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    47   6e-05
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          47   6e-05
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    47   7e-05
Scas_592.4*                                                            46   1e-04
Scas_721.115*                                                          46   1e-04
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    46   2e-04
CAGL0B01529g 137174..138283 highly similar to sp|P39108 Saccharo...    45   2e-04
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    45   2e-04
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    45   2e-04
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      45   3e-04
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    44   4e-04
Scas_721.7                                                             44   4e-04
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    44   4e-04
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    44   5e-04
Scas_658.1                                                             44   5e-04
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    44   6e-04
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    44   8e-04
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    43   8e-04
Kwal_33.15136                                                          43   9e-04
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    43   0.001
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...    42   0.001
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            43   0.001
Kwal_56.24478                                                          43   0.001
Scas_700.27*                                                           42   0.001
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    42   0.002
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    43   0.002
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    42   0.002
Scas_711.11                                                            42   0.002
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         42   0.002
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      42   0.002
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    42   0.002
Kwal_23.6324                                                           42   0.002
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    42   0.002
Scas_707.22                                                            42   0.003
Scas_659.9                                                             41   0.003
Kwal_27.12239                                                          41   0.003
Kwal_26.8628                                                           41   0.004
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    41   0.004
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    41   0.005
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    40   0.006
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    40   0.007
Kwal_23.6240                                                           40   0.007
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    40   0.008
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...    40   0.008
Kwal_26.7736                                                           40   0.008
Kwal_56.24163                                                          40   0.009
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    40   0.009
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    39   0.010
Kwal_27.12586                                                          40   0.010
Kwal_26.8776                                                           40   0.011
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    40   0.011
KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces c...    40   0.011
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    40   0.011
Scas_692.25                                                            40   0.012
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    39   0.012
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    40   0.012
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    39   0.012
CAGL0J08998g 882655..886500 highly similar to sp|P38968 Saccharo...    40   0.013
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    39   0.014
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    40   0.014
Kwal_27.12667                                                          39   0.014
Scas_603.5                                                             39   0.014
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    39   0.015
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    39   0.019
Scas_713.50                                                            39   0.019
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    39   0.020
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    39   0.020
ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1...    39   0.022
Scas_581.3                                                             39   0.022
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    38   0.025
Kwal_47.17465                                                          39   0.025
Scas_720.45                                                            39   0.027
Kwal_23.5035                                                           38   0.034
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    38   0.036
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    38   0.037
KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces c...    38   0.040
Kwal_23.5351                                                           38   0.044
Kwal_27.10385                                                          38   0.044
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    38   0.045
Scas_720.95                                                            38   0.047
YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal...    37   0.048
Scas_718.6*                                                            38   0.049
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    37   0.049
KLLA0F21406g complement(1996260..1998377) similar to sp|P47025 S...    37   0.064
Kwal_26.8953                                                           37   0.065
Sklu_2317.3 YDR142C, Contig c2317 5804-6910                            37   0.068
Scas_442.2*                                                            37   0.078
ADL218C [1523] [Homologous to ScYNL035C - SH] (319676..320887) [...    37   0.079
Scas_397.2                                                             37   0.088
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    37   0.091
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...    37   0.092
Kwal_56.23920                                                          37   0.10 
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...    37   0.11 
Kwal_26.7570                                                           35   0.11 
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            36   0.12 
YNL035C (YNL035C) [4552] chr14 complement(568520..569689) Protei...    36   0.12 
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    37   0.12 
Scas_605.18                                                            36   0.12 
Scas_685.11                                                            36   0.12 
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...    36   0.13 
Kwal_27.11550                                                          36   0.13 
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           36   0.13 
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    36   0.14 
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            36   0.16 
Scas_660.8                                                             36   0.17 
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    36   0.17 
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    35   0.18 
KLLA0E18139g 1608371..1609351 highly similar to sp|P36104 Saccha...    35   0.19 
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    35   0.20 
Sklu_2384.3 YKL018W, Contig c2384 6547-7533                            35   0.21 
Kwal_33.15591                                                          35   0.21 
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    35   0.21 
Scas_699.5                                                             35   0.27 
KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305 Saccha...    35   0.31 
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    35   0.32 
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    35   0.33 
Kwal_56.23895                                                          35   0.34 
YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein req...    35   0.36 
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    35   0.36 
Kwal_55.21450                                                          35   0.37 
CAGL0G01628g complement(151262..152392) similar to sp|P53962 Sac...    35   0.38 
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    35   0.42 
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         35   0.42 
Scas_719.30                                                            35   0.43 
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    35   0.44 
KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces...    35   0.45 
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    34   0.53 
Kwal_33.15475                                                          34   0.54 
Scas_601.2                                                             34   0.57 
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    34   0.62 
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    34   0.64 
Scas_693.36                                                            34   0.66 
Scas_595.3*                                                            34   0.66 
Sklu_1659.2 YMR092C, Contig c1659 410-2251                             34   0.67 
CAGL0K00275g complement(25300..27447) similar to sp|P36037 Sacch...    34   0.77 
Sklu_2379.7 YBR246W, Contig c2379 13796-14935 reverse complement       33   0.77 
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    33   0.82 
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    33   0.87 
AAR078W [264] [Homologous to ScYLR196W (PWP1) - SH] complement(4...    33   0.88 
KLLA0D00814g complement(76687..77913) similar to sp|P39984 Sacch...    33   0.89 
Scas_465.4                                                             33   0.90 
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    33   0.95 
Sklu_675.1 YMR146C, Contig c675 761-1687                               33   0.99 
AER035W [2540] [Homologous to ScYOL087C - SH] complement(699524....    33   1.0  
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    33   1.0  
CAGL0K11836g complement(1142213..1143781) similar to tr|Q12021 S...    33   1.1  
Kwal_14.1597                                                           33   1.1  
Scas_715.22                                                            33   1.1  
AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH] complement(...    33   1.1  
Kwal_34.15818                                                          33   1.2  
ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH] complement...    33   1.2  
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    33   1.2  
KLLA0A08866g 776960..778231 weakly similar to sp|P53196 Saccharo...    33   1.2  
Scas_544.4                                                             33   1.3  
Kwal_14.884                                                            33   1.3  
Scas_701.45                                                            33   1.3  
Kwal_47.19083                                                          33   1.3  
YPL247C (YPL247C) [5203] chr16 complement(82625..84196) Protein ...    33   1.4  
Sklu_1985.3 YLR196W, Contig c1985 4838-6544 reverse complement         32   1.9  
KLLA0C16533g complement(1448866..1450404) similar to sgd|S000231...    32   1.9  
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    32   2.0  
ACR194C [1241] [Homologous to ScYDL156W - SH] (690186..691727) [...    32   2.0  
Kwal_56.24661                                                          32   2.1  
Kwal_26.8975                                                           32   2.2  
CAGL0H00781g complement(77292..78833) similar to tr|Q12523 Sacch...    32   2.2  
YDL156W (YDL156W) [714] chr4 (174919..176487) Protein containing...    32   2.3  
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    32   2.7  
KLLA0D17116g 1451064..1452395 similar to sgd|S0002572 Saccharomy...    32   2.8  
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    32   2.8  
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    32   2.9  
Scas_512.3                                                             32   2.9  
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    32   2.9  
Scas_684.7                                                             32   3.0  
Scas_692.29                                                            32   3.2  
Scas_670.22                                                            32   3.5  
YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component ...    32   3.5  
Kwal_56.23035                                                          32   3.5  
CAGL0F01793g complement(177696..178790) highly similar to sp|P32...    31   3.9  
Kwal_47.17572                                                          31   3.9  
KLLA0C14190g complement(1227049..1228836) some similarities with...    32   3.9  
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         31   4.2  
Scas_631.17                                                            31   4.5  
Kwal_56.23685                                                          31   5.0  
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    31   5.0  
KLLA0E08415g 759718..760986 similar to sp|P53962 Saccharomyces c...    31   5.7  
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    31   5.8  
CAGL0E00979g complement(89546..90811) similar to tr|Q03774 Sacch...    30   6.4  
Kwal_27.11585                                                          31   6.9  
YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protei...    31   7.1  
Scas_652.16                                                            30   7.4  
Kwal_56.24332                                                          30   7.5  
KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...    30   8.3  
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    30   8.5  
KLLA0F06754g complement(650475..651509) similar to sp|P53011 Sac...    30   8.6  
KLLA0E19613g complement(1733708..1735426) similar to sp|P21304 S...    30   8.7  
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    30   9.0  
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    30   9.0  
Scas_675.18                                                            30   9.0  
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    30   9.3  
YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in com...    30   9.3  
YMR131C (RRB1) [4088] chr13 complement(533162..534697) Protein i...    30   9.4  
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    30   9.8  

>Scas_717.68
          Length = 908

 Score = 1545 bits (4000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 788/908 (86%), Positives = 788/908 (86%)

Query: 1   MSTSIADQKDISLEKKVSTDSTSSPSEGLSDLKPLSKETSLSSVDNSKYSADIKPLQFKM 60
           MSTSIADQKDISLEKKVSTDSTSSPSEGLSDLKPLSKETSLSSVDNSKYSADIKPLQFKM
Sbjct: 1   MSTSIADQKDISLEKKVSTDSTSSPSEGLSDLKPLSKETSLSSVDNSKYSADIKPLQFKM 60

Query: 61  NHVPGTRDRKHISYAAAAPSSSLRSNGSMKGQKYSYLFNSIDQDQFEKYLMEPTYIKILK 120
           NHVPGTRDRKHISYAAAAPSSSLRSNGSMKGQKYSYLFNSIDQDQFEKYLMEPTYIKILK
Sbjct: 61  NHVPGTRDRKHISYAAAAPSSSLRSNGSMKGQKYSYLFNSIDQDQFEKYLMEPTYIKILK 120

Query: 121 RRKNLKMFRRLFLAQELKAFDDENKINAFTNQINGLQXXXXXXXXXXXXXXXXXDRAIWI 180
           RRKNLKMFRRLFLAQELKAFDDENKINAFTNQINGLQ                 DRAIWI
Sbjct: 121 RRKNLKMFRRLFLAQELKAFDDENKINAFTNQINGLQSPPLTPTSSSSNLNALADRAIWI 180

Query: 181 TKFSLDGKFMASAGKSGIIRVWKVLNSPIERWELGSSVDSNNATLVKSKRLRXXXXXXXX 240
           TKFSLDGKFMASAGKSGIIRVWKVLNSPIERWELGSSVDSNNATLVKSKRLR        
Sbjct: 181 TKFSLDGKFMASAGKSGIIRVWKVLNSPIERWELGSSVDSNNATLVKSKRLRSQMFSSNP 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIHNTTSSSESTNFRRAQTLEKLD 300
                                                IHNTTSSSESTNFRRAQTLEKLD
Sbjct: 241 SSSMNTPSSSSHTVPTTHSNNTSIASSSSMNSNSKPSIHNTTSSSESTNFRRAQTLEKLD 300

Query: 301 QKISSTNELNLYAPVFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQT 360
           QKISSTNELNLYAPVFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQT
Sbjct: 301 QKISSTNELNLYAPVFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQT 360

Query: 361 SLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSP 420
           SLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSP
Sbjct: 361 SLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSP 420

Query: 421 GDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKY 480
           GDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKY
Sbjct: 421 GDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKY 480

Query: 481 EPDNSLRIVVTSSDSRIRIFDXXXXXXXXXXXGFQSGASQHKACLATVKGQQVVLSSSDD 540
           EPDNSLRIVVTSSDSRIRIFD           GFQSGASQHKACLATVKGQQVVLSSSDD
Sbjct: 481 EPDNSLRIVVTSSDSRIRIFDLEKKKLLEYLKGFQSGASQHKACLATVKGQQVVLSSSDD 540

Query: 541 HWVHGWKLKSSTSLTESEKNNNIDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNI 600
           HWVHGWKLKSSTSLTESEKNNNIDQ                                DNI
Sbjct: 541 HWVHGWKLKSSTSLTESEKNNNIDQTAATTTTTKKSNSHSISRSGSFRSLFSKSSKKDNI 600

Query: 601 DENGKHSHLKLTSLIPHCHNGSTVIKNSDGISFHAHHAPVTTAIVAPSGTAKTLSLSNDF 660
           DENGKHSHLKLTSLIPHCHNGSTVIKNSDGISFHAHHAPVTTAIVAPSGTAKTLSLSNDF
Sbjct: 601 DENGKHSHLKLTSLIPHCHNGSTVIKNSDGISFHAHHAPVTTAIVAPSGTAKTLSLSNDF 660

Query: 661 IYELSSEFAMESRDFEMNTNSDTHSVTTXXXXXXXXXXXXXXXATLVPPSISAVDLIGSI 720
           IYELSSEFAMESRDFEMNTNSDTHSVTT               ATLVPPSISAVDLIGSI
Sbjct: 661 IYELSSEFAMESRDFEMNTNSDTHSVTTSGSSDKSKIRSHSSSATLVPPSISAVDLIGSI 720

Query: 721 IVTTDNTGIIRVFRADISSTIRKKVLCTLQQCKKESIRSNKSGDSLKTLASAPTTVTTGP 780
           IVTTDNTGIIRVFRADISSTIRKKVLCTLQQCKKESIRSNKSGDSLKTLASAPTTVTTGP
Sbjct: 721 IVTTDNTGIIRVFRADISSTIRKKVLCTLQQCKKESIRSNKSGDSLKTLASAPTTVTTGP 780

Query: 781 TGHAKSSFHCPISRAKSSAAVNALALNQGMARAGSISRKTKSSLPFKRASSCTNFNNLNF 840
           TGHAKSSFHCPISRAKSSAAVNALALNQGMARAGSISRKTKSSLPFKRASSCTNFNNLNF
Sbjct: 781 TGHAKSSFHCPISRAKSSAAVNALALNQGMARAGSISRKTKSSLPFKRASSCTNFNNLNF 840

Query: 841 TIGSGSPRESVTSFDIDGEHVTNNPIKMGVRCDVCHGMRFEAITKNVSGRPDKGYYCMDC 900
           TIGSGSPRESVTSFDIDGEHVTNNPIKMGVRCDVCHGMRFEAITKNVSGRPDKGYYCMDC
Sbjct: 841 TIGSGSPRESVTSFDIDGEHVTNNPIKMGVRCDVCHGMRFEAITKNVSGRPDKGYYCMDC 900

Query: 901 GTVLNNFR 908
           GTVLNNFR
Sbjct: 901 GTVLNNFR 908

>YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protein
           containing six WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to S. cerevisiae Ykl121p, which binds
           phosphatidylinositol [2505 bp, 834 aa]
          Length = 834

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/887 (42%), Positives = 494/887 (55%), Gaps = 130/887 (14%)

Query: 46  NSKYSADIKPLQFKMNHVPGTRDRKHISYAAAAPSSSLRS----------NGSMKGQKYS 95
           N +YSADI+PL+F+M     T D+   S    A  S +R           N +++  ++ 
Sbjct: 54  NLEYSADIEPLKFRMTKTNNTNDKLKYSNNGNATDSFMRLKEHLQRGNTLNSNLRVNEF- 112

Query: 96  YLFNSIDQDQFEKYLMEPTYIKILKRRKNLKMFRRLFLAQELKAFDDENKINAFTNQING 155
           Y FNSID +QFE YL EP YIK+LKRRKNLK FRRLFLAQEL A++ E            
Sbjct: 113 YPFNSIDTEQFENYLREPKYIKMLKRRKNLKQFRRLFLAQELMAYEGE------------ 160

Query: 156 LQXXXXXXXXXXXXXXXXXDRAIWITKFSLDGKFMASAGKSGIIRVWKVLNSPIERWELG 215
                               +AIW TKFS DGKFMA+  K G IR+WKV+ SP+ER EL 
Sbjct: 161 -------TVTSTSKSSEPTSKAIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELD 213

Query: 216 SSVDSNNATLVKSKRLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 275
           SS +SN     KS R++                                           
Sbjct: 214 SSAESNKEARAKSMRIKQQV---------------------------------------- 233

Query: 276 XXIHNTTSSSESTNFRRAQTLEKLDQKISSTNE-LNLYAPVFNPSCFKIFKEHTADVLDL 334
                    S   N +  Q L+   +K     + LNLYAPVF+P+  +++KEH  DVLD+
Sbjct: 234 ---------SSLNNPKEKQFLDSATEKYEEKEKLLNLYAPVFHPTPLRLYKEHVQDVLDI 284

Query: 335 DWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVR 394
           +WSKNNF++++SMD+TVKLWH +R+ SLKTF H DFVTCV FHPTDDRFFISGCLDHK R
Sbjct: 285 NWSKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCR 344

Query: 395 LWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDK 454
           LWSIL++E++FE+DCQDLITS+TLSP +GKYTI+GTFNGYVH+L+T+GL  VSSFHV D+
Sbjct: 345 LWSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADR 404

Query: 455 NTQERNT------ASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFDXXXXXXX 508
            TQE+N         +KI HGPRVTGL+ F+ + DNS R+VVTS+DSRIRIFD       
Sbjct: 405 QTQEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLL 464

Query: 509 XXXXGFQSGASQHKACLATVKGQQVVLSSSDDHWVHGWKLKSSTSLTESEKNNNIDQXXX 568
               GF SG+SQHKA L+   GQ +V++SSDDHWV+GW+LKS      S++ N+ D+   
Sbjct: 465 EVLKGFHSGSSQHKAQLSIWHGQPIVVNSSDDHWVYGWRLKS------SDRENDQDEPKR 518

Query: 569 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNIDENGKHSHLKLTSLIPHCHNGST-VIKN 627
                                           +E   H HLKLT+L+P  H+ +   IKN
Sbjct: 519 KPKGLARSGSLRSIFSKSMSRSSSQN------NEEKPHHHLKLTNLLPLPHHSNDHYIKN 572

Query: 628 SDGISFHAHHAPVTTAIVAPSGTAKTLSLSNDFIYELSSEFAMESRDFEM----NTNSDT 683
           +D ISFHAH+APVT   +AP  T+KTLSLSND I ELS EF   S  F++    N +   
Sbjct: 573 TDYISFHAHNAPVTCVSIAPPETSKTLSLSNDVICELSLEFFQTSDSFDVLSRSNDDGIM 632

Query: 684 HSVTTXXXXXXXXXXXXXXXATLVPPSISAVDLIGSIIVTTDNTGIIRVFRADISSTIRK 743
             V +               AT   P +  VD IG+I+++TDN G IRVFRAD+ S IRK
Sbjct: 633 SDVESSLGYNSKPGSISNASATSAIPDV--VDAIGTILISTDNVGTIRVFRADMPSVIRK 690

Query: 744 KVLCTLQQCKKESIRSNKSGDSLKTLASAPTTVTTGPTGHAKSSFHCPISRAKSSAAVNA 803
           +VL  L++  +E  R   S DSL +L+                SF+   SRAKS+ A   
Sbjct: 691 RVLLKLEEYNREVRRRFNSSDSLHSLS---------------RSFN---SRAKSNLAGQP 732

Query: 804 LALNQGMARAGSISRKTKSSLPFKRASSCTNFNNLNFTIGSGSPRESVTSF--DIDGEHV 861
            A      +  +  R   +  P     S T+   L       +PRES++S   +  G   
Sbjct: 733 AAAYTNTGKGYATGRGYSNICP----KSSTSLKTLGSNAQPRTPRESMSSIFSNAHGPTT 788

Query: 862 TNNPIKMGVRCDVCHGMRFEAITKNVSGRPDKGYYCMDCGTVLNNFR 908
             + + + +RC+VC+G RFEA +   + + D+ YYC+DCGTV+NNFR
Sbjct: 789 PTSAMNLPIRCNVCNGSRFEAFS-GANDQQDRNYYCVDCGTVVNNFR 834

>CAGL0K03377g complement(306529..309465) similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 978

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/981 (38%), Positives = 515/981 (52%), Gaps = 188/981 (19%)

Query: 36  SKETSLSSVDNSKYSADIKPLQFKMN-----HVPGTRDRKHISYAAAA-----PSSSLR- 84
           SK+ +   +++++YSADI+PLQFKM+        GT   K    A A+     P  +LR 
Sbjct: 78  SKDRTKKEINSAEYSADIQPLQFKMSRRRTTQFDGTESSKASRKANASGNGSDPIKTLRF 137

Query: 85  ----------------SNGSMKGQKYSYL---------------------FNSIDQDQFE 107
                           +  S++   ++ +                     F  ID++QFE
Sbjct: 138 DEGSLSSSPTAIASDATRASLQRDTFAKVREHIQRGSVGNSGLTRSDFNPFAFIDREQFE 197

Query: 108 KYLMEPTYIKILKRR-KNLKMFRRLFLAQELKAFDDENKINAFT----NQINGLQXXXXX 162
            YL EP YI+I K+R ++ K FRRLFLAQELK  D+ + I A +    +Q +GL+     
Sbjct: 198 TYLKEPRYIRIFKKRSRSSKQFRRLFLAQELKTTDEFDDIEAMSASLLSQPDGLKPNTSI 257

Query: 163 XXXXXXXXXXXXD----------------------------------RAIWITKFSLDGK 188
                       +                                  +AIW TKFS+DGK
Sbjct: 258 TNATLNGNNFHDNINDPNHDMHSDKTFSGTACPVLPTSGHLEPAKNTKAIWSTKFSIDGK 317

Query: 189 FMASAGKSGIIRVWKVLNSPIERWELGSSVDSNNATLVKSKRLRXXXXXXXXXXXXXXXX 248
           +MA+  + G++R+WKVL++P+ERW L SS+DS + T  KS RL+                
Sbjct: 318 YMATGSRDGVLRLWKVLSTPVERWGLDSSIDSAHLTSAKSLRLQQNQ------------- 364

Query: 249 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXIHNTTSSSE--STNFRRAQTLEKLDQKISST 306
                                         H ++      S   RR  T + +D K    
Sbjct: 365 ------------------------------HGSSHGGPLGSPAMRR-DTFDNIDAK---E 390

Query: 307 NELNLYAPVFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ 366
           N  NLYAPVF P+  + +KEH  DVLD+DWSKNNFLI++SMD+T KLWH  +  SLK+FQ
Sbjct: 391 NSSNLYAPVFQPTPVRTYKEHLHDVLDMDWSKNNFLISASMDKTAKLWHPSKMRSLKSFQ 450

Query: 367 HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYT 426
           H DFVTCV+FHPTDDRFFISGCLD K RLWSIL++E++FEF+C+DL+TSLTL+PGDG YT
Sbjct: 451 HPDFVTCVKFHPTDDRFFISGCLDQKCRLWSILDDEVSFEFNCRDLVTSLTLTPGDGTYT 510

Query: 427 IVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQERN------TASTKIHHGPRVTGLECFKY 480
           IVGTFNGY+HVL TKGLE ++SFHV  K T E        +  +K+ HGPRVTGL+CF  
Sbjct: 511 IVGTFNGYIHVLQTKGLEHITSFHVTAKKTHENTHEVLCPSNDSKVRHGPRVTGLQCFNS 570

Query: 481 EPDNSLRIVVTSSDSRIRIFDXXXXXXXXXXXGFQSGASQHKACLATVKGQQVVLSSSDD 540
             DNSLR+VVTSSDSRIR+FD           GFQ G+SQHKA ++  + Q +V++SSDD
Sbjct: 571 LIDNSLRLVVTSSDSRIRVFDLTRRKLIEILRGFQCGSSQHKAQISVYRNQPIVINSSDD 630

Query: 541 HWVHGWKLKSS--TSLTESEKNNNIDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXD 598
           HWV+GW+LKSS    + +  K + + +                                 
Sbjct: 631 HWVYGWRLKSSDPVEINKKAKKHGMSRSGSIRGLFSKSISRSSSQGSE------------ 678

Query: 599 NIDENGKHSHLKLTSL--IPHCHNGSTVIKNSDGISFHAHHAPVTTAIVAPSGTAKTLSL 656
             D     + LKL+SL  IPH  +   V+KNSD  SFHAH+APVTT  +AP  T+KTLSL
Sbjct: 679 --DRQSLRNTLKLSSLLPIPHSSHSDGVMKNSDYFSFHAHNAPVTTVTMAPEETSKTLSL 736

Query: 657 SNDFIYELSSEFAMESRDFEMNTNSDTHSVTTXXXXXXXXXXXXXXXATLVPPSISAVDL 716
           SND I ELS EF   S + ++    DT                     +L  P  + V++
Sbjct: 737 SNDPICELSLEFFEPSDEVDIIKLKDTQ----KGGHDNIPATKTPVTTSLAKP--TPVEV 790

Query: 717 IGSIIVTTDNTGIIRVFRADISSTIRKKVLCTLQQCKKESIRSNKSGDSL--KTLASAPT 774
           IGSI+++TD+ G+IRVFRAD+S +IR +VL  LQ+  +E  +   S DSL  +   S P 
Sbjct: 791 IGSILISTDSNGLIRVFRADMSKSIRARVLQKLQKYNREMGKQYGSTDSLVSENDKSRPN 850

Query: 775 TVTTGPTGHAKSSFHCPISRAKS--SAAVNALALNQGMARAGSISRKT--KSSLPFKRAS 830
             T G         H P + + S  S+  +      G     SI+R    +S   FK  S
Sbjct: 851 LGTVG---------HQPSTNSTSFLSSTGSTNTTTVGSGSKASITRNHSFRSLKAFK--S 899

Query: 831 SCTNFNN--LNFTIGSGSPRESVTSFDIDGEHVTNNPIKM-GVRCDVCHGMRFEAITKNV 887
              NF+N  L  T+   +PRES++S   D    T  P+   G++C VC G +FE +T++ 
Sbjct: 900 PTANFSNTALGATMNR-APRESISSVRSDSTSNTMTPMSFPGLKCHVCDGTKFEPLTRS- 957

Query: 888 SGRPDKGYYCMDCGTVLNNFR 908
           SG  DK Y+C+DC T+LNNFR
Sbjct: 958 SGSQDKSYFCVDCKTLLNNFR 978

>Scas_721.128
          Length = 851

 Score =  445 bits (1145), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 258/620 (41%), Positives = 357/620 (57%), Gaps = 36/620 (5%)

Query: 309 LNLYAPVFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQ 368
           LNLYAP+F+P+  +I+KEH+ D+LDLDWSKNNFL+T+SMD+ V LWH +R+TSLK+F H 
Sbjct: 248 LNLYAPIFHPNPVRIYKEHSHDILDLDWSKNNFLLTASMDKLVSLWHPDRETSLKSFPHP 307

Query: 369 DFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIV 428
           DFVT VRFHP DDRFF+SGCLDHK R+WSILEN++ +EFDCQDLIT++++SPG G++TI+
Sbjct: 308 DFVTSVRFHPKDDRFFVSGCLDHKCRMWSILENKVVYEFDCQDLITAISISPGVGEFTII 367

Query: 429 GTFNGYVHVLLTKGLEQVSSFHVVDKNTQERNTAST----------KIHHGPRVTGLECF 478
           GTFNGY+ +L T  L+ + +FHV+DK+ Q  +   +          K HHGPRVTGL+ F
Sbjct: 368 GTFNGYITILSTFELKPLYTFHVLDKHMQGNSGNDSSFKNLLGQNLKNHHGPRVTGLQLF 427

Query: 479 KYEPDNSLRIVVTSSDSRIRIFDXXXXXXXXXXXGFQSGASQHKACLATVKGQQVVLSSS 538
             +  + L+++V+S+DSRIRIFD           GF+SG SQH A L+    Q +V++SS
Sbjct: 428 LEKETDDLKLLVSSTDSRIRIFDLEKNKLIEVFKGFRSGLSQHNAQLSNWGDQPIVINSS 487

Query: 539 DDHWVHGWKLKSSTSLTESEKNNNIDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXD 598
            DHW + WK+ +S   T ++  ++I Q                                 
Sbjct: 488 KDHWFYAWKINTSNPKT-TQNFSSIRQERLSTGGGLNDLLNKSSEKKETTHELSRTSTAG 546

Query: 599 NIDENGKHSHLK-LTSLIPHCHNGSTVIKNSDGISFHAHHAPVTTAIVAPSGTAKTLSLS 657
             D + +H  L  L+ L+PH    S V+KNS  ++FHAHHAPV+TA +AP  TAKTLSLS
Sbjct: 547 --DSSTRHHFLPSLSRLLPH---SSHVVKNSHYVAFHAHHAPVSTATIAPQETAKTLSLS 601

Query: 658 NDFIYELSSEFAMESRDFEMNTNSDTHSVTTXXXXXXXXXXXXXXXATLVPPSISAVDLI 717
           NDFI EL+ +  ME  D    T   + S                   T+      AV+ I
Sbjct: 602 NDFICELTLQ-VME--DIRKTTTGSSDSSNGRSSVDKKKNASEKSLPTVTSGIPDAVNAI 658

Query: 718 GSIIVTTDNTGIIRVFRADISSTIRKKVLCTLQQCKKESIRSNKSGDSLKTLASAPT--T 775
           G I+VTTD  G IRVFR D+S+  R +VL  LQ  K+ S     S  +L  L ++ +   
Sbjct: 659 GPILVTTDTRGTIRVFRVDMSNATRSRVLKKLQDYKQNSQDIIDSATTLNPLNASDSEGA 718

Query: 776 VTTGPTGHAKSSFHCPISRAKSSAAVNALALNQGMARAGSISRKTKSSLPFKRASSCTNF 835
           + T P     S    P    +S    N    N  + R GSIS     + P K     T+F
Sbjct: 719 INTTPLIQVNS---IP---QRSRTNQNGSQTNGSVQRNGSISNNGTGTGP-KSPRPSTSF 771

Query: 836 NN-------LNFTIGSGSPRESVTSFDIDGEHVTNNPIKMGVRCDVCHGMRFEAITKNVS 888
            N        +F+  + S + S+ S   D E + +      ++CDVC G+ FE ++KN+ 
Sbjct: 772 TNAIFNRSNSSFSSSNRSRKPSIQSVMSDAEELHHGSRPSRLKCDVCDGINFEPLSKNLL 831

Query: 889 GRPDKGYYCMDCGTVLNNFR 908
           G+ + GYYC+DCGT+LNNFR
Sbjct: 832 GQRENGYYCVDCGTILNNFR 851

 Score =  136 bits (342), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 84/216 (38%), Positives = 122/216 (56%), Gaps = 24/216 (11%)

Query: 19  TDSTSSPSEGLSDLKPLSKETSLSSVDNSKYSADIKPLQFKMNHVPGTRD-RKHISYAAA 77
           +D++ + S+ L D KP S E   +S  N +YSAD++PL+FKM   P   +   H+  A+A
Sbjct: 30  SDNSQASSDLLYD-KPSSTE--FASRQNLEYSADLQPLKFKMTRTPDLEEVPSHVKTASA 86

Query: 78  APSSSLR-SNGSMKGQKYSYLFNSIDQDQFEKYLMEPTYIKILKRRKNLKMFRRLFLAQE 136
              S  +  N   K    S+ F+SIDQ+QFE YL EP YIK+ K+ ++L+ F+RLFLAQE
Sbjct: 87  DVDSFYKVRNRLQKIADPSWNFSSIDQEQFEIYLKEPEYIKVFKKHEDLEEFKRLFLAQE 146

Query: 137 LKAFDDENKINAFTNQINGLQXXXXXXXXXXXXXXXXXDRAIWITKFSLDGKFMASAGKS 196
           L         N  T + N                    ++AIW  KFS DGK+MA+  K 
Sbjct: 147 L---------NVTTTKEND----------PTAQNTDASNKAIWTLKFSHDGKYMATGSKD 187

Query: 197 GIIRVWKVLNSPIERWELGSSVDSNNATLVKSKRLR 232
           G + +WKV++SP+ERWEL  + +SN   + KS R++
Sbjct: 188 GCVMLWKVISSPVERWELDRAEESNLVAMAKSIRIK 223

>YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containing
           three WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has moderate similarity to
           uncharacterized S. cerevisiae Ymr102p [2559 bp, 852 aa]
          Length = 852

 Score =  379 bits (974), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 214/519 (41%), Positives = 289/519 (55%), Gaps = 76/519 (14%)

Query: 42  SSVDNSKYSADIKPLQFKM--NHVPGTRDRKHISYAAAAPSSSLRSNGSMK-GQKYSYLF 98
           SS  +  YSADI P Q +   N   GTR RK +        +S+ SNG  K  +   + F
Sbjct: 57  SSRYDGGYSADIIPAQLRFIDNIDYGTRLRKTLH------RNSVVSNGYNKLSENDRWYF 110

Query: 99  NSIDQDQFEKYLMEPTYIKILKRRKNLKMFRRLFLAQELKAFDDENKINAFTNQINGLQX 158
           +  D+  FE YL EPTYIKI K+++ L+ F R+FLAQELK  D              +  
Sbjct: 111 DLFDRKYFENYLEEPTYIKIFKKKEGLEQFDRMFLAQELKIPD--------------VYK 156

Query: 159 XXXXXXXXXXXXXXXXDRAIWITKFSLDGKFMASAGKSGIIRVWKVLNSPIERWELGSSV 218
                             +I    FS DGK+M    K G + +WKV+NSP++R E+G S 
Sbjct: 157 STTYQGEPAVANSELFKNSICCCTFSHDGKYMVIGCKDGSLHLWKVINSPVKRSEMGRSE 216

Query: 219 DSNNATLVKSKRLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI 278
            S +A+   S +++                                              
Sbjct: 217 KSVSASRANSLKIQRHLASISS-------------------------------------- 238

Query: 279 HNTTSSSESTNFRRAQTLEKLDQKISSTNELNLYAPVFNPSCFKIFKEHTADVLDLDWSK 338
           HN + SS          L+  DQ    + +L+LYAPVF    F++F EH  D+LD +WSK
Sbjct: 239 HNGSISSND--------LKPSDQFEGPSKQLHLYAPVFYSDVFRVFMEHALDILDANWSK 290

Query: 339 NNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           N FLIT+SMD+T KLWH ER+ SLKTF H DFVT   F P DDRF I+GCLDH+ RLWSI
Sbjct: 291 NGFLITASMDKTAKLWHPERKYSLKTFVHPDFVTSAIFFPNDDRFIITGCLDHRCRLWSI 350

Query: 399 LENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQ- 457
           L+NE+++ FDC+DLITSLTLSP  G+YTI+GTFNGY++VLLT GL+ VSSFHV DK+TQ 
Sbjct: 351 LDNEVSYAFDCKDLITSLTLSPPGGEYTIIGTFNGYIYVLLTHGLKFVSSFHVSDKSTQG 410

Query: 458 ------ERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFDXXXXXXXXXX 511
                   ++   K+ HGPR+TGL+CF  + D +LR++VT++DS+I+IFD          
Sbjct: 411 TTKNSFHPSSEYGKVQHGPRITGLQCFFSKVDKNLRLIVTTNDSKIQIFDLNEKKPLELF 470

Query: 512 XGFQSGASQHKACLATVKGQQVVLSSSDDHWVHGWKLKS 550
            GFQSG+S+H+     +K + VV + SDDHW + WK++S
Sbjct: 471 KGFQSGSSRHRGQFLMMKNEPVVFTGSDDHWFYTWKMQS 509

 Score =  118 bits (296), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 100/308 (32%), Positives = 142/308 (46%), Gaps = 51/308 (16%)

Query: 621 GSTVIKNSDGISFHAHHAPVTTAIVAPSGTAKTLSLSNDFIYELSSEFAME-----SRDF 675
           GS  IKN+  ISFHAH++PVT A +AP    K LSLSND I+EL+S++  E     S   
Sbjct: 576 GSQAIKNNHYISFHAHNSPVTCASIAPDVAIKNLSLSNDLIFELTSQYFKEMGQNYSESK 635

Query: 676 EMNTNSDTHSVTTXXXXXXXXXXXXXXXATLVPPSISAVDLIGSIIVTTDNTGIIRVFRA 735
           E   N   H VT                        + V+ +G+I++TTD+ G+IRVFR 
Sbjct: 636 ETCDNKPNHPVTETGGFSSNLS--------------NVVNNVGTILITTDSQGLIRVFRT 681

Query: 736 DISSTIRKKVLCTLQQCKKESIRS-----NKSGDSL------KTLASAPTTVTTGPTGHA 784
           DI   IRKK++    +     + +     N + DS+      +  ++     +T P  + 
Sbjct: 682 DILPEIRKKIIEKFHEYNLFHLEAAGKINNHNNDSILENRMDERSSTEDNEFSTTPPSNT 741

Query: 785 KSSFHCPISRAKSSAAVNALALNQGMARAGSISRKTKSSLPFKRASSCTNFNNLNFTIGS 844
            +S        + S     L  N     +G  SR   +S  FK +     FN  N +  S
Sbjct: 742 HNS--------RPSHDFCELHPNNSPVISGMPSR---ASAIFKNSI----FNKSNGSFIS 786

Query: 845 GSPRESVTSFDIDGEH----VTNNPIKMGVRCDVCHGMRFEAITKNVSGRPDKGYYCMDC 900
              R   TS  + G H    V+    K+  +CDVC+G  FE  +KN     D G+ C DC
Sbjct: 787 LKSRSESTSSTVFGPHDIPRVSTTYPKL--KCDVCNGSNFECASKNPIAGGDSGFTCADC 844

Query: 901 GTVLNNFR 908
           GT+LNNFR
Sbjct: 845 GTILNNFR 852

>Kwal_26.7655
          Length = 743

 Score =  362 bits (928), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 205/491 (41%), Positives = 280/491 (57%), Gaps = 37/491 (7%)

Query: 297 EKLDQKISSTNELNLYAPVFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHL 356
           E+ +Q I   + ++LYAPVF+P  F+I++EHT D+LDLDWSKN F++T+SMD+T +LWH 
Sbjct: 242 EEPEQPIGPAS-MDLYAPVFHPLPFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHC 300

Query: 357 ERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSL 416
           +R  +LK F H DFVTC +FHP DDRFFISGCLDH +RLWSIL+N ++F++ C D+IT++
Sbjct: 301 DRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAI 360

Query: 417 TLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQERNTASTKI-HHGPRVTGL 475
             SP DGKYT  GTFNG++ +L T+GLE VS+FHV++K     N  + K+   GP++TG+
Sbjct: 361 DTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKP----NGTTKKVPESGPKITGI 416

Query: 476 ECFKYEPDNSLRIVVTSSDSRIRIFDXXXXXXXXXXXGFQSGASQHKACLATVKGQQV-V 534
           E FK  PDN LRI+VTS+DSRIRIF            GF++  SQ  A L     +++ V
Sbjct: 417 EFFKSAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLKGFENTHSQISAHLILPPSKKIFV 476

Query: 535 LSSSDDHWVHGWKLKSSTSLTESEKNNNIDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 594
           L+ S++ WV+ W+++SS  ++ S+ + N                                
Sbjct: 477 LAPSENQWVYCWRVESSAGVSNSDDSQNNGTHRRGSIRGLLQRSLSIGSSQSPERQEY-- 534

Query: 595 XXXDNIDENGKHSH-LKLTSLIPHCHNGSTVIKNSDGISFHAHHAPVTTAIVAPSGTAKT 653
                  +NG HSH L L S       G   IKN   I+FHAH   VTT  VAP  T KT
Sbjct: 535 -------KNGSHSHSLHLPSPTAKS-KGDQYIKNQHYIAFHAHRCTVTTTAVAPVNTNKT 586

Query: 654 LSLSNDFIYELSSEFAMESRDFEMNTNSDTHSVTTXXXXXXXXXXXXXXXATLVPPSISA 713
           L+LS+DFI EL+   +    D          S+                         S 
Sbjct: 587 LALSDDFICELTMALSETDEDVAFLKQQRRKSLIHSKKGSQKDRDLMERRFP------SM 640

Query: 714 VDLIGSIIVTTDNTGIIRVFRADISSTIRKKVLCTLQQCKKESIRSNKSGDSLKTLASAP 773
           +D IG+I+V+TDN+GIIRVFR+DIS+ +RKKVL    +C KES     SG S        
Sbjct: 641 IDAIGTIVVSTDNSGIIRVFRSDISTNVRKKVL----KCLKESSTPPMSGSS-------- 688

Query: 774 TTVTTGPTGHA 784
            + + GP  HA
Sbjct: 689 -SDSNGPNVHA 698

 Score = 99.4 bits (246), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 73/130 (56%), Gaps = 15/130 (11%)

Query: 97  LFNSIDQDQFEKYLMEPTYIKILKRRKNLKMFRRLFLAQELKAFDDENKINAFTNQINGL 156
           +F  I+++QF +YL EP Y+K+  R+  +K FRRLFLAQEL+    +   ++ T      
Sbjct: 112 VFGRINREQFHQYLKEPKYLKVFNRQPRVKQFRRLFLAQELRLHASDLTSSSSTTLSTLS 171

Query: 157 QXXXXXXXXXXXXXXXXXDRAIWITKFSLDGKFMASAGKSGIIRVWKVLNSPIERWELGS 216
           +                 DRA+W TKFS DGK+MA+ GK   +RVWKV+ SP+ER +L S
Sbjct: 172 ENS---------------DRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSS 216

Query: 217 SVDSNNATLV 226
           +     A  +
Sbjct: 217 ATAKPQAKRI 226

>ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH]
           complement(353684..355888) [2205 bp, 734 aa]
          Length = 734

 Score =  327 bits (839), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 209/598 (34%), Positives = 300/598 (50%), Gaps = 62/598 (10%)

Query: 312 YAPVFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFV 371
           YAPVF+P   ++F EH  D+LD DWSKN+FL+T+SMD+TVKLWH+ R TSLKTF H DFV
Sbjct: 198 YAPVFHPDPHRVFGEHLQDILDCDWSKNSFLLTASMDKTVKLWHINRTTSLKTFVHPDFV 257

Query: 372 TCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTF 431
           TCVRFHP DDRFF SGCLDH VR WSILE E+   F+C DLI +L +SP DG + ++GTF
Sbjct: 258 TCVRFHPHDDRFFFSGCLDHTVRTWSILEGEVAEAFNCGDLIMALDVSP-DGNWLLIGTF 316

Query: 432 NGYVHVLLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVT 491
           NGYVHVL T GL+ + SFH++ K  +  N    +  HGP++TG+E  +++    L +++T
Sbjct: 317 NGYVHVLHTNGLKLLHSFHLLQKPNETEN----RPRHGPKITGVEFIRHKAYPWLGLLIT 372

Query: 492 SSDSRIRIFDXXXXXXXXXXXGFQSGASQHKA-CLATVKGQQVVLSSSDDHWVHGWKLKS 550
           S+DSR+R+FD           GF + +S+  A  L    G+ VVLS+S++HW++ W L  
Sbjct: 373 SNDSRVRLFDMSTTRLLEIFRGFSNESSRISAHHLEMEDGESVVLSASENHWLYTWMLHH 432

Query: 551 STSLTESEKNNNIDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNIDENGKHSHLK 610
                E    ++ D                                 D + E+   +   
Sbjct: 433 -----EEYMYSHSDLDNARTVPSPIDGKDPKKHSIRNIFRRSISFNSDILSESNPVARHH 487

Query: 611 LTSLIPHCHNGSTVIKNSDGISFHAHHAPVTTAIVAPSGTAKTLSLSNDFIYELSSEFAM 670
                    +    +KNS+ I+FHAHH PVT A +AP  T   LSLS+D I EL+ +F  
Sbjct: 488 FPLFHHKAQHKGGCVKNSEYITFHAHHNPVTAATIAPKETTHVLSLSDDIICELNMKFGG 547

Query: 671 ESRDFEMNTNSDTHSVTTXXXXXXXXXXXXXXXATLVPPSISAVDLIGSIIVTTDNTGII 730
           E+ +     +  T S+                 A       +A   +G+IIV+   TG I
Sbjct: 548 EALE-----HLRTKSIREPGSPAGRSDHKRNHSAEKNYSQSTAKQNVGTIIVSAAATGQI 602

Query: 731 RVFRADISSTIRKKVLCTLQQCKKESIRSNKSGDSLKTLASAPTTVTTGPTGHAKSSFHC 790
           RVFR D+SS++R K L        E+IR+         L  +P                 
Sbjct: 603 RVFRTDVSSSVRAKAL--------EAIRAAHG------LPGSPER--------------- 633

Query: 791 PISRAKSSAAVNALALNQGMARAGSISRKTKSSLPFKRASSCTNFNNLNFTIGSGSPRES 850
           P+   K   +  A  L+ G+A+   I    +S+ P      C        +  +G   ES
Sbjct: 634 PL---KPVLSALAHPLSAGVAKGKHICGDNRSA-PSTTCPRCAP------SAVNGQQDES 683

Query: 851 VTSFDIDGEHVTNNPIKMGVRCDVCHGMRFEAITKNVSGRPDKGYYCMDCGTVLNNFR 908
            ++     E  T++P      CDVC G +   + K  + +  K  YC++CG  +N F+
Sbjct: 684 AST----AEQSTSSPKPT---CDVCGGQKLSVVGKKTALQKTKSLYCLECGNHINRFK 734

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 66/132 (50%), Gaps = 16/132 (12%)

Query: 106 FEKYLMEPTYIKILKRRKNLKMFRRLFLAQELKAFDDENKINAFTNQINGLQXXXXXXXX 165
             ++  EP YIK+L R+K  + FRRLF+AQEL+   D           + L         
Sbjct: 51  LRRFAAEPEYIKVLARKKGARCFRRLFVAQELQPPVD-----------SPLHANHSSQSL 99

Query: 166 XXXXXXXXXDRAIWITKFSLDGKFMASAGKSGIIRVWKVLNSPIERWEL-----GSSVDS 220
                     R++W+ +FS DGK++AS GK   + VWKV+ SP+ERW L     G    S
Sbjct: 100 GQAAPAGDKARSVWLLRFSKDGKYLASGGKGRQLCVWKVIASPMERWNLLPVYGGDKHHS 159

Query: 221 NNATLVKSKRLR 232
           N  +L+  + L+
Sbjct: 160 NTLSLLNQQLLK 171

>Sklu_2430.9 YMR102C, Contig c2430 15497-18397
          Length = 966

 Score =  316 bits (810), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 147/261 (56%), Positives = 191/261 (73%), Gaps = 10/261 (3%)

Query: 309 LNLYAPVFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQ 368
           LNLYAPVF+P  ++ F  H  D+LD+DWSKNNF++T SMD+TVKLWH +R+  LK F H 
Sbjct: 377 LNLYAPVFHPLPYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHP 436

Query: 369 DFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIV 428
           DFVTCV+FHP DDRFFISGCLDHK RLWSIL++E++FEFDC DLITSL +SPGD KYTI+
Sbjct: 437 DFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTIL 496

Query: 429 GTFNGYVHVLLTKGLEQVSSFHVVDKN--------TQERNTASTKIHHGPRVTGLECFKY 480
           GTFNGYV VLLT+GLE V SFH+ DK         T++  T+ T  HHGP+VTG+ECF+ 
Sbjct: 497 GTFNGYVIVLLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIECFRA 556

Query: 481 EPDNSLRIVVTSSDSRIRIFDXXXXXXXXXXXGFQSGASQHKACLAT--VKGQQVVLSSS 538
             D +L+++VTS+DS+IR+F+           GF++ +SQ  A L T     QQ V++ S
Sbjct: 557 VNDMTLKLLVTSNDSKIRVFNLKDNILQEVLKGFENESSQISAHLITGSKNKQQFVIAPS 616

Query: 539 DDHWVHGWKLKSSTSLTESEK 559
           +DHW++ WKL+SS    + +K
Sbjct: 617 EDHWIYCWKLQSSLMTKDKDK 637

 Score =  124 bits (312), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 98/301 (32%), Positives = 138/301 (45%), Gaps = 49/301 (16%)

Query: 625 IKNSDGISFHAHHAPVTTAIVAPSGTAKTLSLSNDFIYELSSEFAMESRDFEM----NTN 680
           +KN++ I+FHAHH P+TTAI AP  TA+TLSLSNDFI EL+ EF  +  D  +    N  
Sbjct: 698 LKNNEYIAFHAHHHPLTTAIAAPPETARTLSLSNDFICELTMEFCEDYDDVRIVNTYNKK 757

Query: 681 SDTHSVTTXXXXXXXXXXXXXXXATLVPPSISAVD-LIGSIIVTTDNTGIIRVFRADISS 739
                                      P  I  VD  IG+I+VT+D+ G+IRVFR+DIS+
Sbjct: 758 QKQKKKKDADIAQEDDACDNDGDVGTNPRRIPTVDEFIGAILVTSDDNGVIRVFRSDIST 817

Query: 740 TIRKKVLCTLQQ---------CKKESIRSNKSGDSLKTLASAPTTVTTGPTGHAKSSFH- 789
            IRK+VL  LQ+           + S+  ++  D + +   A   +TT     A + F+ 
Sbjct: 818 NIRKRVLAKLQEEDVKDATDKKNRNSVSISEVNDEIASAVHALGNLTTNTVKAATAGFNK 877

Query: 790 -CPISRAKSSAAVNALALNQGMARAGSISRKTKSSLPFKRASSCTNFNNLNFTIGSGSPR 848
            CP+     S +V +L          S  R +KSS      SS                +
Sbjct: 878 SCPMGNYSHSNSVLSL----------STMRSSKSSTAQSIPSS----------------Q 911

Query: 849 ESVTSFDIDGEHVTNNPIKMGVRCDVCHGMRFEAITKNVSGRPDK-GYYCMDCGTVLNNF 907
           E+ T      EHV        +RCDVC G+ F  +    S      G++C DCG  ++NF
Sbjct: 912 ETTT------EHVLPAASDSQMRCDVCGGVNFNVMKPMRSTDLRTVGFFCTDCGNQVSNF 965

Query: 908 R 908
           R
Sbjct: 966 R 966

 Score =  108 bits (271), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 101/212 (47%), Gaps = 43/212 (20%)

Query: 49  YSADIKPLQFKMNHVP----------GTRD-RKHISYAAAAPSSSL----RSNGSMKGQK 93
           YSADI PL+FKM+             G R   K I   + A    L    R+N ++K  K
Sbjct: 114 YSADIAPLRFKMSMTRLDNAAAVKPVGQRPIAKPIVLDSLAAGRRLDSTDRNNIAVKPDK 173

Query: 94  YS---------------YLFN------SIDQDQFEKYLMEPTYIKILKRRKNLKMFRRLF 132
            S               Y F+      SI++ QFE+YL EP YIK+ K+RK LK FRR F
Sbjct: 174 ISRVTKNPTKFVLDKDLYRFHHGSTLGSINRKQFEQYLKEPEYIKVFKKRKGLKQFRRFF 233

Query: 133 LAQELKAFDDENKINAFTNQINGLQXXXXXXXXXX-------XXXXXXXDRAIWITKFSL 185
           LAQELK        N  TN ++G+                          +++W  KFS 
Sbjct: 234 LAQELKIGTSPVNSNVGTNNVDGIPHVASSASIATLSSSSPTGSSSSSAGKSVWSMKFSK 293

Query: 186 DGKFMASAGKSGIIRVWKVLNSPIERWELGSS 217
           DG+F+A+ GK  I+R+WKV+ SP ER EL SS
Sbjct: 294 DGRFLATGGKDRILRIWKVIASPTERLELDSS 325

>KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 852

 Score =  286 bits (733), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 215/669 (32%), Positives = 309/669 (46%), Gaps = 135/669 (20%)

Query: 312 YAPVFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFV 371
           Y  VF+P+    F EHT D+LD+DWSKN+F++T SMD++ KLWH  R TSLKTF H DFV
Sbjct: 247 YCGVFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFV 306

Query: 372 TCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTF 431
           T VRFHP DDRFF+S CLD K RLWSILE ++ FE+DC DLIT++ +S  DG YTI+GTF
Sbjct: 307 TAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDISY-DGNYTILGTF 365

Query: 432 NGYVHVLLTKGLEQVSSFHVVDKNTQERN----------TASTKIHHGPRVTGLECFKYE 481
           NGY+HVL+TK LE + SF+V+DK+++ +            +S K  +GP++TGLE  + +
Sbjct: 366 NGYIHVLITKSLELLFSFNVLDKDSELKKCHRTSRRLKKQSSDKAKNGPKITGLEFIQKD 425

Query: 482 PDN--------SLRIVVTSSDSRIRIFDXXXXXXXXXXXGFQSGASQHKA-CLATVKGQQ 532
             N        S   +V+S+DSRIRI+            G  +  SQ  A    T  G+ 
Sbjct: 426 ARNYKISSKDVSDWFLVSSNDSRIRIY-TLNQEFVSVMKGHSNEHSQITAHSTVTRSGKA 484

Query: 533 VVLSSSDDHWVHGWKLKSSTSLTESEKNNNIDQXXXXXXXXXXXXXXXXXXXXXXXXXXX 592
            V+S S+DHW++ W  K S  + +S + ++ D                            
Sbjct: 485 YVVSGSEDHWIYCW--KLSDEVVKSTETSSKD-----SKSTRSRSGSLRSFCRRRNNDSV 537

Query: 593 XXXXXDNIDENGKHSHLKLTSLIPHCHNGSTVIKNSDGISFHAHHAPVTTAIVAPSGTAK 652
                D +   G   + +++S             NS+ I FHAHH P+T A   P    K
Sbjct: 538 ASETLDAVLSRGYTKNHQVSS-------------NSNYIGFHAHHHPITCATAVPMQVTK 584

Query: 653 TLSL---------------SNDFIYELSSEFAMESRDFEMNTNSD--------------- 682
            LSL               ++DF  E +S+ A   ++    +++D               
Sbjct: 585 VLSLSNDLICELTMQFWETTDDFTMESASKNARAKKNGNAISSNDGQKTDCRRKISIDKT 644

Query: 683 --------------THSVTTXXXXXXXXXXXXXXXATLV--PPSISAVDLIGSIIVTTDN 726
                         +++V                  T    PPS+  ++ IG I+V+ D 
Sbjct: 645 IPNVKGKSGVSGAQSNNVPNIQISDGDNRTTNAVNGTTAANPPSL--IEFIGGIVVSADT 702

Query: 727 TGIIRVFRADISSTIRKKVLCTLQQCKKESIRSNKSGDSLKTLASAPTTVTTGPTGHAKS 786
           TG+IRVFR+DISS +RKKVL  L   +K+ ++ N  G S+K   S  ++V     G    
Sbjct: 703 TGVIRVFRSDISSNVRKKVLNRLNAIEKQ-LKENGEG-SVKPRTSGVSSVAAATNGSL-- 758

Query: 787 SFHCPISRAKSSAAVNALALNQGMARAGSISRKT----KSSLPFKRASSCTNFNNLNFTI 842
                      S A   +          SI R T    + SLP    SS           
Sbjct: 759 -----------STATTFVGNGSNGHNVHSIERPTPFPMQDSLPLVDESS----------- 796

Query: 843 GSGSPRESVTSFDIDGEHVTNNPIKMGVRCDVCHGMRF---EAITKNVSGRPDKGYYCMD 899
                  S+T+           P      C+VC G RF   + ++ N + +  K YYC+D
Sbjct: 797 ------SSLTTLQ------QQQPHSQSRVCNVCGGTRFATDQTLSFNQAPQNVK-YYCLD 843

Query: 900 CGTVLNNFR 908
           CG +  + R
Sbjct: 844 CGALYTSLR 852

 Score = 87.0 bits (214), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 61/114 (53%), Gaps = 12/114 (10%)

Query: 101 IDQDQFEKYLMEPTYIKILKRRKNLKMFRRLFLAQELKAFDDENKINAFTNQINGLQXXX 160
           +  + F+++L    ++K+ +++K  K FRRL LAQEL+ F +E             Q   
Sbjct: 64  VGNEDFKRHLKTGEHMKVYRKKKGFKQFRRLILAQELRPFGNE------------FQDSS 111

Query: 161 XXXXXXXXXXXXXXDRAIWITKFSLDGKFMASAGKSGIIRVWKVLNSPIERWEL 214
                           A+W  +FS DGKFMA+AGK  I+R+WKV++SP ER EL
Sbjct: 112 SSNEKGTATEPMKNGGAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLEL 165

>CAGL0K11638g complement(1123343..1125121) weakly similar to
           sp|Q03177 Saccharomyces cerevisiae YMR102c, hypothetical
           start
          Length = 592

 Score =  166 bits (421), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 96/258 (37%), Positives = 140/258 (54%), Gaps = 29/258 (11%)

Query: 312 YAPVFNP-------SCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWH-LERQTSLK 363
           YAP+FN        S  K+ +E    VLDL WS N+FL+ SS+D  V LW   +    + 
Sbjct: 133 YAPIFNELDIVSLNSDEKVHRE----VLDLSWSVNHFLLVSSVDSYVTLWTPFDGNRPIM 188

Query: 364 TFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDG 423
            F H D VT  +F   DDRFFISGCLDH VR WS+ +N + + F+C++ I  +T+SPG  
Sbjct: 189 RFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEPINVVTVSPGMS 248

Query: 424 KYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQERN--TASTKIHHGPRVTGLECF--- 478
            +T+VGTF GY++V  T GL+ +  FH+++  + + N    + KI    ++TG+E     
Sbjct: 249 HFTVVGTFGGYIYVFSTMGLKLIDKFHIINGRSIDGNLRNGADKI----KITGIEWIVTD 304

Query: 479 ----KYEPDN---SLRIVVTSSDSRIRIFDXXX-XXXXXXXXGFQSGASQHKACLATVKG 530
               + + DN   + RIVVTS D RIR+F             GF     +H+A L     
Sbjct: 305 NRLDEIQEDNEYSTARIVVTSGDERIRVFKLTEGGYHNLELKGFHCEQFRHRAQLCIWDD 364

Query: 531 QQVVLSSSDDHWVHGWKL 548
           +  +  SS+D W + W+L
Sbjct: 365 KPFIYCSSEDQWFYVWRL 382

 Score = 69.7 bits (169), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 62/130 (47%), Gaps = 37/130 (28%)

Query: 624 VIKNSDGISFHAHHAPVTTAIVAPSGTAKTLSLSNDFIYELSSEFA---MESRDFEMNTN 680
           ++++S   SFHAH  P+TT  +AP GT   ++ SNDFIYE +       +E RD EM+  
Sbjct: 487 ILRHSHTFSFHAHDHPITTVNIAPIGTIAAVTQSNDFIYEFTCRCYSNNVELRDVEMD-- 544

Query: 681 SDTHSVTTXXXXXXXXXXXXXXXATLVPPSISAVDLIGSIIVTTDNTGIIRVFRADISST 740
                                           + D+IG I+VTTD+ G +RVFR D+S  
Sbjct: 545 --------------------------------SCDIIGPIVVTTDSVGKLRVFRTDLSDI 572

Query: 741 IRKKVLCTLQ 750
            R+ ++  L 
Sbjct: 573 ARETLINVLH 582

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 70/176 (39%), Gaps = 65/176 (36%)

Query: 38  ETSLSSVDNSKYSADIKPLQFKMNHVPGTRDRKHISYAAAAPSSSLRSNGSMKGQKYSYL 97
           E    SV +  YSAD++PL F        R R  I+                        
Sbjct: 3   EEDTESVRSGTYSADLQPLDFD------ARSRVQINDVT--------------------- 35

Query: 98  FNSIDQDQFEKYLMEPTYIKILKRRKNLKM--FRRLFLAQELKAFDDENKINAFTNQING 155
             + D DQFEKYL+ P Y+K+LK++ +  +  F+RLFLAQEL              Q+ G
Sbjct: 36  --NFDHDQFEKYLVRPDYVKLLKKQADCDILPFKRLFLAQEL--------------QLGG 79

Query: 156 LQXXXXXXXXXXXXXXXXXDRAIWITKFSLDGKFMASAGKSGIIRVWKVLNSPIER 211
                                ++ +++FS DG       K G + V KVL +  E+
Sbjct: 80  --------------------SSVTVSRFSKDGTLFCVGCKDGSLMVLKVLQTKSEK 115

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 43/60 (71%), Gaps = 2/60 (3%)

Query: 341 FLITSSMDRTVKLWHLERQTSL-KTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           +++T S D TVKLW+ E   SL +TF+ H+ FV CV F+P D   F SGCLDHKV++WS+
Sbjct: 111 YILTGSDDLTVKLWNWENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSL 170

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWS 397
           ++ITSS D TVK++  + ++ + T + H   V+   FHPT     ISG  D  V+LW+
Sbjct: 200 YMITSSDDTTVKIFDYQTKSCVATLEGHMSNVSFAVFHPT-LPIIISGSEDGTVKLWN 256

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 66.6 bits (161), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 54/98 (55%), Gaps = 2/98 (2%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
           FL T + DR +++W +E +  +   Q H+  +  + + P+ D+  +SG  D  VR+W + 
Sbjct: 457 FLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKL-VSGSGDRTVRIWDLR 515

Query: 400 ENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHV 437
             + +     +D +T++ +SPGDGKY   G+ +  V V
Sbjct: 516 TGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRV 553

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (45%), Gaps = 4/120 (3%)

Query: 315 VFNPSCFKIFKEHTADVLDLDW-SKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTC 373
           + N     I + H  D+  LD+    + L++ S DRTV++W L       T   +D VT 
Sbjct: 472 IENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTT 531

Query: 374 VRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNG 433
           V   P D ++  +G LD  VR+W   ++E  F  +  D          D  Y++V T +G
Sbjct: 532 VAVSPGDGKYIAAGSLDRAVRVW---DSETGFLVERLDSENESGTGHKDSVYSVVFTRDG 588

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 14/68 (20%)

Query: 342 LITSSMDRTVKLWHLERQTS-------------LKTFQHQDFVTCVRFHPTDDRFFISGC 388
           +++ S+DR+VKLW+L+   +             +    H+DFV  V     +D + +SG 
Sbjct: 591 VVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATT-QNDEYILSGS 649

Query: 389 LDHKVRLW 396
            D  V  W
Sbjct: 650 KDRGVLFW 657

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 183 FSLDGKFMASAGKSGIIRVWKVLNSPI 209
           FS DGKF+A+  +  +IR+W + N  I
Sbjct: 451 FSPDGKFLATGAEDRLIRIWDIENRKI 477

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 53/100 (53%), Gaps = 2/100 (2%)

Query: 339 NNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWS 397
             +L T + D+ +++W L  +  L T Q H+  +  + + P  D+  +SG  D  VR+W 
Sbjct: 364 GKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKL-VSGSGDRTVRIWD 422

Query: 398 ILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHV 437
           +   + +     +D +T++ +SPGDGKY   G+ +  V V
Sbjct: 423 LRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRV 462

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 54/111 (48%), Gaps = 4/111 (3%)

Query: 324 FKEHTADVLDLDW-SKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDR 382
            + H  D+  LD+    + L++ S DRTV++W L       T   +D VT V   P D +
Sbjct: 390 LQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK 449

Query: 383 FFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNG 433
           +  +G LD  VR+W   ++E  F  +  D    L+    D  Y++V T +G
Sbjct: 450 YIAAGSLDRTVRVW---DSETGFLVERLDSENELSTGHKDSVYSVVFTRDG 497

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 11/69 (15%)

Query: 339 NNFLITSSMDRTVKLW---------HLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCL 389
             ++   S+DRTV++W          L+ +  L T  H+D V  V F   D +  ISG L
Sbjct: 448 GKYIAAGSLDRTVRVWDSETGFLVERLDSENELST-GHKDSVYSVVFT-RDGQGVISGSL 505

Query: 390 DHKVRLWSI 398
           D  V+LW +
Sbjct: 506 DRSVKLWDL 514

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 9/63 (14%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ--------HQDFVTCVRFHPTDDRFFISGCLDHKV 393
           +I+ S+DR+VKLW L      K+          H+DFV  V     DD + +SG  D  V
Sbjct: 500 VISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATT-QDDEYILSGSKDRGV 558

Query: 394 RLW 396
             W
Sbjct: 559 LFW 561

>Kwal_23.6429
          Length = 750

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 53/98 (54%), Gaps = 2/98 (2%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
           FL T + D+ +++W L  +  + T Q H+  +  + + P+ D+  +SG  D  VR+W + 
Sbjct: 484 FLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKL-VSGSGDRTVRIWDLR 542

Query: 400 ENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHV 437
             + +     +D +T++ +SPGDGK    G+ +  V +
Sbjct: 543 TGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRI 580

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 53/112 (47%), Gaps = 4/112 (3%)

Query: 324 FKEHTADVLDLDW-SKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDR 382
            + H  D+  LD+    + L++ S DRTV++W L       T   +D VT V   P D +
Sbjct: 508 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK 567

Query: 383 FFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGY 434
              +G LD  VR+W   ++E  F  +  D    L     D  Y++V T +G+
Sbjct: 568 LIAAGSLDRTVRIW---DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGH 616

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 11/67 (16%)

Query: 341 FLITSSMDRTVKLW---------HLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDH 391
            +   S+DRTV++W          L+ +  L T  H+D V  V F   D    +SG LD 
Sbjct: 568 LIAAGSLDRTVRIWDSETGFLVERLDSENELGT-GHKDSVYSVVFT-RDGHGVVSGSLDR 625

Query: 392 KVRLWSI 398
            V+LW++
Sbjct: 626 SVKLWNL 632

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 16/69 (23%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ--------------HQDFVTCVRFHPTDDRFFISG 387
           +++ S+DR+VKLW+L R  +  T +              H+DFV  V     +D F +SG
Sbjct: 618 VVSGSLDRSVKLWNL-RSANGGTAEGKANTAASEVTYTGHKDFVLSVATT-QNDEFILSG 675

Query: 388 CLDHKVRLW 396
             D  V  W
Sbjct: 676 SKDRGVLFW 684

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 41/60 (68%), Gaps = 2/60 (3%)

Query: 341 FLITSSMDRTVKLWHLERQTSL-KTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           ++++ S D TVKLW+ E   +L +TF+ H+ FV CV F+P D   F SGCLD  V++WS+
Sbjct: 111 YVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSL 170

 Score = 37.7 bits (86), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWS 397
           ++IT+S D T+K+W  + ++ + T + H   V+   FHPT     ISG  D  +++W+
Sbjct: 200 YMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPT-LPIIISGSEDGTLKIWN 256

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 55/112 (49%), Gaps = 4/112 (3%)

Query: 323 IFKEHTADVLDLDW-SKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDD 381
           + K H  D+  LD+    + L++ S DRTV++W L+      T   +D VT V   P D 
Sbjct: 592 VLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDG 651

Query: 382 RFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNG 433
           +F  +G LD  VR+W   +++  F  +  D    L     D  Y++V T +G
Sbjct: 652 KFIAAGSLDRAVRVW---DSDTGFLVERLDSENELGTGHKDSVYSVVFTRDG 700

 Score = 36.6 bits (83), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 14/70 (20%)

Query: 340 NFLITSSMDRTVKLWHLE---------RQTS----LKTFQHQDFVTCVRFHPTDDRFFIS 386
           N +++ S+DR+VKLW+L          + TS    +    H+DFV  V     DD + +S
Sbjct: 701 NGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATT-EDDEYILS 759

Query: 387 GCLDHKVRLW 396
           G  D  V  W
Sbjct: 760 GSKDRGVLFW 769

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 54/98 (55%), Gaps = 2/98 (2%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
           FL T + D+ +++W LE +  + T + H+  +  + + P+ ++  +SG  D  VR+W + 
Sbjct: 420 FLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKL-VSGSGDRTVRIWDLT 478

Query: 400 ENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHV 437
               +     +D +T++ +SPG+GK+   G+ +  V V
Sbjct: 479 TGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRV 516

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 54/111 (48%), Gaps = 4/111 (3%)

Query: 324 FKEHTADVLDLDW-SKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDR 382
            K H  D+  LD+    N L++ S DRTV++W L   T   T   +D VT V   P + +
Sbjct: 444 LKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGK 503

Query: 383 FFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNG 433
           F  +G LD  VR+W   +++  F  +  D    L     D  Y++V T +G
Sbjct: 504 FIAAGSLDRTVRVW---DSDTGFLVERLDSENELGTGHRDSVYSVVFTRDG 551

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 11/70 (15%)

Query: 338 KNNFLITSSMDRTVKLW---------HLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGC 388
           +  F+   S+DRTV++W          L+ +  L T  H+D V  V F   D +  +SG 
Sbjct: 501 EGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGT-GHRDSVYSVVF-TRDGKGVVSGS 558

Query: 389 LDHKVRLWSI 398
           LD  V+LW++
Sbjct: 559 LDRSVKLWNL 568

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 9/63 (14%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ--------HQDFVTCVRFHPTDDRFFISGCLDHKV 393
           +++ S+DR+VKLW+L   +  K+          H+DFV  V     +D + +SG  D  V
Sbjct: 554 VVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVAT-TQNDEYILSGSKDRGV 612

Query: 394 RLW 396
             W
Sbjct: 613 LFW 615

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 39/60 (65%), Gaps = 2/60 (3%)

Query: 341 FLITSSMDRTVKLWHLERQTSLK-TFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           F++T S D T+KLW+ E+    + TF  H+ FV  V F+P D   F SGCLDH +++WSI
Sbjct: 111 FVLTGSDDLTIKLWNWEKNWGCQQTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSI 170

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWS 397
           +LIT+S D T+K+W  + ++++ T + H   V+   FHPT     ISG  D  +++W+
Sbjct: 200 YLITTSDDGTIKVWDYQTKSNVATLEGHMANVSYAVFHPT-LPIIISGSEDGTLKIWN 256

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 59/129 (45%), Gaps = 20/129 (15%)

Query: 318 PSCFKIFKEHTADVLDLDWSK-NNFLITS-SMDRTVKLWHLERQTSLKTF---------- 365
           P    +F+ HTA VLD D+S  N+ ++ S S D  + +W +     L  +          
Sbjct: 83  PDQVPLFRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDL 142

Query: 366 -------QHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTL 418
                   H   V  + FHP  +    S  LD+ V++W I + E+ F     D++TS++ 
Sbjct: 143 KPVRMLSGHSRKVGHLLFHPLAENILASSSLDYTVKIWDISQEEVKFTLKHPDMVTSMSF 202

Query: 419 SPGDGKYTI 427
           S  DGK+ +
Sbjct: 203 S-YDGKHLV 210

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 350 TVKLWHLERQTSL-KTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           T+KLW+ E+  +L +TF+ H+ FV CV F+P D   F S CLDH V++WS+
Sbjct: 2   TIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSL 52

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWS 397
           +LITSS DR+VK+W  + ++ + T + H   V+   FHP+     ISG  D  V++W+
Sbjct: 82  YLITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAIFHPS-LPIIISGSEDGTVKIWN 138

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 53/136 (38%), Gaps = 19/136 (13%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILE 400
           +I+ S D TVK+W+       KT     +   CV  HPT  R +++   D+   + S+  
Sbjct: 125 IISGSEDGTVKIWNANTYKLEKTLNLGLERSWCVAAHPTGKRNYVASGFDNGFNVLSMGN 184

Query: 401 NEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGY---VHVLLTKGLEQVSSFHVVDKNTQ 457
           +E             L+L P  GK    G  N     V   + +G EQV     +   T+
Sbjct: 185 DE-----------PRLSLDPV-GKLVWCGGKNAVATDVFTAVIRGTEQVEDGETIPLQTK 232

Query: 458 ERNTAST---KIHHGP 470
           E  T       + H P
Sbjct: 233 ELGTVDVYPQSLKHSP 248

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 340 NFLITSSMDRTVKLWHLERQTSLKTFQHQDF--VTCVRFHPTDDR-FFISGCLDHKVRLW 396
           N   ++ +D TVK+W L +Q+   T    +   V  V ++P  D+ + I+   D  V++W
Sbjct: 36  NTFASACLDHTVKIWSLGQQSPNFTMTAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIW 95

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 42/60 (70%), Gaps = 2/60 (3%)

Query: 341 FLITSSMDRTVKLWHLERQTSL-KTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           +++++S D TVKLW+ E+  +L +TF+ H+ FV  V F+P D   F + CLDH V++WS+
Sbjct: 111 YVLSASDDLTVKLWNWEKNWALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSL 170

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWS 397
           +LITSS DRTVK+W  + ++ + T + H   V+   +HP      ISG  D  V++W+
Sbjct: 200 YLITSSDDRTVKVWDYQTKSCVATLEGHLSNVSYAVYHPMLP-IIISGSEDGTVKIWN 256

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 34/72 (47%), Gaps = 9/72 (12%)

Query: 342 LITSSMDRTVKLWH-----LERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLW 396
           +I+ S D TVK+W+     LER  +L   +      CV  HPT  R FI+   D+   + 
Sbjct: 243 IISGSEDGTVKIWNSNTYKLERTLNLGLERSW----CVAAHPTGKRNFIAAGFDNGFTVL 298

Query: 397 SILENEITFEFD 408
           +I  +E     D
Sbjct: 299 AIGNDEPRLSLD 310

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 55/111 (49%), Gaps = 6/111 (5%)

Query: 300 DQKISSTNELNLYAPVFN---PSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHL 356
           DQK+  T  L+    V+N    +C   ++ H   VL +D S    +++ S D+TVK+WH+
Sbjct: 309 DQKLI-TGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD-SFRKLIVSGSADKTVKVWHV 366

Query: 357 ERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEF 407
           E +T      H  +V CV+ HP     F SG  D  +R+W I  N     F
Sbjct: 367 ESRTCYTLRGHTGWVNCVKLHPKSFTCF-SGSDDMTIRMWDIRTNTCVRVF 416

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 76/180 (42%), Gaps = 30/180 (16%)

Query: 324 FKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDR 382
           FK H   VL L  + N  L+T S D TV +W L     ++    H D V  +RF   DD+
Sbjct: 255 FKGHMDGVLSLQLT-NKLLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF---DDQ 310

Query: 383 FFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKG 442
             I+G LD  +R+W              + +T   +S   G    V + + +  ++++  
Sbjct: 311 KLITGSLDKTIRVW--------------NYVTGACVSTYRGHQDSVLSVDSFRKLIVSGS 356

Query: 443 LEQ-VSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFD 501
            ++ V  +HV     + R   + + H G     + C K  P  S      S D  IR++D
Sbjct: 357 ADKTVKVWHV-----ESRTCYTLRGHTG----WVNCVKLHP-KSFTCFSGSDDMTIRMWD 406

>Scas_704.40
          Length = 608

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 2/82 (2%)

Query: 320 CFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPT 379
           C   ++ HT  V+ +D  K   +++ S D+TVK+WH+E +T      H ++V CV+ HP 
Sbjct: 325 CISTYRGHTDSVMSVDAFKK-IIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPK 383

Query: 380 DDRFFISGCLDHKVRLWSILEN 401
               F SG  D  +R+W I  N
Sbjct: 384 SFTCF-SGSDDTTIRMWDIRTN 404

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 342 LITSSMDRTVKLWHLERQTSLKT-FQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILE 400
           L++ S+D T+KLW ++    ++T F H + V  +     D+   ISG  D  +++W +  
Sbjct: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI---AADNFRIISGSHDGSIKIWDLQS 536

Query: 401 NEITFEF 407
            +    F
Sbjct: 537 GKCMHTF 543

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 57/113 (50%), Gaps = 8/113 (7%)

Query: 293 AQTLEKLDQKISSTNELNLYAPVFN---PSCFKIFKEHTADVLDLDWSKNNFLITSSMDR 349
            +TL   DQK+  T  L+    V+N     C   ++ HT  V+ +D S    +++ S D+
Sbjct: 377 VKTLYFDDQKLI-TGSLDKTIRVWNYITGECISTYRGHTDSVMSVD-SHKKIIVSGSADK 434

Query: 350 TVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDH-KVRLWSILEN 401
           TVK+WH+E +T      H ++V CV+ HP    F    C D   +R+W I  N
Sbjct: 435 TVKVWHVESRTCYTLKGHTEWVNCVKLHPKS--FSCYSCSDDTTIRMWDIRTN 485

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 74/180 (41%), Gaps = 30/180 (16%)

Query: 324 FKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDR 382
           FK H   VL L ++    L T S D TV +W L     ++    H D V  + F   DD+
Sbjct: 330 FKGHMDGVLTLQFNYR-LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF---DDQ 385

Query: 383 FFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKG 442
             I+G LD  +R+W              + IT   +S   G    V + + +  ++++  
Sbjct: 386 KLITGSLDKTIRVW--------------NYITGECISTYRGHTDSVMSVDSHKKIIVSGS 431

Query: 443 LEQ-VSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFD 501
            ++ V  +HV     + R   + K H       + C K  P  S      S D+ IR++D
Sbjct: 432 ADKTVKVWHV-----ESRTCYTLKGH----TEWVNCVKLHP-KSFSCYSCSDDTTIRMWD 481

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 53/127 (41%), Gaps = 20/127 (15%)

Query: 318 PSCFKIFKEHTADVLDLDWSK--NNFLITSSMDRTVKLWHLERQTSLKTFQ--------- 366
           P    +F+ HTA VLD D+       L++ S D  + +W +    S    Q         
Sbjct: 71  PDQIPLFRGHTAQVLDTDFDPFDERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVEHV 130

Query: 367 --------HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTL 418
                   HQ  V  V +HPT      S  LDH VRLW++ +          D++TS++ 
Sbjct: 131 APVKFLTGHQRKVGHVLYHPTAQGVLASSSLDHTVRLWNVEQGTNPIVLTHPDMVTSMSF 190

Query: 419 SPGDGKY 425
           S G G Y
Sbjct: 191 SYG-GTY 196

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILEN 401
           L +SS+D TV+LW++E+ T+     H D VT + F      +  + C D  +R+W I + 
Sbjct: 156 LASSSLDHTVRLWNVEQGTNPIVLTHPDMVTSMSFS-YGGTYLATVCRDKMLRVWDIRKG 214

Query: 402 EITFE 406
           E+  E
Sbjct: 215 EVVSE 219

>Scas_629.12
          Length = 671

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 54/114 (47%), Gaps = 8/114 (7%)

Query: 323 IFKEHTADVLDLDWSKNNF-LITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDD 381
           + K H  DV  LD+  N   L++ S DRTV++W L       T   +  VT V   P D 
Sbjct: 424 VLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEYGVTTVAVSPNDG 483

Query: 382 RFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPG--DGKYTIVGTFNG 433
           +F  +G LD  VR+W     + T  F  + L +   L  G  D  Y++V T +G
Sbjct: 484 KFIAAGSLDRAVRVW-----DSTTGFLVERLDSENELGTGHRDSVYSVVFTRDG 532

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 51/98 (52%), Gaps = 2/98 (2%)

Query: 341 FLITSSMDRTVKLWHL-ERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
           FL T + D+ +++W + ER+  +    H+  V  + + P  ++  +SG  D  VR+W + 
Sbjct: 401 FLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKL-VSGSGDRTVRIWDLR 459

Query: 400 ENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHV 437
             + +     +  +T++ +SP DGK+   G+ +  V V
Sbjct: 460 TGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRV 497

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 11/67 (16%)

Query: 341 FLITSSMDRTVKLW---------HLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDH 391
           F+   S+DR V++W          L+ +  L T  H+D V  V F   D    +SG LD 
Sbjct: 485 FIAAGSLDRAVRVWDSTTGFLVERLDSENELGT-GHRDSVYSVVFT-RDGNEVVSGSLDK 542

Query: 392 KVRLWSI 398
            V+LW++
Sbjct: 543 TVKLWNM 549

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 17/73 (23%)

Query: 340 NFLITSSMDRTVKLWHL-----------ERQTSLKTFQ-----HQDFVTCVRFHPTDDRF 383
           N +++ S+D+TVKLW++           ++ ++  T +     H+DFV  V     DD++
Sbjct: 533 NEVVSGSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTS-QDDKY 591

Query: 384 FISGCLDHKVRLW 396
            +SG  D  +  W
Sbjct: 592 ILSGSKDRGILFW 604

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 2/82 (2%)

Query: 320 CFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPT 379
           C   ++ H+  VL +D S    +++ S D+TVK+WH+E +T      H ++V CV+ HP 
Sbjct: 374 CISTYRGHSDSVLSVD-SYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPK 432

Query: 380 DDRFFISGCLDHKVRLWSILEN 401
               F S   D  +R+W I  N
Sbjct: 433 SFSCF-SCSDDTTIRMWDIRTN 453

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 73/180 (40%), Gaps = 30/180 (16%)

Query: 324 FKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDR 382
           FK H   VL L ++    L T S D T+ +W L     ++    H D V  + F   DDR
Sbjct: 298 FKGHMDGVLTLQFNYR-LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF---DDR 353

Query: 383 FFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKG 442
             I+G LD  +R+W              + IT   +S   G    V + + Y  V+++  
Sbjct: 354 KLITGSLDKTIRVW--------------NYITGECISTYRGHSDSVLSVDSYQKVIVSGS 399

Query: 443 LEQ-VSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFD 501
            ++ V  +HV      E  T  T   H   V    C K  P  S      S D+ IR++D
Sbjct: 400 ADKTVKVWHV------ESRTCYTLRGHTEWV---NCVKLHP-KSFSCFSCSDDTTIRMWD 449

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 57/120 (47%), Gaps = 18/120 (15%)

Query: 318 PSCFKIFKEHTADVLDLDWSK--NNFLITSSMDRTVKLWHLERQTSL---------KTFQ 366
           P    +F+ HTA VLD D+    +N + +SS D  + +W + +  S+         K  +
Sbjct: 71  PDQVPLFRGHTAQVLDTDFDPFDDNRVASSSDDGKIGIWDIPQDYSILKSGDNEEIKDIE 130

Query: 367 HQDFVTC-------VRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLS 419
              F+T        + +HPT      S  LD+ VR+W++   E  ++    D++TS++ S
Sbjct: 131 PTKFLTGHSRKVGHILYHPTAKDVLASSSLDYTVRIWNVETGEDIYKLKHPDMVTSMSFS 190

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 340 NFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
           + L +SS+D TV++W++E    +   +H D VT + F   D     +   D K+R+W++ 
Sbjct: 153 DVLASSSLDYTVRIWNVETGEDIYKLKHPDMVTSMSFS-YDGTHLATVARDKKLRVWNVR 211

Query: 400 ENEITFE 406
           E ++  E
Sbjct: 212 EEKVVSE 218

>Scas_571.4
          Length = 601

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 84/208 (40%), Gaps = 45/208 (21%)

Query: 318 PSCFKIFKEHTADVLDLDWSK-NNFLITS-SMDRTVKLWHLERQTSLKTFQ--------- 366
           P    +F+ H   VLD D+   N+F I S S D  + +W++    S++T++         
Sbjct: 79  PDHVSLFRGHKGQVLDTDFDPFNDFKIASASDDGKIGIWNIPMNYSMRTYRDSENKPMDI 138

Query: 367 --------HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTL 418
                   H   V  V FHP       S  LD  V++W+I + ++       D++T++  
Sbjct: 139 RPSKILSGHTRKVGHVLFHPRIRNVLASSSLDFTVKIWNIKKGKVIGTLQHSDMVTAMAF 198

Query: 419 SPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECF 478
            P DG Y    T N  + +        ++S  +V         + TK H GP+   +   
Sbjct: 199 DP-DGAYLATITRNKKLTIW------DIASKQIV---------SQTKSHQGPKNQRVVWL 242

Query: 479 KYEPDNSLRIVVT-----SSDSRIRIFD 501
            Y      RI+ T     S D  I I+D
Sbjct: 243 GYS-----RIIATTGFSKSMDREIGIWD 265

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 72/167 (43%), Gaps = 21/167 (12%)

Query: 340 NFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
           N L +SS+D TVK+W++++   + T QH D VT + F P D  +  +   + K+ +W I 
Sbjct: 162 NVLASSSLDFTVKIWNIKKGKVIGTLQHSDMVTAMAFDP-DGAYLATITRNKKLTIWDIA 220

Query: 400 ENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGL-----EQVSSFHVVDK 454
             +I  +       T     P + +   +    GY  ++ T G       ++  +  +D 
Sbjct: 221 SKQIVSQ-------TKSHQGPKNQRVVWL----GYSRIIATTGFSKSMDREIGIWDALDL 269

Query: 455 NTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFD 501
                N    K +   + +G+    Y+  N +  VV   D  IR F+
Sbjct: 270 KEGTIN----KFYKIDQSSGILMPFYDLTNRILYVVGKGDGNIRCFE 312

>Scas_719.52
          Length = 628

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 52/123 (42%), Gaps = 19/123 (15%)

Query: 318 PSCFKIFKEHTADVLDLDWSKNN--FLITSSMDRTVKLWHLERQTSLKTF---------- 365
           P    +F+ HTA VLD D+   N   + +SS D  + +W +    S + +          
Sbjct: 71  PDQVPLFRGHTAQVLDTDFDPFNDHIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNI 130

Query: 366 -------QHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTL 418
                   H   V  V FHP  +    S  LD+ V+LW+I   E        D++TS++ 
Sbjct: 131 KPVKFLSGHSRKVGHVLFHPVAENVLASSSLDYTVKLWNIETGEAVITLKHPDMVTSMSF 190

Query: 419 SPG 421
           S G
Sbjct: 191 SYG 193

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 340 NFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
           N L +SS+D TVKLW++E   ++ T +H D VT + F         + C D K+R+W I 
Sbjct: 154 NVLASSSLDYTVKLWNIETGEAVITLKHPDMVTSMSFS-YGGNHLATVCRDKKLRVWDIR 212

Query: 400 ENEITFE 406
           E +I  E
Sbjct: 213 EGKIVSE 219

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 45/83 (54%), Gaps = 2/83 (2%)

Query: 319 SCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHP 378
           SC   ++ H   VL +D S    ++++S D+TVK+WH+E +T      H ++V CV+ HP
Sbjct: 383 SCISTYRGHQDSVLSVD-SYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHP 441

Query: 379 TDDRFFISGCLDHKVRLWSILEN 401
                + S   D  +R+W I  N
Sbjct: 442 KSFTCY-SSSDDKTLRMWDIRTN 463

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 81/194 (41%), Gaps = 34/194 (17%)

Query: 317 NPSC-FKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCV 374
           N  C  ++FK H   VL L ++ +  L T S D TV +W  +    ++    H D V  +
Sbjct: 300 NGRCRIQLFKGHMDGVLSLKFN-HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI 358

Query: 375 RFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGY 434
            F   DD+  I+  LD  +R+W              + IT   +S   G    V + + Y
Sbjct: 359 YF---DDQKMITASLDKTIRVW--------------NYITGSCISTYRGHQDSVLSVDSY 401

Query: 435 VHVLLTKGLEQ-VSSFHVVDKNTQERNTASTKIHHGPRVTGLE-------CFKYEPDNSL 486
             ++++   ++ V  +HV      E  T  T   H   V  ++       C+    D +L
Sbjct: 402 KKIIVSASADKTVKVWHV------ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTL 455

Query: 487 RIVVTSSDSRIRIF 500
           R+    ++S I++F
Sbjct: 456 RMWDIRTNSCIKVF 469

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 7/79 (8%)

Query: 320 CFKIFKEHTADVLDLDWSKNNFLITS-SMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFH 377
           C +    H   V D+  + +NF I S S D+++K+W L+    ++TF  H+  + CV   
Sbjct: 545 CIRTQFGHVEGVWDI--AADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV--- 599

Query: 378 PTDDRFFISGCLDHKVRLW 396
              D  F+SG    +V++W
Sbjct: 600 GIGDSSFVSGDELGEVKMW 618

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 4/85 (4%)

Query: 315 VFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKT-FQHQDFVTC 373
           V NP   + F +    + D +      L++ S+D T+KLW +     ++T F H + V  
Sbjct: 499 VPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWD 558

Query: 374 VRFHPTDDRFFISGCLDHKVRLWSI 398
           +     D+   +SG  D  +++W +
Sbjct: 559 I---AADNFRIVSGSHDKSIKVWDL 580

>Kwal_23.5769
          Length = 627

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 85/210 (40%), Gaps = 39/210 (18%)

Query: 319 SCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHP 378
           +C   +  H+  VL +D S    +++ S D+TVK+WH+E +T      H ++V  V+ HP
Sbjct: 388 ACVAAYPGHSDSVLSVD-SYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHP 446

Query: 379 TDDRFFISGCLDHKVRLWSILENEITFEF----------------DCQDLITSLT----- 417
                F SG  D  +R+W I  N     F                D ++L+T  T     
Sbjct: 447 KSFTCF-SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPR 505

Query: 418 ------LSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPR 471
                   P DG+ + +     Y   LL+  L+       V      R     + H G  
Sbjct: 506 NEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEV------RTGKCVRTHFG-H 558

Query: 472 VTGLECFKYEPDNSLRIVVTSSDSRIRIFD 501
           V G+  +    DN  RIV  + D  ++++D
Sbjct: 559 VEGI--WDIAADN-FRIVSGAHDKTVKVWD 585

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 77/184 (41%), Gaps = 29/184 (15%)

Query: 324 FKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDR 382
           FK H   VL L ++    L T S D TV +W L     ++    H+D V  + F   D +
Sbjct: 313 FKGHMDGVLSLQFN-YRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF---DGQ 368

Query: 383 FFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKG 442
             I+G LD  +R+W              + +T   ++   G    V + + Y  ++++  
Sbjct: 369 KLITGSLDRMIRVW--------------NYVTGACVAAYPGHSDSVLSVDSYKKIIVSGS 414

Query: 443 LEQ-VSSFHVVDKNT-----QERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSR 496
            ++ V  +HV  +             + K+H  P+     CF    D ++R+    S++ 
Sbjct: 415 ADKTVKVWHVESRTCYTLRGHTEWVGTVKLH--PK--SFTCFSGSDDTTIRMWDIRSNTC 470

Query: 497 IRIF 500
           +++F
Sbjct: 471 VKVF 474

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 41/83 (49%), Gaps = 8/83 (9%)

Query: 307 NELNLYAPVFNPSCFKIFKEHTADVLDLDWSKNNFLITS-SMDRTVKLWHLERQTSLKTF 365
           N + L+  V    C +    H   + D+  + +NF I S + D+TVK+W L+    + TF
Sbjct: 539 NTIKLWE-VRTGKCVRTHFGHVEGIWDI--AADNFRIVSGAHDKTVKVWDLQSGKCIHTF 595

Query: 366 Q-HQDFVTCVRFHPTDDRFFISG 387
             HQ  +TCV      D  F+SG
Sbjct: 596 DSHQAPITCVGI---GDSEFVSG 615

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 2/67 (2%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILEN 401
           L++ S+D T+KLW +     ++T  H   V  +     D+   +SG  D  V++W +   
Sbjct: 532 LLSCSLDNTIKLWEVRTGKCVRT--HFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSG 589

Query: 402 EITFEFD 408
           +    FD
Sbjct: 590 KCIHTFD 596

>Scas_630.6
          Length = 621

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 52/98 (53%), Gaps = 2/98 (2%)

Query: 341 FLITSSMDRTVKLWHL-ERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
           FL T + D+ +++W++ ER+  +    H+  +  + + P D +  +SG  D  +R+W + 
Sbjct: 355 FLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFP-DGQKLVSGSGDRSIRIWDLK 413

Query: 400 ENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHV 437
             + +     +D +T++ +SP +GK    G+ +  V +
Sbjct: 414 TGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRI 451

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 56/124 (45%), Gaps = 10/124 (8%)

Query: 323 IFKEHTADVLDLDW-SKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDD 381
           + K H  D+  LD+      L++ S DR++++W L+      T   +D VT V   P + 
Sbjct: 378 VLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLTLSIEDGVTTVAVSPNEG 437

Query: 382 RFFISGCLDHKVRLWSILENEITFEFDC--------QDLITSLTLSPGDGKYTIVGTFNG 433
           +   +G LD  VR+W      +    D         QD + S+  +  DG++ + G+ + 
Sbjct: 438 KLIAAGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAFT-KDGQHVVSGSLDR 496

Query: 434 YVHV 437
            V +
Sbjct: 497 TVKL 500

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 7/61 (11%)

Query: 342 LITSSMDRTVKLWHLERQTS------LKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRL 395
           +++ S+DRTVKLW+L    S      +    H+DFV  V     DD++  SG  D  V +
Sbjct: 489 VVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATS-NDDKYIFSGSKDRGVII 547

Query: 396 W 396
           W
Sbjct: 548 W 548

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 49/105 (46%), Gaps = 18/105 (17%)

Query: 341 FLITSSMDRTVKLWH------LERQTSLKTFQ--HQDFVTCVRFHPTDDRFFISGCLDHK 392
            +   S+DR+V++W       +ER  S       HQD V  V F   D +  +SG LD  
Sbjct: 439 LIAAGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAFT-KDGQHVVSGSLDRT 497

Query: 393 VRLWSILEN-------EITFEFDCQDLITSLTLSPGDGKYTIVGT 430
           V+LW++ +        E+T+    +D + S+  S  D KY   G+
Sbjct: 498 VKLWNLGDTQSGTGKCEVTY-IGHKDFVLSVATS-NDDKYIFSGS 540

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           ++I++S D+T+++W+ + +  +     H  FV C +FHPTDD   +S  LD  +R+W I
Sbjct: 109 WIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDD-LIVSASLDETIRIWDI 166

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 97/241 (40%), Gaps = 36/241 (14%)

Query: 317 NPSCFKIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVR 375
           NP+    F+ H  +V  + + ++N ++++SS D T+K+W +   +  + ++H   V  V 
Sbjct: 64  NPNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVV 123

Query: 376 FHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLS-PGDGKYTIVGTFNGY 434
            HP      IS   D  +R+W + EN+ T +   +D     +LS   DG   + G   G 
Sbjct: 124 IHPNQGE-LISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIASDGSMLVAGNNKGN 182

Query: 435 VHVLL------TKGLEQVSSFHVVDK-------NTQERNTASTKIHHGPRVTGLE-CFKY 480
            +V           L+ V+ F    K       ++  ++ A+    H  RV  +E  FK 
Sbjct: 183 CYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDNFKL 242

Query: 481 EPD---------------NSLRIVVTSSDSRIRIFDXXXXXXXXXXXGFQSGASQHKACL 525
           E                 +S  +V   SD  +R++D           G   GA     C+
Sbjct: 243 ETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGA----VCV 298

Query: 526 A 526
           A
Sbjct: 299 A 299

>Scas_624.11
          Length = 1205

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           ++I++S D+T+++W+ + +  +     H  FV C +FHPTDD   +S  LD  +R+W I
Sbjct: 109 WIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDD-LVVSASLDETIRVWDI 166

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 68/162 (41%), Gaps = 22/162 (13%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
           +++ +    T++LW     T L  F+ H+  V  V FHPT    F+SG  D+ +++WS+ 
Sbjct: 25  WVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRSVDFHPTQP-IFVSGGDDYTIKVWSLE 83

Query: 400 ENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQER 459
            N+  +  +            G   Y     F+  +  +++   +Q         N Q R
Sbjct: 84  TNKCLYTLN------------GHLDYIRTVFFHKELPWIISASDDQTIRIW----NWQNR 127

Query: 460 NTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFD 501
              +    H   V    C ++ P + L +V  S D  IR++D
Sbjct: 128 KEIACLTGHNHFVM---CAQFHPTDDL-VVSASLDETIRVWD 165

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 10/64 (15%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ------HQDFVTCVRFHPTDDRFFISGCLDHKVR 394
            +++ S DR VKLW   +  S K ++      H + V CV FHPT  +F +S   D  +R
Sbjct: 223 MIVSGSDDRQVKLW---KYNSTKAWEVDTCRGHTNNVDCVIFHPT-QKFILSVGEDKTLR 278

Query: 395 LWSI 398
           +W +
Sbjct: 279 IWDL 282

>Kwal_0.212
          Length = 303

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 59/123 (47%), Gaps = 3/123 (2%)

Query: 317 NPSCFKIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVR 375
           NP+    F+ H  +V  + + + N ++++SS D T+K+W +   +  + ++HQ  V  V 
Sbjct: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVV 123

Query: 376 FHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLS-PGDGKYTIVGTFNGY 434
            HP      IS   D  VR+W + EN+   +   +D     +LS   DG   + G   G 
Sbjct: 124 IHPNQGE-LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182

Query: 435 VHV 437
            +V
Sbjct: 183 CYV 185

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 4/94 (4%)

Query: 317 NPSCFKIFKEHTADVLDLDWSKN-NFLITSSMDRTVKLWHLERQTSLKTF--QHQDFVTC 373
           NP     F+ H   +  +  S +   L T S D T ++W ++    L+T    HQ +V  
Sbjct: 196 NPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWD 255

Query: 374 VRFHPTDDRFFISGCLDHKVRLWSILENEITFEF 407
             F   D  + ++ C DH VRLW +   EI  ++
Sbjct: 256 CAF-SADSAYLVTACSDHYVRLWDLSTREIVRQY 288

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 340 NFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
           N L +SS D TVKLW++E    + T +H D VT + F   D  +  +   D K+R+W+I 
Sbjct: 154 NVLASSSGDYTVKLWNVETGKDMITLKHPDMVTSMSFS-YDGNYLATVARDKKLRVWNIR 212

Query: 400 ENEITFE 406
           E +I  E
Sbjct: 213 EEKIVSE 219

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 52/127 (40%), Gaps = 20/127 (15%)

Query: 318 PSCFKIFKEHTADVLDLDWSKNN--FLITSSMDRTVKLWHLERQTSLKTFQHQD------ 369
           P    +F+ HTA VLD D+   N   + + S D  + +W +           +D      
Sbjct: 71  PDQVPLFRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDI 130

Query: 370 ----FVTC-------VRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTL 418
               F+T        V +HP  +    S   D+ V+LW++   +        D++TS++ 
Sbjct: 131 KPVKFLTGHARKVGHVLYHPVAENVLASSSGDYTVKLWNVETGKDMITLKHPDMVTSMSF 190

Query: 419 SPGDGKY 425
           S  DG Y
Sbjct: 191 S-YDGNY 196

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 52/98 (53%), Gaps = 2/98 (2%)

Query: 341 FLITSSMDRTVKLWHL-ERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
           FL T + D+ +++W + +R+  +    H+  +  + +  + ++  +SG  D  +R+W + 
Sbjct: 387 FLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKL-VSGSGDRTIRIWDLH 445

Query: 400 ENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHV 437
             + +     +D +T++ +SPG+G Y   G+ +  V V
Sbjct: 446 TGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRV 483

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 323 IFKEHTADVLDLDW-SKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDD 381
           + + H  D+  LD+    N L++ S DRT+++W L       T   +D VT V   P + 
Sbjct: 410 VLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSLTLSIEDGVTTVAVSPGNG 469

Query: 382 RFFISGCLDHKVRLW 396
            +  +G LD  VR+W
Sbjct: 470 NYVAAGSLDRTVRVW 484

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 9/67 (13%)

Query: 340 NFLITSSMDRTVKLWH------LERQTSLKT--FQHQDFVTCVRFHPTDDRFFISGCLDH 391
           N++   S+DRTV++W       +ER  S       H+D V  V F   D +  +SG LD 
Sbjct: 470 NYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGVGHKDSVYSVVF-TRDGKNIVSGSLDR 528

Query: 392 KVRLWSI 398
            V+LW++
Sbjct: 529 SVKLWNL 535

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 15/69 (21%)

Query: 342 LITSSMDRTVKLWHL--------------ERQTSLKTFQHQDFVTCVRFHPTDDRFFISG 387
           +++ S+DR+VKLW+L              E    +    H+DFV  V     +D++ +SG
Sbjct: 521 IVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVT-TTENDQYILSG 579

Query: 388 CLDHKVRLW 396
             D  V  W
Sbjct: 580 SKDRGVIFW 588

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           ++I++S D+T+++W+ + +  +     H  FV C +FHPT+D   +S  LD  VR+W I
Sbjct: 109 WIISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTED-LVVSASLDETVRIWDI 166

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 69/181 (38%), Gaps = 22/181 (12%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
           +++ +    T++LW       L  F+ H+  V  V FHPT    F+S   D+ +++WS+ 
Sbjct: 25  WVLVALFSSTIQLWDYRMGVLLHRFEEHEGPVRGVDFHPTQP-LFVSAGDDYSIKVWSLS 83

Query: 400 ENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQER 459
            ++  F  +            G   Y     F+  +  +++   +Q         N Q R
Sbjct: 84  THKCLFTLN------------GHLDYVRTVFFHTELPWIISASDDQTIRIW----NWQNR 127

Query: 460 NTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFDXXXXXXXXXXXGFQSGAS 519
              +    H   V    C ++ P   L +V  S D  +RI+D           G QS   
Sbjct: 128 REIACLTGHNHFVM---CAQFHPTEDL-VVSASLDETVRIWDISGLRKRHSAPGSQSFEE 183

Query: 520 Q 520
           Q
Sbjct: 184 Q 184

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 18/100 (18%)

Query: 310 NLYAPVFNPSCFK-IFKEHTADVLDLDWSKNN----FLITSSMDRTVKLWHLERQTSLKT 364
           NL+   F     K I + HT  V   +W+  +     +++ S DR VKLW   R +S K 
Sbjct: 190 NLFDGGFGDCVVKFILEGHTRGV---NWASFHPTLPLIVSGSDDRQVKLW---RMSSTKA 243

Query: 365 FQ------HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           ++      H + V  V FHP  +   IS   D  +R+W +
Sbjct: 244 WEVDTCRGHTNNVDSVIFHPFQN-LIISVGEDSTIRVWDL 282

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 95/241 (39%), Gaps = 36/241 (14%)

Query: 317 NPSCFKIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVR 375
           NP+    F+ H  +V  + + + N ++++SS D T+K+W +   +  + ++H   V  V 
Sbjct: 64  NPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVNEVA 123

Query: 376 FHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLS-PGDGKYTIVGTFNGY 434
            HP      IS   D  +R+W + EN+ T +   +D     +LS   DG   + G   G 
Sbjct: 124 IHPNQGE-LISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVASDGSMLVAGNNKGN 182

Query: 435 VHVLL------TKGLEQVSSFHVVDK-------NTQERNTASTKIHHGPRVTGLE-CFKY 480
            +V           LE V+ F    K       +   ++ A+    H  RV  +E  F+ 
Sbjct: 183 CYVWKMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDNFEL 242

Query: 481 EPD---------------NSLRIVVTSSDSRIRIFDXXXXXXXXXXXGFQSGASQHKACL 525
           E                 +S  +V   SD  +R++D           G   GA     C+
Sbjct: 243 ETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTSEIVRQYGGHHKGA----VCV 298

Query: 526 A 526
           A
Sbjct: 299 A 299

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 97/241 (40%), Gaps = 36/241 (14%)

Query: 317 NPSCFKIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVR 375
           NP+    F+ H  +V  + + ++N ++++SS D T+K+W +   +  + ++H   V  V 
Sbjct: 64  NPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNYKHDAPVNEVV 123

Query: 376 FHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLS-PGDGKYTIVGTFNGY 434
            HP      IS   D  +++W + EN+ T +   +D     +LS   DG   + G   G 
Sbjct: 124 IHPNQGE-LISCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIASDGSMLVAGNNKGN 182

Query: 435 VHVLL------TKGLEQVSSFHVVDK-------NTQERNTASTKIHHGPRVTGLE-CFKY 480
            +V        T  L+ V+ F    K       +   ++ A+    H  RV  +E  F+ 
Sbjct: 183 CYVWKMPNHTDTASLKPVTKFRSHSKYITRVLLSVDVKHLATCSADHTARVWSVEDNFQL 242

Query: 481 EPD---------------NSLRIVVTSSDSRIRIFDXXXXXXXXXXXGFQSGASQHKACL 525
           E                 +S  +V   SD  +R++D           G   GA     C+
Sbjct: 243 ETTLDAHSRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGA----VCV 298

Query: 526 A 526
           A
Sbjct: 299 A 299

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           ++I+SS D+T+++W+ + +  +     H  FV C +FHP +D   +S  LD  VR+W I
Sbjct: 109 WIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVED-LVVSASLDETVRVWDI 166

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 70/183 (38%), Gaps = 22/183 (12%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
           +++ +    T++LW       L  F+ H+  V  + FHPT    F+S   D+ +++WS+ 
Sbjct: 25  WVLVALFSSTIQLWDYRMGVLLHRFEDHEGPVRGIDFHPTQP-LFVSAGDDYTIKVWSLE 83

Query: 400 ENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQER 459
            N+  F  D            G   Y     F+  +  +++   +Q         N Q R
Sbjct: 84  SNKCLFTLD------------GHLDYVRTVFFHHELPWIISSSDDQTIRIW----NWQNR 127

Query: 460 NTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFDXXXXXXXXXXXGFQSGAS 519
              +    H   V    C ++ P   L +V  S D  +R++D           G QS   
Sbjct: 128 KEIACLTGHNHFVM---CAQFHPVEDL-VVSASLDETVRVWDISGLRKRHSAPGTQSFEE 183

Query: 520 QHK 522
           Q +
Sbjct: 184 QMR 186

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 1/47 (2%)

Query: 338 KNNFLITSSMDRTVKLWHLERQTSLKTFQHQ-DFVTCVRFHPTDDRF 383
           + N +I+   D+TV++W L+++T +K F+ + D    VR HP  + F
Sbjct: 264 QQNLIISVGEDKTVRVWDLDKRTPIKQFKRENDRFWLVRAHPNLNLF 310

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 10/64 (15%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ------HQDFVTCVRFHPTDDRFFISGCLDHKVR 394
            +++ S DR VKLW   R ++ K ++      H + V  V FHP  +   IS   D  VR
Sbjct: 223 LIVSGSDDRQVKLW---RMSATKAWEVDTCRGHTNNVDSVIFHPQQN-LIISVGEDKTVR 278

Query: 395 LWSI 398
           +W +
Sbjct: 279 VWDL 282

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 94/241 (39%), Gaps = 36/241 (14%)

Query: 317 NPSCFKIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVR 375
           NP+    F+ H  +V  + + ++N +++TSS D T+K+W +   +  + ++H   V  V 
Sbjct: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVV 123

Query: 376 FHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLS-PGDGKYTIVGTFNGY 434
            HP      IS   D  +R+W + EN+ T +   +D  +  +LS   DG         G 
Sbjct: 124 IHPNQGE-LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGN 182

Query: 435 VHVLLTKGLEQVSSFHVVDK-------------NTQERNTASTKIHHGPRVTGL-ECFKY 480
            +V         S    V K             ++  ++ A+    H  RV  + + FK 
Sbjct: 183 CYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKL 242

Query: 481 EPD---------------NSLRIVVTSSDSRIRIFDXXXXXXXXXXXGFQSGASQHKACL 525
           E                 +S  +V  SSD  +R++D           G   GA     C+
Sbjct: 243 ETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGA----VCV 298

Query: 526 A 526
           A
Sbjct: 299 A 299

>Scas_695.15
          Length = 327

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 61/124 (49%), Gaps = 4/124 (3%)

Query: 317 NPSCFKIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVR 375
           NP+    F+ H  +V  + + ++N +++TSS D T+K+W +   +  + ++H   V  V 
Sbjct: 84  NPNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVV 143

Query: 376 FHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSL-TLS-PGDGKYTIVGTFNG 433
            HP      IS   D  +++W + EN+ T +    D  TSL +LS   DG   +     G
Sbjct: 144 IHPNQGE-LISCDRDGTIKIWDLGENQCTHQLIPDDDNTSLQSLSVASDGSMLVAANNKG 202

Query: 434 YVHV 437
             +V
Sbjct: 203 DCYV 206

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 6/71 (8%)

Query: 342 LITSSMDRTVKLWHL---ERQTSLKTF--QHQDFVTCVRFHPTDDRFFISGCLDHKVRLW 396
           + T S DRT K+W +   E   +L+T    HQ +V    F   D  + ++   DH VRLW
Sbjct: 243 MATCSADRTAKIWSVGETEDDFNLETTLDGHQRWVWDCAF-SADSAYLVTASSDHYVRLW 301

Query: 397 SILENEITFEF 407
            +   EI  ++
Sbjct: 302 DLSTREIVRQY 312

>Kwal_56.24526
          Length = 1210

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           ++I++S D+T+++W+ + +  +     H  FV C  FHPT+D   +S  LD  VR+W I
Sbjct: 109 WIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTED-LVVSASLDETVRVWDI 166

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 339 NNFLITSSMDRTVKLWHLERQTSLKTFQHQ-DFVTCVRFHPTDDRF 383
            N +I+   D+TV++W L+++T +K F+ + D    VR HP  + F
Sbjct: 265 QNLIISVGEDKTVRVWDLDKRTPVKQFKRENDRFWLVRAHPNINLF 310

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 324 FKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDR 382
           F+ H  +V  + + ++N +++TSS D T+K+W +   +  + ++H   V  V  HP    
Sbjct: 71  FEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVNEVVIHPNQGE 130

Query: 383 FFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLS-PGDGKYTIVGTFNGYVHV 437
             IS   D  +R+W + EN+ T +   +D +   +LS   DG   +     G  +V
Sbjct: 131 -LISCDRDGNIRIWDLGENQCTHQLTPEDDVPLQSLSVASDGSMLVAANNKGNCYV 185

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTF--QHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
           + T S D T ++W +E   +L++    HQ +V    F   D  + ++   DH VRLW + 
Sbjct: 222 MATCSADHTARIWSVEDNFNLESTLDGHQRWVWDCAF-SADSAYLVTASSDHYVRLWDLS 280

Query: 400 ENEITFEF 407
             +I  ++
Sbjct: 281 TRDIIRQY 288

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 27/58 (46%), Gaps = 1/58 (1%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
            L+++  D T++ W       L+T QH D     R   T+D+  ++      +RL+ I
Sbjct: 4   LLVSAGYDHTIRFWEALTGVCLRTIQHPD-SQVNRLEITNDKKLLAAAGHQNIRLYDI 60

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           ++I++S D+TV++W+ + +  L     H  FV C +FH T+D   +S  LD  VR+W I
Sbjct: 109 WVISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTED-LVVSASLDETVRVWDI 166

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 10/64 (15%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ------HQDFVTCVRFHPTDDRFFISGCLDHKVR 394
            ++T   DR VKLW   R +S K ++      H + V CV FHP D    +S   D  +R
Sbjct: 223 LIVTGGDDRQVKLW---RMSSNKAWEVDTCRGHTNNVDCVVFHP-DQNLILSVAEDKTLR 278

Query: 395 LWSI 398
           +W +
Sbjct: 279 IWDL 282

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 350 TVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITF 405
           T++LW     T L  F+ H+  V  V FHPT    F+S   D  +++WS+  N   +
Sbjct: 34  TIQLWDYRMGTLLHRFEGHEGPVRAVDFHPTQP-IFVSAGDDASIKVWSLETNRCLY 89

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 70/172 (40%), Gaps = 37/172 (21%)

Query: 340 NFLITSSMDRTVKLWHLERQTSLKTFQHQ-DFVTCVRFHPTDDRFFI---SGC----LDH 391
           N +++ + D+T+++W L+++T +K F+ + D    +R HP    F     SG     LD 
Sbjct: 266 NLILSVAEDKTLRIWDLDKRTPVKQFKRENDRFWLIRSHPNMSLFGAAHDSGIMIFKLDR 325

Query: 392 KVRLWSILENEITF--------EFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGL 443
           +    +  +N++ F         FD    +TSL                   +V LTK  
Sbjct: 326 ERPAATTYQNQLFFVNKEKQLQSFDYGKKVTSLP------------------YVTLTKLG 367

Query: 444 EQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDS 495
           +  +SFH +  N  +    S  I+ G    GL     +P  ++       DS
Sbjct: 368 QAWNSFHSISYNPSQH---SVLINEGTDKFGLVVLPKQPTGAVEPTSVIEDS 416

>Scas_720.83d
          Length = 915

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 79/208 (37%), Gaps = 62/208 (29%)

Query: 320 CFKIFKEHTADVLDLDWSK-NNFLITSSMDRTVKLWHLERQTSLKTFQ------------ 366
           C   F+EHT+ V  + ++K    L +SS+D TV+ W L R  + +TF             
Sbjct: 377 CLATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAV 436

Query: 367 ---------------------------------HQDFVTCVRFHPTDDRFFISGCLDHKV 393
                                            H+  V+C+ F   ++    S   D  V
Sbjct: 437 DPSGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAF-SQENSVLASASWDKTV 495

Query: 394 RLWSILENEITFE-FDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQV------ 446
           R+WSI       E FD    + +LT+ P DGK   V T  G + ++  +  +QV      
Sbjct: 496 RVWSIFGRSQQVEPFDVYSDVLALTIRP-DGKQVAVSTLKGQILMIDIESGQQVGNIDCR 554

Query: 447 ----SSFHVVDKNT---QERNTASTKIH 467
               S  H+ D+ T    ER+   T IH
Sbjct: 555 KDIISGRHLEDRFTSKNSERSKYFTSIH 582

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 38/69 (55%), Gaps = 5/69 (7%)

Query: 321 FKIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHL---ERQTSLKTFQ-HQDFVTCVR 375
           +++   H  D+L L WS ++ F+I++S D T ++W +   E+  +  TF  H+D+V    
Sbjct: 139 YRVHAGHFQDILSLTWSLDSRFIISTSKDLTARIWSIDSEEKDLASMTFAGHRDYVMGAF 198

Query: 376 FHPTDDRFF 384
           F    ++ +
Sbjct: 199 FSADQEKIY 207

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 72/169 (42%), Gaps = 38/169 (22%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL- 399
           ++T++ D  +K+W +     L TFQ H   VT V+F       F S  LD  VR W ++ 
Sbjct: 358 VVTAAEDGKIKVWDVVSGFCLATFQEHTSSVTQVQFAKRGQVLF-SSSLDGTVRAWDLIR 416

Query: 400 -ENEITF------EFDCQDLITSLTLSPGDGKYTIVGTFNGY-VHVLLTKGLEQVSSFHV 451
             N  TF      +F+C      L + P  G+    G+ + + +HV        V +  +
Sbjct: 417 YRNFRTFTAAERIQFNC------LAVDPS-GEVVCAGSLDNFDIHVW------SVQTGQL 463

Query: 452 VDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIF 500
           +D         +   H GP    + C  +  +NS+ +   S D  +R++
Sbjct: 464 LD---------TLSGHEGP----VSCLAFSQENSV-LASASWDKTVRVW 498

>Kwal_27.12053
          Length = 755

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 5/117 (4%)

Query: 324 FKEHTADVLDLDWSK-NNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDD 381
           +K H   + D+ +S   ++  T+S D+T +LW  +    L+ F  H + V  V FHP + 
Sbjct: 520 YKGHNHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHP-NG 578

Query: 382 RFFISGCLDHKVRLWSILENE-ITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHV 437
            +  +G  D   R+W I   + +         +TS  +SP DG++   G+ +G ++V
Sbjct: 579 TYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSP-DGRWLSTGSEDGVINV 634

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 3/73 (4%)

Query: 327 HTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFF 384
           H+  V    +S +N +L+++S D+TV+LW  +  TSL  ++ H   +  V F P    +F
Sbjct: 481 HSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPL-GHYF 539

Query: 385 ISGCLDHKVRLWS 397
            +   D   RLWS
Sbjct: 540 ATASHDQTARLWS 552

 Score = 37.0 bits (84), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 3/80 (3%)

Query: 321 FKIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHP 378
            +IF  H  DV  + +  N  ++ T S D+T ++W +    S++ F  H   VT     P
Sbjct: 559 LRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSP 618

Query: 379 TDDRFFISGCLDHKVRLWSI 398
            D R+  +G  D  + +W I
Sbjct: 619 -DGRWLSTGSEDGVINVWDI 637

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 2/79 (2%)

Query: 322 KIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPT 379
           ++F  HTA V     S +  +L T S D  + +W +     LK  + H         +  
Sbjct: 602 RLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSK 661

Query: 380 DDRFFISGCLDHKVRLWSI 398
           +    ISG  DH VR+W +
Sbjct: 662 EGHVLISGGADHSVRVWDV 680

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 43/73 (58%), Gaps = 3/73 (4%)

Query: 327 HTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFF 384
           H+  V  + +S +N +L+++S D+TV+LW L+  T L +++ H   V  V+F P    +F
Sbjct: 541 HSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPL-GHYF 599

Query: 385 ISGCLDHKVRLWS 397
            +G  D   RLWS
Sbjct: 600 ATGSHDQTARLWS 612

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 3/80 (3%)

Query: 321 FKIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHP 378
            +IF  H  DV  + +  N  +++T S D+T ++W ++   S++ F  H   V  V   P
Sbjct: 619 LRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSP 678

Query: 379 TDDRFFISGCLDHKVRLWSI 398
            D R+  +G  D  + +W I
Sbjct: 679 -DGRWLTTGSEDGVIIVWDI 697

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 71/197 (36%), Gaps = 36/197 (18%)

Query: 320 CFKIFKEHTADVLDLDWSKNNFLITSSM-DRTVKLWHL-----ERQTSLKT--------- 364
           C   F     ++  L +S ++ L+ +   D  +KLW L     E Q   K          
Sbjct: 479 CMYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTL 538

Query: 365 FQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGK 424
             H   V  V F P D+R+ +S   D  VRLWS+            D  T L    G   
Sbjct: 539 IGHSGPVYSVSFSP-DNRYLVSASEDKTVRLWSL------------DTYTCLVSYKGHNH 585

Query: 425 YTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDN 484
                 F+   H   T   +Q +     D      +    +I  G  +  ++C  + P N
Sbjct: 586 PVWDVKFSPLGHYFATGSHDQTARLWSCD------HIYPLRIFAG-HLNDVDCVTFHP-N 637

Query: 485 SLRIVVTSSDSRIRIFD 501
              ++  SSD   R++D
Sbjct: 638 GTYVLTGSSDKTCRMWD 654

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 59/127 (46%), Gaps = 14/127 (11%)

Query: 324 FKEHTADVLDLDWSKNNF-LITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPT--- 379
           F  HT DVL +    N+  +I++S D+T+++W+     +     H D+VT VR  P    
Sbjct: 104 FVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLE 163

Query: 380 -----DDRF-FISGCLDHKVRLWSILENEITFEFDC---QDLITSLTLSPGDGKYTIVGT 430
                D R  F+S  +D  VR WS+ E+    E D     + I  +  SP DG       
Sbjct: 164 DGEVDDGRITFVSAGMDKIVRSWSLNEDSYRIEADFIGHNNYINVVQPSP-DGSLAASAG 222

Query: 431 FNGYVHV 437
            +G ++V
Sbjct: 223 KDGQIYV 229

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 57/132 (43%), Gaps = 17/132 (12%)

Query: 307 NELNLYAPVFNPSCFKIFKEHTADVLDLDWSKN-NFLITSSMDRTVKLWHLERQTSLKTF 365
           NE     PV      + +K H+  V D+  S + N+ +++S D+T++LW+L    S   F
Sbjct: 51  NEQQFGVPV------RSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARF 104

Query: 366 -QHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSP---- 420
             H   V  V       +  IS   D  +R+W+ + +         D +T + ++P    
Sbjct: 105 VGHTGDVLSVAIDANSSK-IISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLE 163

Query: 421 ----GDGKYTIV 428
                DG+ T V
Sbjct: 164 DGEVDDGRITFV 175

>Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement
          Length = 1261

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 48/91 (52%), Gaps = 5/91 (5%)

Query: 327 HTADVLDLDWSKN--NFLITSSMDRTVKLWHLERQTSLKTFQHQ-DFVTCVRFHPTDDRF 383
           H+  +L LDW K   N L++S  D T  LW+ +    L  F  + ++    +F P     
Sbjct: 250 HSKGILSLDWCKQDENLLLSSGRDNTCALWNPQTAQKLSQFPTRGNWCFKTKFAPEAPDL 309

Query: 384 FISGCLDHKVRLWSILENEITFEFDCQDLIT 414
           F S  LD+K+++   L+N +T + D +D+++
Sbjct: 310 FASASLDNKIQV-QTLQN-LTNKLDLEDIVS 338

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 73/174 (41%), Gaps = 10/174 (5%)

Query: 333 DLDWSKNNFLITSSMDRTVKLW--HLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLD 390
           DLDWS +N ++  ++D  +  +    E ++  K  +H   V  ++F+   D    SG   
Sbjct: 67  DLDWSPDNSILAGALDNGIVEFFSPKELKSVAKISKHTTPVNTLKFNAKQDNVLCSGDSR 126

Query: 391 HKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFH 450
            ++ +W I  N+IT           + ++P D  Y++        HV  + G    +S  
Sbjct: 127 GEIFIWDI--NKIT-SSGYVPFSPGVAMTPIDEVYSLAWN-QSLAHVFASAGSSGYTSIW 182

Query: 451 VVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTS---SDSRIRIFD 501
            +    +  + + T    G +   L   ++ P NS +I   +   +D  I ++D
Sbjct: 183 DLKAKKEVLHLSYTSPSTGAK-NHLSVVEWHPSNSTKIATATGNDNDPVILVWD 235

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 72/159 (45%), Gaps = 26/159 (16%)

Query: 310 NLYAPVFNP--SCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ- 366
           N Y P + P  +C      H+ +V+     +NN++IT + D+ + ++  E    L     
Sbjct: 242 NWYDPNYKPGRTCLD---GHSTNVVTCLQFENNYIITGADDKKINVYDAENDLFLLELNG 298

Query: 367 HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFD-------CQDLITSLTLS 419
           H+  V  ++F   D +  +SG  D  VR+W+I   + T  F        C +++      
Sbjct: 299 HEGGVWALKF--VDGKILVSGSTDRSVRIWNIETGKCTHVFKGHTSTVRCLEVVEY---- 352

Query: 420 PGDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQE 458
            GD KY + G+ +  +HV     +++      +DK +QE
Sbjct: 353 -GDSKYIVTGSRDNTLHVWKLPPMKE------LDKGSQE 384

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 45/107 (42%), Gaps = 21/107 (19%)

Query: 320 CFKIFKEHTADVLDLD---WSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQD------- 369
           C  +FK HT+ V  L+   +  + +++T S D T+ +W L     L     +        
Sbjct: 333 CTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVWKLPPMKELDKGSQEPIFYRTPE 392

Query: 370 ----FVTCVRFHPTD-------DRFFISGCLDHKVRLWSILENEITF 405
               FV  +R H +         R  ISG  DH + +W I+  ++ +
Sbjct: 393 ENPYFVGVLRGHMSSVRTVSGHGRIVISGSYDHNLMVWDIISMKLLY 439

>Scas_721.32
          Length = 822

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 324 FKEHTADVLDLDWSK-NNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDD 381
           +K H   V D+ +S   ++  T+S D+T +LW  +    L+ F  H   V CV FHP + 
Sbjct: 587 YKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHP-NG 645

Query: 382 RFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHV 437
            +  +G  D   R+W I   +    F         T    DG++   G+ +G +++
Sbjct: 646 CYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINL 701

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 90/237 (37%), Gaps = 42/237 (17%)

Query: 327 HTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFF 384
           H+  V    +S +N +L++ S D+TV+LW  +  TSL +++ H   V  V+F P    +F
Sbjct: 548 HSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPL-GHYF 606

Query: 385 ISGCLDHKVRLWS--------ILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVH 436
            +   D   RLWS        I    ++ + DC      ++  P +G Y   G+ +    
Sbjct: 607 ATASHDQTARLWSCDHIYPLRIFAGHLS-DVDC------VSFHP-NGCYVFTGSSDKTCR 658

Query: 437 VLLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSR 496
           +      + V  F                 H  P +    C    PD    +   S D  
Sbjct: 659 MWDISTGDSVRLFLG---------------HTAPVL----CTAVSPDGRW-LATGSEDGI 698

Query: 497 IRIFDXXXXXXXXXXXGFQSGASQHKACLATVKGQQVVLSSSDDHWVHGWKLKSSTS 553
           I ++D           G    A      L+  K   V++S   DH V  W LK ST+
Sbjct: 699 INLWDIGTAKRLKVMRGHGKNAIH---SLSYCKEGNVLVSGGADHSVRVWDLKKSTA 752

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 3/80 (3%)

Query: 321 FKIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHP 378
            +IF  H +DV  + +  N  ++ T S D+T ++W +    S++ F  H   V C    P
Sbjct: 626 LRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSP 685

Query: 379 TDDRFFISGCLDHKVRLWSI 398
            D R+  +G  D  + LW I
Sbjct: 686 -DGRWLATGSEDGIINLWDI 704

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 2/79 (2%)

Query: 322 KIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPT 379
           ++F  HTA VL    S +  +L T S D  + LW +     LK  + H         +  
Sbjct: 669 RLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCK 728

Query: 380 DDRFFISGCLDHKVRLWSI 398
           +    +SG  DH VR+W +
Sbjct: 729 EGNVLVSGGADHSVRVWDL 747

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 57/110 (51%), Gaps = 8/110 (7%)

Query: 321 FKIFKEHTADVLDLDWSKN-NFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPT 379
           ++ F  H +DV+ +D  K  + +I+ S D+T+K+W ++ Q       H D+V+ VR  P 
Sbjct: 100 YQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPN 159

Query: 380 -----DDRFFISGCLDHKVRLWSILENEITFEFDCQDL-ITSLTLSPGDG 423
                D    IS   D  V+ W++ + +I  +F   +  I +LT SP DG
Sbjct: 160 EKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASP-DG 208

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 53/107 (49%), Gaps = 12/107 (11%)

Query: 302 KISSTNELNLYAPVFNPSCFKIFKE---------HTADVLDLDWSKNN-FLITSSMDRTV 351
           KI S +  +L  P ++ S F  F +         H+  V    +S +N +L++ S D+TV
Sbjct: 498 KIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTV 557

Query: 352 KLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWS 397
           KLW ++  T+L  ++ H   V  V+F P    +F S   D   RLW+
Sbjct: 558 KLWSMDTHTALVNYKGHNHPVWDVKFSPL-GHYFASASHDQTARLWA 603

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 3/80 (3%)

Query: 321 FKIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHP 378
            +IF  HT DV  + +  N  ++ T S D+T ++W +    S++ F  H   V   +  P
Sbjct: 610 LRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSP 669

Query: 379 TDDRFFISGCLDHKVRLWSI 398
            D R+  +G  D  + LW I
Sbjct: 670 -DGRWLATGSEDGVICLWDI 688

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 4/80 (5%)

Query: 322 KIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQH--QDFVTCVRFHP 378
           ++F  HTA VL    S +  +L T S D  + LW +     +K  +   ++ V  + F+ 
Sbjct: 653 RLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFN- 711

Query: 379 TDDRFFISGCLDHKVRLWSI 398
            +    ISG  DH VR+W +
Sbjct: 712 KEGNVLISGGADHSVRVWDV 731

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 50/98 (51%), Gaps = 4/98 (4%)

Query: 327 HTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFIS 386
           H  +V  L  SKNNF+I+SS D+T K+WH           H   V   +F P  D FF++
Sbjct: 98  HKGNVCSLS-SKNNFVISSSWDKTAKVWH-NGSAIYDLVGHSASVWDAKFLPEKD-FFLT 154

Query: 387 GCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGK 424
              D  ++LW   +   TF    +D+I  L +SP DG+
Sbjct: 155 ASADCTIKLWHGNKLIKTFSGIHKDVIRHLDISP-DGE 191

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 5/60 (8%)

Query: 327 HTADVLDLDW-SKNNFLITSSMDRTVKLWHLERQTSLKTFQ--HQDFVTCVRFHPTDDRF 383
           H+A V D  +  + +F +T+S D T+KLWH  +   +KTF   H+D +  +   P  + F
Sbjct: 136 HSASVWDAKFLPEKDFFLTASADCTIKLWHGNKL--IKTFSGIHKDVIRHLDISPDGETF 193

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 50/88 (56%), Gaps = 5/88 (5%)

Query: 320 CFKIFKEHTADVLDLDWSKN-NFLITSSMDRTVKLWHLERQTSLKTFQHQDFV--TCVRF 376
           C   F+EHT+ V  + ++KN   + +SS+D TVK W L R  + +TF   + +  +C+  
Sbjct: 390 CLATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAA 449

Query: 377 HPTDDRFFISGCLD-HKVRLWSILENEI 403
            PT +    +G LD + +++WS+   ++
Sbjct: 450 DPTGE-VVCAGSLDNYDIQVWSVQTGQL 476

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 39/69 (56%), Gaps = 5/69 (7%)

Query: 321 FKIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHL---ERQTSLKTFQ-HQDFVTCVR 375
           +++   H AD+  L WS+++ F+I+++ D T +++ +   E+  +  TF  H+D+V    
Sbjct: 155 YRVHAGHFADITSLTWSRDSRFIISTAKDMTARIYSVNAEEKDLASMTFAGHRDYVMGAF 214

Query: 376 FHPTDDRFF 384
           F    ++ +
Sbjct: 215 FSADQEKIY 223

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 69/162 (42%), Gaps = 24/162 (14%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL- 399
           ++T++ D  +K+W +     L TF +H   VT V+F   + +   S  LD  V+ W ++ 
Sbjct: 371 IVTAAEDGKIKIWDIVSGFCLATFEEHTSSVTSVQF-AKNGQIMFSSSLDGTVKAWDLMR 429

Query: 400 -ENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQE 458
             N  TF    +   + L   P  G+    G+ + Y           +  + V  +  Q 
Sbjct: 430 FRNFRTFTATERIQFSCLAADP-TGEVVCAGSLDNY----------DIQVWSV--QTGQL 476

Query: 459 RNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIF 500
            +T S   H GP    + C  +  +NS+ +   S D  IR++
Sbjct: 477 LDTLSG--HEGP----VSCLSFSRENSI-LASASWDKTIRVW 511

>Scas_592.4*
          Length = 318

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 49/93 (52%), Gaps = 7/93 (7%)

Query: 321 FKIFKEHTADVLD--LDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHP 378
           ++ F  H +DV+   +D  K + +I+ S D+T+K+W ++ Q       H D+V+ VR  P
Sbjct: 100 YQRFVGHKSDVMSVAID-RKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAP 158

Query: 379 TDDR----FFISGCLDHKVRLWSILENEITFEF 407
           TD        IS   D  V+ W++ + +I  +F
Sbjct: 159 TDQNDDAVTVISAGNDKMVKAWNLNQFQIEADF 191

 Score = 33.1 bits (74), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 50/104 (48%), Gaps = 9/104 (8%)

Query: 324 FKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHPTDD 381
           FK H+  V D   +++  + +++S D+T++LW +    + + F  H+  V  V      D
Sbjct: 61  FKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAI----D 116

Query: 382 R---FFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGD 422
           R     ISG  D  +++W+I    +       D ++ + ++P D
Sbjct: 117 RKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTD 160

>Scas_721.115*
          Length = 318

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 49/93 (52%), Gaps = 7/93 (7%)

Query: 321 FKIFKEHTADVLD--LDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHP 378
           ++ F  H +DV+   +D  K + +I+ S D+T+K+W ++ Q       H D+V+ VR  P
Sbjct: 100 YQRFVGHKSDVMSVAID-RKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAP 158

Query: 379 TDDR----FFISGCLDHKVRLWSILENEITFEF 407
           TD        IS   D  V+ W++ + +I  +F
Sbjct: 159 TDQNDDSVTVISAGNDKMVKAWNLNQFQIEADF 191

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 50/104 (48%), Gaps = 9/104 (8%)

Query: 324 FKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHPTDD 381
           FK H+  V D   +++  + +++S D+T++LW +    + + F  H+  V  V      D
Sbjct: 61  FKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAI----D 116

Query: 382 R---FFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGD 422
           R     ISG  D  +++W+I    +       D ++ + ++P D
Sbjct: 117 RKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTD 160

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 3/73 (4%)

Query: 327 HTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFF 384
           H+  V  + +S +N +L+++S D+TV+LW L+  T L  ++ H   V  V+F P    +F
Sbjct: 552 HSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPL-GHYF 610

Query: 385 ISGCLDHKVRLWS 397
           I+   D   RLWS
Sbjct: 611 ITASHDQTARLWS 623

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 72/197 (36%), Gaps = 36/197 (18%)

Query: 320 CFKIFKEHTADVLDLDWSKNNFLITSSM-DRTVKLWHLE--------------RQTSLKT 364
           C   F     ++  +++S +  L  +   D T+K+W+L+              +  S   
Sbjct: 490 CMYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATL 549

Query: 365 FQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGK 424
             H   V  V F P D+R+ +S   D  VRLWS+            D  T L    G   
Sbjct: 550 VGHSGPVYSVAFSP-DNRYLLSASEDKTVRLWSL------------DTFTCLVCYKGHNH 596

Query: 425 YTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDN 484
                 F+   H  +T   +Q +     D      +    +I  G  +  ++C  + P N
Sbjct: 597 PVWYVKFSPLGHYFITASHDQTARLWSCD------HIYPLRIFSG-HLNDVDCSTFHP-N 648

Query: 485 SLRIVVTSSDSRIRIFD 501
              +   SSD   R++D
Sbjct: 649 GCYVFTGSSDKTCRMWD 665

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 16/128 (12%)

Query: 321 FKIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHP 378
            +IF  H  DV    +  N  ++ T S D+T ++W ++   S++ F  H   VT +   P
Sbjct: 630 LRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSP 689

Query: 379 TDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVG-TFNGYVHV 437
            D R+  +G  D  + +W I   +             +    G GK  I   TFN   + 
Sbjct: 690 -DGRWLTTGSEDGTIIVWDIGTGK------------RIKQMKGHGKNPIYSITFNKEGNC 736

Query: 438 LLTKGLEQ 445
           L+T G +Q
Sbjct: 737 LVTGGADQ 744

>CAGL0B01529g 137174..138283 highly similar to sp|P39108
           Saccharomyces cerevisiae YDR142c PAS7 peroxisomal import
           protein - peroxin, start by similarity
          Length = 369

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 82/202 (40%), Gaps = 41/202 (20%)

Query: 323 IFKEHTADVLDLDW---SKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPT 379
           +F EH+ +V   +W   SK+NF ++SS D  VK+W   R+ SL TF           HP 
Sbjct: 99  MFHEHSKEVYSCNWNLVSKSNF-VSSSWDGQVKIWSPNRKASLITFSP---------HPI 148

Query: 380 DDRFFISGCLDHKVRLWS---ILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVH 436
           D    +S  LD+   +     +  N++    +C   I   T SP D    +    N YV 
Sbjct: 149 D----VSRALDNLPEVSQRDKLSPNQVAQNRNC---IYQATFSPHDDNLILCCAGNSYVT 201

Query: 437 VLLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSS-DS 495
           +     L Q         N Q+   A    H G      +  KY P+    I+ TS  D+
Sbjct: 202 LF---DLRQNPG------NNQKNFIA----HRGKGALSCDFNKYRPN----IIATSGVDN 244

Query: 496 RIRIFDXXXXXXXXXXXGFQSG 517
            I I+D           GFQ+G
Sbjct: 245 SIGIWDIRMLPNSSNQQGFQTG 266

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 45/83 (54%), Gaps = 4/83 (4%)

Query: 317 NPSCFKIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCV 374
           +P+C K    H+  V    +S +N +L++ S D+TV+LW ++  T+L +++ H   V  V
Sbjct: 515 DPTC-KTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDV 573

Query: 375 RFHPTDDRFFISGCLDHKVRLWS 397
            F P    +F +   D   RLWS
Sbjct: 574 SFSPL-GHYFATASHDQTARLWS 595

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 3/80 (3%)

Query: 321 FKIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHP 378
            +IF  H  DV  + +  N  ++ T S D+T ++W +    S++ F  H   V  +   P
Sbjct: 602 LRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCP 661

Query: 379 TDDRFFISGCLDHKVRLWSI 398
            D R+  +G  D  + +W I
Sbjct: 662 -DGRWLSTGSEDGIINVWDI 680

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 71/201 (35%), Gaps = 40/201 (19%)

Query: 320 CFKIFKEHTADVLDLDWSKNNFLITSSM-DRTVKLWHL------------------ERQT 360
           C   F+    D+  LD+S +  +  +   D  +K+W L                  E  T
Sbjct: 458 CMYTFQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPT 517

Query: 361 SLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSP 420
                 H   V    F P D+++ +SG  D  VRLWS+            D  T+L    
Sbjct: 518 CKTLVGHSGTVYSTSFSP-DNKYLLSGSEDKTVRLWSM------------DTHTALVSYK 564

Query: 421 GDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKY 480
           G        +F+   H   T   +Q +     D      +    +I  G  +  ++C  +
Sbjct: 565 GHNHPVWDVSFSPLGHYFATASHDQTARLWSCD------HIYPLRIFAG-HLNDVDCVSF 617

Query: 481 EPDNSLRIVVTSSDSRIRIFD 501
            P N   +   SSD   R++D
Sbjct: 618 HP-NGCYVFTGSSDKTCRMWD 637

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 2/79 (2%)

Query: 322 KIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPT 379
           ++F  HTA V+ +    +  +L T S D  + +W +     LK  + H         +  
Sbjct: 645 RLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSK 704

Query: 380 DDRFFISGCLDHKVRLWSI 398
           +    ISG  DH VR+W +
Sbjct: 705 EGNVLISGGADHTVRVWDL 723

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 2/80 (2%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILE 400
           +I++ MD+ VK+W L+  T    F  H ++VT V   P D   F S   D ++ LW++ E
Sbjct: 184 VISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVTPSP-DGSIFASAGKDGQIILWNLNE 242

Query: 401 NEITFEFDCQDLITSLTLSP 420
               +  D +D + ++  SP
Sbjct: 243 KTALYTLDAKDEVFAVAFSP 262

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 57/110 (51%), Gaps = 7/110 (6%)

Query: 320 CFKIFKEHTADVLDLDWS-KNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHP 378
           C K F  H +DV+ +    +   ++++S D+TVK+W+      +    H D+V+ VR  P
Sbjct: 115 CIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWNTVGDCVVTLLGHNDWVSNVRIAP 174

Query: 379 ---TDDRF-FISGCLDHKVRLWSILENEITFEF-DCQDLITSLTLSPGDG 423
              +DD    IS  +D  V++W +    I  +F    + +T++T SP DG
Sbjct: 175 SEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVTPSP-DG 223

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 51/101 (50%), Gaps = 3/101 (2%)

Query: 324 FKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHPTDD 381
           FK H+  V D   + +  + +++S D+T++LW L+    +K F  H+  V  V   P   
Sbjct: 77  FKGHSHIVQDCTVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRAT 136

Query: 382 RFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGD 422
           +  +S   D  V++W+ + + +       D ++++ ++P +
Sbjct: 137 Q-IVSASRDKTVKVWNTVGDCVVTLLGHNDWVSNVRIAPSE 176

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 348 DRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEI 403
           D  + LW+L  +T+L T   +D V  V F P  +R++++      ++++ + E  I
Sbjct: 232 DGQIILWNLNEKTALYTLDAKDEVFAVAFSP--NRYWLTAATASGIKIFDLEERTI 285

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 58/142 (40%), Gaps = 5/142 (3%)

Query: 323 IFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHPTD- 380
           IFK HT  V DL++  N  ++T+S D T  LW + +   +  +  H   V  +   P   
Sbjct: 172 IFKGHTCYVSDLEFINNESILTASGDMTCALWDIPKSKRVSEYSDHLGDVLTLSVPPAGT 231

Query: 381 ---DRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHV 437
              D  F SG  D  V LW          F   D   S      DG   I G+ +G   +
Sbjct: 232 TSYDSMFASGGSDGYVYLWDTRSPSSVQNFFVSDSDISTVRFFSDGNSIITGSDDGIARL 291

Query: 438 LLTKGLEQVSSFHVVDKNTQER 459
              +   ++SS+ +  K  Q++
Sbjct: 292 FDLRSDCELSSYSLSQKVQQQQ 313

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 58/114 (50%), Gaps = 6/114 (5%)

Query: 290 FRRAQTLEKLDQKISSTNELNLYAPVFNPSCFKI---FKEHTADVLDLDWS-KNNFLITS 345
           + R   ++K+D +  +T   +    ++N +  K+    K H   V DL  S ++ ++ + 
Sbjct: 117 WVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISNRHPYMFSV 176

Query: 346 SMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           S D+TVK W LE+ T+++ +  H   V  V  HPT D    +G  D  V++W I
Sbjct: 177 SEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAG-RDSVVKVWDI 229

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 46/93 (49%), Gaps = 3/93 (3%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILE 400
           +I+SS+D +++LW L    S+K    HQ  V  +  HP+ +  F S C +  +R W + +
Sbjct: 257 VISSSVDASIRLWDLVAGKSMKVLTHHQRTVRDISVHPS-EFSFASACTN-DIRSWLLPK 314

Query: 401 NEITFEFDCQDLITSLTLSPGDGKYTIVGTFNG 433
            E+   F  QDL    T+S         G+ NG
Sbjct: 315 GELLTNFVSQDLDVINTVSINQDDVLFAGSDNG 347

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 85/206 (41%), Gaps = 38/206 (18%)

Query: 354 WHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDL- 412
           WHL R        H  +V C+     D+ +F +G  D  +++W++   ++       D+ 
Sbjct: 105 WHLTRVI----HGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMT 160

Query: 413 ITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPRV 472
           +  L +S            N + ++      + V  +  ++KNT  RN      +HG  +
Sbjct: 161 VRDLAIS------------NRHPYMFSVSEDKTVKCWD-LEKNTAIRN------YHG-HL 200

Query: 473 TGLECFKYEPDNSLRIVVTSS-DSRIRIFDXXXXXXXXXXXGFQSGASQHKACLATVKGQ 531
           +G+      P  ++ +VVT+  DS ++++D           G       HK  +  V+  
Sbjct: 201 SGVHTVDIHP--TVDVVVTAGRDSVVKVWDIRTRLPVMTLPG-------HKGPITKVRCL 251

Query: 532 QV---VLSSSDDHWVHGWKLKSSTSL 554
            V   V+SSS D  +  W L +  S+
Sbjct: 252 PVDPQVISSSVDASIRLWDLVAGKSM 277

>Scas_721.7
          Length = 325

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 61/130 (46%), Gaps = 13/130 (10%)

Query: 320 CFKIFKEHTADVLDLDWSKN-NFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFH 377
           C      HTA V+ L ++ + N L TSSMD ++K+W       LKT   H + V  +   
Sbjct: 90  CLHRLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHGAILKTISAHSESVVSLSIC 149

Query: 378 PT-DDRFFISGCLDHKVRLWSILENE----ITFEFDCQD-----LITSLTLSPGDGKYTI 427
           P  D     SG  D  +RL+          +T++ D +       I+ +  SP +GK+ +
Sbjct: 150 PDRDSSVLASGSFDGLIRLFDTRTGHCLKTLTYDKDWKSDDGVVPISQVRFSP-NGKFLL 208

Query: 428 VGTFNGYVHV 437
           V +F+G V +
Sbjct: 209 VSSFDGIVKI 218

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 36/178 (20%), Positives = 79/178 (44%), Gaps = 16/178 (8%)

Query: 327 HTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFI 385
           H A + ++ WS +N  L ++S D T+++ HL      +   H   V  + ++ + +  F 
Sbjct: 56  HVAPISEVAWSPDNQCLASASDDFTIEITHLTHGCLHRLMGHTAPVISLTYNDSGNLLFT 115

Query: 386 SGCLDHKVRLWSILENEITFEFDCQ-DLITSLTLSPG-DGKYTIVGTFNGYVHVLLTKGL 443
           S  +D  +++W      I        + + SL++ P  D      G+F+G + +  T+  
Sbjct: 116 SS-MDESIKIWDTFHGAILKTISAHSESVVSLSICPDRDSSVLASGSFDGLIRLFDTR-- 172

Query: 444 EQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFD 501
               + H +   T +++  S        V  +   ++ P+    ++V+S D  ++I+D
Sbjct: 173 ----TGHCLKTLTYDKDWKSDD-----GVVPISQVRFSPNGKF-LLVSSFDGIVKIWD 220

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 7/97 (7%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILE 400
           L T + D  ++LW +     ++  + H D +T ++F  T     ISG LD  +RLW +  
Sbjct: 577 LATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKFDAT---TIISGSLDGTIRLWDLRS 633

Query: 401 NEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHV 437
           N +T     +  I+SL     D K+ +V +     H+
Sbjct: 634 NNLTDIISYEKPISSLDF---DAKHIVVASNEHNTHI 667

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 367 HQDFVTCVRFHPTDDRFFISGCLDHKVRLW 396
           H D +TC+ F P       +G +DH V+LW
Sbjct: 403 HDDAITCLDFDPHFSTLCTAGYMDHIVKLW 432

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 327 HTADVLDLDWS-KNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFF 384
           HTA V+ + ++ K N L +SSMD ++K WH+   T+LKT   H D V  +     D    
Sbjct: 109 HTAPVISICYNNKGNILCSSSMDESIKEWHVLSGTALKTMSAHSDAVVSIDIPKFDSSIL 168

Query: 385 ISGCLDHKVRLW 396
            SG  D  +R++
Sbjct: 169 SSGSYDGLIRIF 180

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTF--QHQD 369
           FL+  S+D  VKLW   R T ++TF   HQ+
Sbjct: 217 FLLVKSLDNVVKLWEYTRGTVVRTFLWPHQE 247

>Scas_658.1
          Length = 442

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 68/164 (41%), Gaps = 20/164 (12%)

Query: 340 NFLITSSMDRTVKLWHL-ERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWS 397
           N L++   D  VK+W    ++  L+ ++ H   +  + F+  D   FIS   DH +++W 
Sbjct: 163 NLLLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDFN-DDGTNFISSSFDHTIKIWD 221

Query: 398 ILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQ 457
             + ++  +   +     +   P +    IVG  N  ++   T+  E      V D    
Sbjct: 222 TEQGKVKTKLHFKSTPNDVKFRPFNSSEFIVGFANSKIYHYDTRISENDGRVQVYD---- 277

Query: 458 ERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFD 501
                    HH   +  L+ F   PD S + + +S D  +RI+D
Sbjct: 278 ---------HHMSSILALKFF---PDGS-KFISSSEDKTVRIWD 308

>AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516)
           [1440 bp, 479 aa]
          Length = 479

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 57/105 (54%), Gaps = 5/105 (4%)

Query: 296 LEKLDQKISSTNELNLYAPVFNPS-CFKIFKEHTADVLDLDWSK-NNFLITSSMDRTVKL 353
           +E  +  I++ +    Y  + N S    +FK+H + V+D+D+S     ++T S D+T+++
Sbjct: 269 MEPFNFAIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGEEIVTGSYDKTIRI 328

Query: 354 WHLERQTSLKTF--QHQDFVTCVRFHPTDDRFFISGCLDHKVRLW 396
           ++L+   S + +  +    V  V+F   D ++ +SG  D  VRLW
Sbjct: 329 FNLKHGHSREVYHTKRMQHVFQVKF-TMDSKYIVSGSDDGNVRLW 372

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLW 396
           ++T + D T ++W  + QT + T + H ++V CV + P D     +G +D+ +RLW
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSP-DGEVIATGSMDNTIRLW 213

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 41/104 (39%), Gaps = 11/104 (10%)

Query: 304 SSTNELNLYAPVFNPSCFKIFKEHTADVLDLDWSKNNF--------LITSSMDRTVKLWH 355
           S  N + L+ P          + H+  +  L W   +         L +SS D T+K+W 
Sbjct: 205 SMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWD 264

Query: 356 -LERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
            + R        H + V+CV++         SG  D  VR+W I
Sbjct: 265 TVSRVCQYTMSGHTNSVSCVKW--GGQGLLYSGSHDRTVRVWDI 306

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 53/101 (52%), Gaps = 5/101 (4%)

Query: 300 DQKISSTNELNLYAPVFNPSCFK---IFKEHTADVLDLDWSKNNF-LITSSMDRTVKLWH 355
           D  + ST  L+  A +++    K     + H+  +  +DWS+N + L + S D T+K+W 
Sbjct: 316 DGSLVSTAGLDAIALIWDIRSGKNIMSLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWD 375

Query: 356 LERQTSLKT-FQHQDFVTCVRFHPTDDRFFISGCLDHKVRL 395
           + ++ +++T   H   V+ V+F+  +  + +S   D KV +
Sbjct: 376 IRKKGNVETILAHNSIVSQVKFNKQNGGYLVSSGYDKKVNI 416

>Kwal_33.15136
          Length = 473

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 46/80 (57%), Gaps = 4/80 (5%)

Query: 320 CFKIFKEHTADVLDLDWSK-NNFLITSSMDRTVKLWHLERQTSLKTF--QHQDFVTCVRF 376
              +FK+H + V+D+D+S   + ++T S D+T++++ ++   S + +  +    V  V++
Sbjct: 292 ALHVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIYQVKHGHSREIYHTKRMQHVFQVKY 351

Query: 377 HPTDDRFFISGCLDHKVRLW 396
              D R+ +SG  D  VR+W
Sbjct: 352 -TMDSRYIVSGSDDGNVRMW 370

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 40/74 (54%), Gaps = 3/74 (4%)

Query: 327 HTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFF 384
           H   V D+  SK + ++ ++S D+ VK W LER T+++ F  H   V  V  HP+ D   
Sbjct: 164 HVMSVRDIAISKRHPYMFSASEDKLVKCWDLERNTAIRDFHGHLSGVHTVDVHPSLDIIA 223

Query: 385 ISGCLDHKVRLWSI 398
            +G  D  VRLW I
Sbjct: 224 TAG-RDAVVRLWDI 236

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 86/214 (40%), Gaps = 35/214 (16%)

Query: 354 WHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLI 413
           WH   + S     H  +V CV   P D+ +F +G  D  +++W                 
Sbjct: 108 WHAPWKLSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWD---------------- 151

Query: 414 TSLTLSPGDGKYTIVGTFNGYVHVLLTKG---LEQVSSFHVVDKNTQERNTASTKIHHGP 470
               L+ G  K T++G       + ++K    +   S   +V     ERNTA    H   
Sbjct: 152 ----LAAGKLKITLIGHVMSVRDIAISKRHPYMFSASEDKLVKCWDLERNTAIRDFHG-- 205

Query: 471 RVTGLECFKYEPDNSLRIVVTSS-DSRIRIFDXXXXXXXXXXXGFQSGASQHKACLATVK 529
            ++G+      P  SL I+ T+  D+ +R++D           G +S  ++ K CL  V 
Sbjct: 206 HLSGVHTVDVHP--SLDIIATAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVK-CLP-VD 261

Query: 530 GQQVVLSSSDDHWVHGWKL---KSSTSLTESEKN 560
            Q  ++S S D  V  W +   K+S  LT   +N
Sbjct: 262 PQ--IISCSGDATVRLWDIIAGKASKVLTHHSRN 293

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 51/104 (49%), Gaps = 8/104 (7%)

Query: 320 CFKIFKEHTADVLDLDW-SKNNFLITSSMDRTVKLWH---LERQTSLKTFQHQDFVTCVR 375
           C  + +EH+ DV  + W +K+N L +SS D TV++W     + + +     H+  + C  
Sbjct: 149 CISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSD 208

Query: 376 FHPTDDRF-FISGCLDHKVRLWSILENEITFEFDCQDLITSLTL 418
           F   +D     SG  D  VR+W  + ++   E D Q+ +   TL
Sbjct: 209 FSKEEDPIRLCSGSDDSTVRVWKYIGDD---EDDQQEWVCESTL 249

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLW 396
           +IT + D T ++W    QT + T + H ++V CV + P D     +G +D+ +RLW
Sbjct: 159 MITGAGDNTARIWDCNTQTPMSTLKGHFNWVLCVSWSP-DGELIATGSMDNTIRLW 213

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           L ++S D T+K+W   R+  L T   H   V+C+++         SG  D  +R W +
Sbjct: 251 LASASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKW--GGQGVLYSGSHDKTIRAWDM 306

>Kwal_56.24478
          Length = 1296

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 72/178 (40%), Gaps = 18/178 (10%)

Query: 333 DLDWSKNNFLITSSMDRTVKLW--HLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLD 390
           DLDWS +N ++T ++D  V  +    E ++  K  QH   V  VRF+        SG   
Sbjct: 67  DLDWSYDNSVLTGALDNGVVEFFSPSEYKSIAKLAQHSTPVKTVRFNAKQHNVLCSGGSK 126

Query: 391 HKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFH 450
            ++ +W   + E          +    ++P D  Y++    N   HV  + G    +S  
Sbjct: 127 GEIYIWDANKIETP---GYAPFVPGTAMTPMDEIYSLAWNQN-QGHVFASAGSSGFASIW 182

Query: 451 VVDKNTQERNTASTKIHHGPRVTG----LECFKYEPDNSLRIVVTS---SDSRIRIFD 501
            +    +        + H   +TG    L   ++ P+NS RI   S   SD  I ++D
Sbjct: 183 DLKAKKE-----VIHLSHTSSITGQKNQLSIVEWHPNNSTRIATASGSDSDPSILVWD 235

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 3/86 (3%)

Query: 327 HTADVLDLDWSKNN--FLITSSMDRTVKLWHLERQTSLKTFQHQ-DFVTCVRFHPTDDRF 383
           HT  VL LDW K +   L++S  D +  LW+ E   +L  F  + ++    +F P     
Sbjct: 250 HTKGVLSLDWCKQDETLLLSSGRDNSCVLWNPESGQNLTQFPTRGNWCFKTKFAPQAPDL 309

Query: 384 FISGCLDHKVRLWSILENEITFEFDC 409
           F S   D+K+ + ++     T + D 
Sbjct: 310 FASASFDNKIEVQTLQNITCTLDVDA 335

>Scas_700.27*
          Length = 433

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 64/158 (40%), Gaps = 10/158 (6%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILE 400
           +++ S D T++LW +    S+K    H+  V  + FHPT+  F +S C  + +R W + E
Sbjct: 263 IVSCSTDATIRLWDIVAGKSMKVITHHKKSVRNIAFHPTE--FSMSSCSANDIRSWKLPE 320

Query: 401 NEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSF---HVVDKNTQ 457
             +   F+   L    TLS         G+ NG +     K   +  S     +      
Sbjct: 321 GGLLTNFNSDGLGIINTLSINQDDVLFAGSDNGMLSFYDYKSGHKYQSMMTKEIPGSLES 380

Query: 458 ERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDS 495
           ER    +        TGL     E D S++I    SD+
Sbjct: 381 ERGILCSTFDR----TGLRLLTGETDKSIKIWSMDSDA 414

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 58/111 (52%), Gaps = 8/111 (7%)

Query: 327 HTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHPTDDRFF 384
           HT+ +  L+++K+N  L+++S D T+K+W     ++   F  H   ++    H  +D   
Sbjct: 339 HTSTITTLEFNKSNKSLLSASDDNTIKVWRGGNSSAANDFTDHTKTISSA--HWINDDLI 396

Query: 385 ISGCLDHKVRLWSILENEITFE--FDCQDLITSLTLSPGDGKYTIVGTFNG 433
           IS   D  V++WSI +N I  E   D + +  + +LSP D  +  VGT  G
Sbjct: 397 ISTAYDGTVKVWSISKNSIVAEASLDSEPIFEA-SLSP-DRNWLTVGTLQG 445

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 56/113 (49%), Gaps = 18/113 (15%)

Query: 327 HTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKT-FQHQDFVTCVRFHPTDDRFF 384
           H   VL +D+S ++  LITSS D+ +K+W ++     K+ F HQD +  VRF      FF
Sbjct: 563 HKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSIFAHQDSIMSVRFEADTHNFF 622

Query: 385 ISGCLDHKVRLWSILENEITFEFDC-------QDLITSLTLSPGDGKYTIVGT 430
             G  D  V+ W         +FDC       Q  +  + +SP DG+ T+V T
Sbjct: 623 SCGK-DGAVKRWD------GDKFDCIQKLNGHQSEVWCIAVSP-DGR-TVVST 666

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 58/121 (47%), Gaps = 10/121 (8%)

Query: 327 HTADVLDLDWS-KNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFF 384
           HTA V+ L ++ K N L TSSMD ++K+W +   T +KT   H + V  +     D    
Sbjct: 95  HTAPVISLCYNNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSDNDGSIL 154

Query: 385 ISGCLDHKVRLWSILENE----ITFEFDCQDLITSLTLS----PGDGKYTIVGTFNGYVH 436
            SG  D  +R++          +T++ D Q     + ++      + KY +V +++G V 
Sbjct: 155 SSGSHDGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSANTKYLLVKSYDGVVK 214

Query: 437 V 437
           +
Sbjct: 215 I 215

>Scas_711.11
          Length = 695

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 8/70 (11%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLW---- 396
           L T + D  V+LW L     ++  + H   +TC++F   D++  ++G +D  VR+W    
Sbjct: 552 LATGTRDGIVRLWDLRAGKVVRALEGHSGSITCLKF---DNKNIVTGSIDKTVRIWDLRS 608

Query: 397 SILENEITFE 406
            IL + +TFE
Sbjct: 609 GILSDMLTFE 618

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 55/153 (35%), Gaps = 25/153 (16%)

Query: 306 TNELNLYAPVFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTF 365
           TN  NL     + SC   F  H  ++  +  +  N LI+ S DRT++ W +     L+T 
Sbjct: 455 TNNSNLEPISSSASCIHTFDSHVDEITSVTVAGEN-LISGSQDRTIRQWDIPSGKCLQTI 513

Query: 366 QHQDFVTCVR--FHPTDDRFFI-------------------SGCLDHKVRLWSILENEIT 404
               FV         TD  F                     +G  D  VRLW +   ++ 
Sbjct: 514 DLS-FVAIASPPIQVTDSPFLTTTKATAIIGALQCFDAALATGTRDGIVRLWDLRAGKVV 572

Query: 405 FEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHV 437
              +      S+T    D K  + G+ +  V +
Sbjct: 573 RALEGHS--GSITCLKFDNKNIVTGSIDKTVRI 603

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 355 HLERQTSLKTFQ--HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           + E+ + + T Q  H D +TC+ F         +G LDH +++W +
Sbjct: 357 YFEKGSMINTIQKAHDDNITCLDFDLPFGTLCTAGHLDHVIKIWDL 402

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 37/71 (52%), Gaps = 2/71 (2%)

Query: 327 HTADVLDLDW-SKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFF 384
           HTA VL L + SK N L ++SMD ++K+W +   T LKT   H + V  +     D    
Sbjct: 96  HTAPVLSLVYTSKGNLLCSASMDESIKIWDVLTGTLLKTISAHSEPVVSIDMPVCDPSIL 155

Query: 385 ISGCLDHKVRL 395
            SG  D  +R+
Sbjct: 156 SSGSYDGLIRI 166

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 327 HTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFF 384
           H+  V    +S +N +L+++S D+TV+LW ++  +SL +++ H   V  V F P    +F
Sbjct: 475 HSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPL-GHYF 533

Query: 385 ISGCLDHKVRLWS 397
            +   D   RLWS
Sbjct: 534 ATASHDQTARLWS 546

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 321 FKIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHP 378
            +IF  H  DV  + +  N  ++ T S D+T ++W +    S++ F  H   V      P
Sbjct: 553 LRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSP 612

Query: 379 TDDRFFISGCLDHKVRLWSI 398
            D R+  +G  D  + +W I
Sbjct: 613 -DGRWLSTGSEDGIINVWDI 631

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 42/197 (21%), Positives = 70/197 (35%), Gaps = 36/197 (18%)

Query: 320 CFKIFKEHTADVLDLDWSKNNFLITSSM-DRTVKLWHL--------------ERQTSLKT 364
           C   F     D+  L++S +  L  +   D  +KLW L              E+  +   
Sbjct: 413 CMYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTL 472

Query: 365 FQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGK 424
             H   V    F P D+++ +S   D  VRLWS+            D  +SL    G   
Sbjct: 473 IGHSGTVYSTSFSP-DNKYLLSASEDKTVRLWSM------------DTYSSLVSYKGHNH 519

Query: 425 YTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDN 484
                +F+   H   T   +Q +     D      +    +I  G  +  ++C  + P N
Sbjct: 520 PVWDVSFSPLGHYFATASHDQTARLWSCD------HIYPLRIFAG-HLNDVDCVSFHP-N 571

Query: 485 SLRIVVTSSDSRIRIFD 501
              +   S+D   R++D
Sbjct: 572 GTYVFTGSTDKTCRMWD 588

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 2/79 (2%)

Query: 322 KIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPT 379
           ++F  HTA V+    S +  +L T S D  + +W +     LK  + H         +  
Sbjct: 596 RLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSK 655

Query: 380 DDRFFISGCLDHKVRLWSI 398
           +    +SG  DH VR+W +
Sbjct: 656 EGTVLVSGGADHSVRVWDL 674

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 64/141 (45%), Gaps = 12/141 (8%)

Query: 339 NNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWS 397
           N+ L T + D  V+LW L     ++  + H D +T ++F   D    ++G +D+ VR+W 
Sbjct: 515 NSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKF---DSEKLVTGSMDNSVRIWD 571

Query: 398 ILENEITFEFDCQDL-ITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSS---FHVVD 453
           +  + I  +    DL ++SL     DGK   VG   G V+V   +  E   +    H +D
Sbjct: 572 LRTSSI-LDVIAYDLPVSSLDF---DGKLITVGANEGGVNVFNMERDEHWMTPEPPHSLD 627

Query: 454 KNTQERNTASTKIHHGPRVTG 474
            +   R  A  K   G  + G
Sbjct: 628 GDELSRRIAIVKYKDGFLING 648

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 40/91 (43%), Gaps = 23/91 (25%)

Query: 328 TADVLDLDWSKNNFLITSSMDRTVKLW--HLERQTSL-------KTFQ-----------H 367
           T + + +D    N LIT S D T+KLW  +L R+  L       KT +           H
Sbjct: 380 TVNCMQIDKKNYNMLITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELH 439

Query: 368 QDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           +D +T + F   D    +SG  D K+  W +
Sbjct: 440 KDEITALSF---DSEALVSGSRDKKIFHWDL 467

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 32/77 (41%), Gaps = 2/77 (2%)

Query: 332 LDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLD 390
           LD D        +S  DR VK+W L     +     H   V C++    +    I+G  D
Sbjct: 341 LDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNMLITGSKD 400

Query: 391 HKVRLWSI-LENEITFE 406
             ++LW + L  EI  +
Sbjct: 401 ATLKLWDLNLSREIYLD 417

>Kwal_23.6324
          Length = 514

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 4/82 (4%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILE 400
           ++T S D T ++W     T + T + H ++V CV + P D     +G +D+ +RLW   +
Sbjct: 158 MVTGSGDNTARIWDCNTNTPMYTLKGHFNWVLCVAWCP-DGELIATGSMDNTIRLWDSNK 216

Query: 401 NEITFEF--DCQDLITSLTLSP 420
            E   E        ITSLT  P
Sbjct: 217 GESYGEALRGHAKWITSLTWEP 238

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 3/83 (3%)

Query: 317 NPSCFKIFKEHTADVLDLDWSKN-NFLITSSMDRTVKLWHLE-RQTSLKTFQHQDFVTCV 374
           N +    F+ H A V  + WS +   L++ S D T+K+W +  ++ S+    H D V  V
Sbjct: 432 NGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHNDEVYTV 491

Query: 375 RFHPTDDRFFISGCLDHKVRLWS 397
            +   D +   S   D  VR+W+
Sbjct: 492 DWS-VDGKRVCSAGKDKMVRIWT 513

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           L ++S D T+K+W   R+  + T   H + V+CV++         SG  D  +R W +
Sbjct: 250 LASASKDGTIKIWDTTRRVCVLTLSGHTNSVSCVKW--GGRGILYSGSHDKTIRAWDM 305

>KLLA0F15598g 1439610..1441046 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1 involved in 18S
           pre-rRNA production singleton, start by similarity
          Length = 478

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 44/79 (55%), Gaps = 2/79 (2%)

Query: 320 CFKIFKEHTADVLDLDWSK-NNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHP 378
              +FK+H + V+D+D+S   + ++T S D+T++++ ++   S + +  +      +   
Sbjct: 290 ALHVFKDHVSAVMDVDFSPTGDEVVTGSYDKTIRIYQVKHGHSREIYHTKRMQHIFQVKY 349

Query: 379 T-DDRFFISGCLDHKVRLW 396
           T D ++ +SG  D  VRLW
Sbjct: 350 TMDSKYIVSGSDDGNVRLW 368

>Scas_707.22
          Length = 730

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 315 VFNPSCFKIFKE---HTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDF 370
           +++    K  KE   H   V  L +  +  +++ S DR+V++W ++R      F+ H   
Sbjct: 380 IYDARSKKFLKELSGHEGGVWALKYDADGIIVSGSTDRSVRIWDIKRGCCTHVFKGHTST 439

Query: 371 VTCVRFHPTDD-RFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVG 429
           V C+      + ++ ++G  D+ + +W +++ E   +FD +  +  +  +P +  Y  VG
Sbjct: 440 VRCLEIVTYKNMKYIVTGSRDNTLHVWKLIKEE---KFDGE--LPMVYNTPEENPY-FVG 493

Query: 430 TFNGYV 435
              G++
Sbjct: 494 VLRGHM 499

>Scas_659.9
          Length = 475

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 10/83 (12%)

Query: 320 CFKIFKEHTADVLDLDWSK-NNFLITSSMDRTVKLW-----HLERQTSLKTFQHQDFVTC 373
              +FK+H + V+D+D+S   + ++T S D+T++++     H       K  QH   V  
Sbjct: 291 ALNVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFNTTHGHSREIYHTKRMQH---VFQ 347

Query: 374 VRFHPTDDRFFISGCLDHKVRLW 396
           V+F   D ++ +SG  D  VRLW
Sbjct: 348 VKF-SMDAKYIVSGSDDGNVRLW 369

>Kwal_27.12239
          Length = 316

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 57/121 (47%), Gaps = 10/121 (8%)

Query: 327 HTADVLDLDWS-KNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFF 384
           HTA V  + ++ K N L + SMD ++K+W +   T L+T   H + V  +   P D    
Sbjct: 98  HTAPVTSVKYTMKGNLLCSCSMDESIKIWDILSGTLLRTLSAHSEPVVSIDLPPFDPSIL 157

Query: 385 ISGCLDHKVRLWSILENE----ITFEFDCQDLITSLTLS----PGDGKYTIVGTFNGYVH 436
            SG  D  +R++          +T++ D Q     + +S      +GKY +V + +G + 
Sbjct: 158 SSGSYDGLIRIFDTATGHCLKTLTYDKDWQSENGVVPISQVKFSRNGKYLLVKSLDGILK 217

Query: 437 V 437
           +
Sbjct: 218 I 218

>Kwal_26.8628
          Length = 422

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 64/151 (42%), Gaps = 6/151 (3%)

Query: 323 IFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHP--- 378
           +FK HT  V  +++ +NN +IT+S D T  LW + +   +  F  H   V  +   P   
Sbjct: 170 MFKGHTCYVSQVEFFENNSIITASGDMTCALWDIPKAKRIAEFSDHLGDVLALALPPPHA 229

Query: 379 -TDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHV 437
            T    F SG  D  V +W          F   +   S      +G   + G  +G   +
Sbjct: 230 QTSSPIFASGGSDGYVYIWDTRARAAAQSFFVSESDISTLKFFNNGYAIVTGADDGVARM 289

Query: 438 LLTKGLEQVSSFHVVDKNTQERNTASTKIHH 468
              +    V+S+  + +N Q++  + T++++
Sbjct: 290 FDMRSDCAVASYS-LSQNLQQQANSPTRLYN 319

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLW 396
           ++T + D T  +W  + QT + T Q H ++V C  + P D     +G +D+ +RLW
Sbjct: 159 MVTGAGDNTACIWDCDTQTRMCTLQGHHNWVLCCSWSP-DGELIATGSMDNTIRLW 213

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           L T+S D T+K+W   R+  L T   H   V+CV++   +     SG  D  +R W +
Sbjct: 251 LATASKDGTIKIWDTTRRVCLLTLCGHTSSVSCVKWGGKN--VLYSGSHDKTIRCWDM 306

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 65/174 (37%), Gaps = 49/174 (28%)

Query: 320 CFKIFKEHTADVLDLDWSK-NNFLITSSMDRTVKLWHLERQTSLKTFQ------------ 366
           C   F+EHT+ V  + ++K    + +SS+D TV+ W L R  + +TF             
Sbjct: 379 CLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAV 438

Query: 367 ---------------------------------HQDFVTCVRFHPTDDRFFISGCLDHKV 393
                                            H+  V+C+ F   ++    S   D  +
Sbjct: 439 DPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSF-SQENSVLASASWDKTI 497

Query: 394 RLWSILENEITFE-FDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQV 446
           R+WSI       E  +    + +L++ P DGK   V T  G + +   +  +QV
Sbjct: 498 RIWSIFGRSQQVEPIEVYSDVLALSMRP-DGKEVAVSTLKGQISIFNIEDAKQV 550

 Score = 37.0 bits (84), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 72/169 (42%), Gaps = 38/169 (22%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL- 399
           ++T+S D  +K+W +     L TF +H   VT V+F       F S  LD  VR W ++ 
Sbjct: 360 VVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMF-SSSLDGTVRAWDLIR 418

Query: 400 -ENEITF------EFDCQDLITSLTLSPGDGKYTIVGTFNGY-VHVLLTKGLEQVSSFHV 451
             N  TF      +F+C      L + P  G+    G+ + + +HV        V +  +
Sbjct: 419 YRNFRTFTGTERIQFNC------LAVDPS-GEVVCAGSLDNFDIHVW------SVQTGQL 465

Query: 452 VDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIF 500
           +D         +   H GP    + C  +  +NS+ +   S D  IRI+
Sbjct: 466 LD---------ALSGHEGP----VSCLSFSQENSV-LASASWDKTIRIW 500

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 66/164 (40%), Gaps = 20/164 (12%)

Query: 340 NFLITSSMDRTVKLWHLERQTS-LKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWS 397
           + +++   D T+K+W        L+ FQ H   +  +RF   D + F+S   D  V++W 
Sbjct: 176 HLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKALRF-TEDCQSFLSSSFDRSVKIWD 234

Query: 398 ILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQ 457
               ++            +   P +    IVG  N  +              H  D+ ++
Sbjct: 235 TETGKVKTRLHLNSTPADVESRPTNPHEFIVGLSNSKI-------------LHYDDRVSE 281

Query: 458 ERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFD 501
            +    T  HH   ++ +   KY PD S + + +S D  +RI++
Sbjct: 282 NQGLVQTYDHH---LSSILALKYFPDGS-KFISSSEDKTVRIWE 321

>YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, contains seven WD
           (WD-40) repeats [1470 bp, 489 aa]
          Length = 489

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 44/80 (55%), Gaps = 10/80 (12%)

Query: 323 IFKEHTADVLDLDWSK-NNFLITSSMDRTVKLW-----HLERQTSLKTFQHQDFVTCVRF 376
           +FK+H + V+D+D+S   + ++T S D++++++     H       K  QH   V  V++
Sbjct: 300 VFKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH---VFQVKY 356

Query: 377 HPTDDRFFISGCLDHKVRLW 396
              D ++ ISG  D  VRLW
Sbjct: 357 -SMDSKYIISGSDDGNVRLW 375

>Kwal_23.6240
          Length = 913

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 5/93 (5%)

Query: 320 CFKIFKEHTADVLDLDWSK-NNFLITSSMDRTVKLWHLERQTSLKTFQHQDFV--TCVRF 376
           C   F+EHTA V  L ++K    L ++S+D TV+ W L R  + +TF   + +   C+  
Sbjct: 375 CLVTFQEHTAAVSALAFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAA 434

Query: 377 HPTDDRFFISGCLD-HKVRLWSILENEITFEFD 408
            P+ +    +G +D   V +WS+   ++    D
Sbjct: 435 DPSGE-VVCAGSVDSFAVHVWSVQTGQLVETLD 466

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 38/68 (55%), Gaps = 5/68 (7%)

Query: 322 KIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQ----TSLKTFQHQDFVTCVRF 376
           ++   H ++++ L WS+++ FLI++S D T ++W L+ Q     S+    H+D+V    F
Sbjct: 140 RVHAGHFSNIISLTWSRDSRFLISTSKDLTARIWSLDSQEKGLASVTFAGHRDYVMGAFF 199

Query: 377 HPTDDRFF 384
               +R +
Sbjct: 200 SADQERIY 207

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 68/169 (40%), Gaps = 38/169 (22%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL- 399
           ++T+S D  +K+W +     L TFQ H   V+ + F       F S  LD  VR W ++ 
Sbjct: 356 VVTASEDGKIKIWDVVSGFCLVTFQEHTAAVSALAFAKRGQVLF-SASLDGTVRAWDLVR 414

Query: 400 -ENEITF------EFDCQDLITSLTLSPGDGKYTIVGTFNGY-VHVLLTKGLEQVSSFHV 451
             N  TF      +F+C      L   P  G+    G+ + + VHV   +  + V +   
Sbjct: 415 YRNFRTFTAAERIQFNC------LAADPS-GEVVCAGSVDSFAVHVWSVQTGQLVETL-- 465

Query: 452 VDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIF 500
                          H GP    + C  +  +NS+ +   S D  IRI+
Sbjct: 466 -------------DGHEGP----VSCLSFSQENSV-LASASWDKTIRIW 496

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 32/69 (46%), Gaps = 5/69 (7%)

Query: 480 YEPDNSLRIVVTSSDSRIRIFDXXXXXXXXXXXGFQSGASQHKACLATVKGQQVVLSSSD 539
           Y PD S R+V  S D +I+I+D            FQ   +   A LA  K  QV+ S+S 
Sbjct: 349 YSPDGS-RVVTASEDGKIKIWDVVSGFCLVT---FQEHTAAVSA-LAFAKRGQVLFSASL 403

Query: 540 DHWVHGWKL 548
           D  V  W L
Sbjct: 404 DGTVRAWDL 412

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 327 HTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKT-FQHQDFVTCVRFHPTDDRFF 384
           H   VL +D S ++  +ITSS D+ +K+W L+     K+ F HQD +  V+F P    FF
Sbjct: 566 HKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFF 625

Query: 385 ISGCLDHKVRLW 396
            S   D  V+ W
Sbjct: 626 -SCSKDGTVKYW 636

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 3/84 (3%)

Query: 318 PSCFKIFKEHTADVLDLDWSKNNFLITSSM-DRTVKLWHLERQTSLKTFQ-HQDFVTCVR 375
           P       E  A+   L + +  F++     D T+K+W ++ QT L  F  H   +T +R
Sbjct: 65  PGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILR 124

Query: 376 FHPTDDRFFISGCLDHKVRLWSIL 399
           F  T  R  ISG  D  + LW ++
Sbjct: 125 FDQTGTR-LISGSRDATIILWDLV 147

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 39/91 (42%), Gaps = 19/91 (20%)

Query: 323 IFKEHTADVLDLDW-SKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVT--------- 372
           I + HTA +  LD  S    L+T+S D+TVK W  + +  L       FV          
Sbjct: 462 IEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTT 521

Query: 373 --------CVRFHPTDDRFFISGCLDHKVRL 395
                   CV+  P +DRF     LD+ V++
Sbjct: 522 LDLGEDLWCVKISP-EDRFLAVSLLDNTVKV 551

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 51/108 (47%), Gaps = 15/108 (13%)

Query: 338 KNNFLITSSMDRTVKLWHLER-QTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLW 396
           + N++IT + D+ + ++  +R Q  L+   H+  V  +++    D   +SG  D  VR+W
Sbjct: 376 EGNYIITGADDKRINVYDADREQFKLELVGHEGGVWALKY--AGDEILVSGSTDRTVRIW 433

Query: 397 SILENEITFEF-------DCQDLITSLTLSPGDGKYTIVGTFNGYVHV 437
           ++   + T  F        C D++       G  KY + G+ +  +HV
Sbjct: 434 NVKAGKCTHVFRGHTSTVRCLDVVEH-----GGIKYVVTGSRDNTLHV 476

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 47/107 (43%), Gaps = 21/107 (19%)

Query: 320 CFKIFKEHTADVLDLDWSKNN---FLITSSMDRTVKLWHLERQTS-------LKTFQHQD 369
           C  +F+ HT+ V  LD  ++    +++T S D T+ +W L    S       ++ F   +
Sbjct: 440 CTHVFRGHTSTVRCLDVVEHGGIKYVVTGSRDNTLHVWKLPDPNSPDYNPNAMRQFNSIE 499

Query: 370 ----FVTCVRFHPTDDR-------FFISGCLDHKVRLWSILENEITF 405
               FV  +R H    R         +SG  DH + +W I + ++ +
Sbjct: 500 DNPFFVGVLRGHMASVRTVSGHGNIVVSGSYDHNLMVWDIAKMKLLY 546

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 17/74 (22%), Positives = 37/74 (50%), Gaps = 2/74 (2%)

Query: 327 HTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVR-FHPTDDRFF 384
           H   V  L ++ +  L++ S DRTV++W+++       F+ H   V C+        ++ 
Sbjct: 406 HEGGVWALKYAGDEILVSGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDVVEHGGIKYV 465

Query: 385 ISGCLDHKVRLWSI 398
           ++G  D+ + +W +
Sbjct: 466 VTGSRDNTLHVWKL 479

>Kwal_26.7736
          Length = 507

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 2/79 (2%)

Query: 373 CVRFHPTDDRFFISGCLDHKVRLWSILE-NEITFEF-DCQDLITSLTLSPGDGKYTIVGT 430
             +FHP D R  ++   D  VR+W I +  E   E     D + S+ + P      + G+
Sbjct: 129 VAKFHPADSRTLVTASDDRVVRVWDITQAQEPQVELTGASDYVRSVCMVPQAPHLVVTGS 188

Query: 431 FNGYVHVLLTKGLEQVSSF 449
           ++G V +  T+  E+ ++ 
Sbjct: 189 YDGQVRLFDTRTNERATTL 207

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%)

Query: 342 LITSSMDRTVKLWHL--ERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
           L+T+S DR V++W +   ++  ++     D+V  V   P      ++G  D +VRL+   
Sbjct: 140 LVTASDDRVVRVWDITQAQEPQVELTGASDYVRSVCMVPQAPHLVVTGSYDGQVRLFDTR 199

Query: 400 ENE 402
            NE
Sbjct: 200 TNE 202

>Kwal_56.24163
          Length = 729

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWS 397
           +LITSS DRTVK+W  + ++ + T + H   V+   FHP+     +SG  D  +++W+
Sbjct: 57  YLITSSDDRTVKIWDYQTKSCVATLEGHMANVSYAVFHPS-LPIILSGSEDGTLKVWN 113

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 374 VRFHPTDDRFFISGCLDHKVRLWSI 398
           V F+P D   F S CLDH V++WS+
Sbjct: 3   VAFNPKDPSTFASACLDHTVKIWSL 27

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 344 TSSMDRTVKLWHLERQTSLKTFQHQDF--VTCVRFHPTDDR-FFISGCLDHKVRLW 396
           ++ +D TVK+W L + T+  T Q  +   V  V ++P  D+ + I+   D  V++W
Sbjct: 15  SACLDHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIW 70

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 321 FKIFKEHTADVLDLDWSKNNF-LITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPT 379
            + ++ H+  + DL+++ N     ++S D+ VK+W+ E+    K  +      C+ FHP 
Sbjct: 172 LRTYEGHSMTIKDLNFTDNGHSFASASFDKWVKIWNTEKGIIDKRLRFNSVPNCITFHPK 231

Query: 380 DDRFFISGCLDHKVRLWSILENE 402
           D    + G  + ++R + +  +E
Sbjct: 232 DKNQLVVGLSNSEIRHYDLRLSE 254

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 83/206 (40%), Gaps = 36/206 (17%)

Query: 365 FQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL-ENEITFEFDCQDL-ITSLTLSPGD 422
           + H++  T +RF P      +SG  D+ ++LW    E E+   ++   + I  L  +  +
Sbjct: 132 YGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLNFT-DN 190

Query: 423 GKYTIVGTFNGYVHVLLT-KGL----------EQVSSFHVVDKNTQERNTASTKI-HHGP 470
           G      +F+ +V +  T KG+              +FH  DKN      ++++I H+  
Sbjct: 191 GHSFASASFDKWVKIWNTEKGIIDKRLRFNSVPNCITFHPKDKNQLVVGLSNSEIRHYDL 250

Query: 471 RVT--------------GLECFKYEPDNSLRIVVTSSDSRIRIFDXXXXXXXXXXXGFQS 516
           R++               +   KY PD   +++ +S D  +RI++              S
Sbjct: 251 RLSENHGEVQKYDHHQGSILALKYFPDGK-KLISSSEDKTVRIWENRINIPIKQI----S 305

Query: 517 GASQHKACLATV--KGQQVVLSSSDD 540
           G +QH      +  +GQ     S D+
Sbjct: 306 GTAQHSMPWIDINPQGQSFCTQSMDN 331

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 2/74 (2%)

Query: 324 FKEHTADVLDLDWS-KNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDD 381
           F  HTA V+ L ++ K N L TSSMD ++K+W     + +KT   H + V  V     D 
Sbjct: 92  FIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSLMKTISAHSEAVVSVDVPMNDS 151

Query: 382 RFFISGCLDHKVRL 395
               SG  D  +R+
Sbjct: 152 SILSSGSYDGLIRI 165

>Kwal_27.12586
          Length = 509

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 54/113 (47%), Gaps = 4/113 (3%)

Query: 327 HTADVLDLDW-SKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFI 385
           H+A +   D+ S+NN L++ S D+T+++W     +S   F          F   DD+  I
Sbjct: 334 HSATITAFDFNSENNMLLSGSDDKTLRVWRSGSLSSSNCFMGNTLGITSAFWIDDDK-VI 392

Query: 386 SGCLDHKVRLWSILENEITFEFDCQDL-ITSLTLSPGDGKYTIVGTFNGYVHV 437
           +  LD  VRLWS L N +        + I   +LSP   K+ I G  +G V V
Sbjct: 393 ATSLDGSVRLWSHLTNTLQAISMVDGVPIFCGSLSPDKLKFAI-GKMDGEVTV 444

>Kwal_26.8776
          Length = 433

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 338 KNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLW 396
           ++  + ++S D+ VK W LER  +++ +  H   V  V  HPT D    S   D  VRLW
Sbjct: 175 RHPLMFSASEDKMVKCWDLERNAAIRDYHGHFSGVNTVDVHPTLD-LIASAGRDAVVRLW 233

Query: 397 SI 398
            I
Sbjct: 234 DI 235

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 33/176 (18%), Positives = 64/176 (36%), Gaps = 34/176 (19%)

Query: 354 WHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEF------ 407
           WH   +       H  +V CV   P D+ +F +G  D  +++W +   ++          
Sbjct: 107 WHAPWKLMRVINGHNGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMT 166

Query: 408 ----------------------DCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQ 445
                                  C DL  +  +    G ++ V T + +  + L     +
Sbjct: 167 VRSVAVSQRHPLMFSASEDKMVKCWDLERNAAIRDYHGHFSGVNTVDVHPTLDLIASAGR 226

Query: 446 VSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFD 501
            +   + D  T  R    T   H   +  ++CF  +P    +I+  SSD+ +R++D
Sbjct: 227 DAVVRLWDIRT--RLPVMTLAGHKSPINQVKCFPVDP----QIMSCSSDATVRLWD 276

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLW 396
           ++T + D T ++W  + QT L T + H ++V CV +   D     +G +D  +RLW
Sbjct: 157 MVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWS-ADGEVIATGSMDATIRLW 211

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 35/172 (20%), Positives = 64/172 (37%), Gaps = 43/172 (25%)

Query: 320 CFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLW----------------HLERQTSLK 363
           C      HT+ V  + W   N L ++S DRTV+ W                H     SL 
Sbjct: 268 CIYTLSGHTSSVSCIKWGGRNVLYSASHDRTVRCWDMAAGGKCINILKSHAHWVNHLSLS 327

Query: 364 T--------FQH----------------QDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
           T        F H                +++    + + T +   ++G  D  + LW+ L
Sbjct: 328 TDYALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLWNPL 387

Query: 400 ENE--ITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSF 449
           +    I      Q L+  +  SP DG+Y +  +F+  + +   +  + +++F
Sbjct: 388 KGSKPILRMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLWDGRDGKFIATF 438

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 5/64 (7%)

Query: 318 PSCFKIFKEHTADVLDLDWSKNNFLI-TSSMDRTVKLWHLERQTSLKTF--QHQDFVTCV 374
           P C    K H+  VL + WS +  +I T SMD T++LW  E+  SL      H  ++T +
Sbjct: 176 PLC--TLKGHSNWVLCVAWSADGEVIATGSMDATIRLWDSEKGQSLGDALRGHTKWITSL 233

Query: 375 RFHP 378
            + P
Sbjct: 234 SWEP 237

>KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces
           cerevisiae YDL195w SEC31 component of the COPII coat of
           ER-golgi vesicles, start by similarity
          Length = 1231

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 327 HTADVLDLDWSKN--NFLITSSMDRTVKLWHLERQTSLKTFQHQ-DFVTCVRFHPTDDRF 383
           H+  VL LDW K   N L++S  D T  LW+ +  + L  F  + ++V   +F P     
Sbjct: 250 HSKGVLSLDWCKQDENLLLSSGRDNTSVLWNPQEGSILTQFAPRGNWVFKSKFAPEAPDL 309

Query: 384 FISGCLDHKV 393
           F S   D K+
Sbjct: 310 FASASFDSKI 319

>CAGL0D05588g 533235..534668 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1, start by
           similarity
          Length = 477

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 55/105 (52%), Gaps = 5/105 (4%)

Query: 296 LEKLDQKISSTNELNLYAPVFNPS-CFKIFKEHTADVLDLDWSK-NNFLITSSMDRTVKL 353
           +E  +  ++S +    Y  + N S    +FK+H + V+D+D S     ++T+S D+T+++
Sbjct: 269 MEAFNFVVASEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDISPTGEEVVTASYDKTIRI 328

Query: 354 WHLERQTSLKTF--QHQDFVTCVRFHPTDDRFFISGCLDHKVRLW 396
           + + +  S + +  +    V   +F   D ++ +SG  D  VRLW
Sbjct: 329 FPINKGHSREIYHTKRMQHVFQAKF-SMDSKYVMSGSDDGNVRLW 372

>Scas_692.25
          Length = 488

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 3/64 (4%)

Query: 317 NPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ--HQDFVTCV 374
           N  C    K H + V DL   + N+L + S D+T++ W+LE    +K +   H  FVTC+
Sbjct: 395 NFKCIMTLKGHASWVKDLR-IRGNYLFSCSDDKTIRCWNLENGECVKQWTDLHSGFVTCL 453

Query: 375 RFHP 378
              P
Sbjct: 454 DMDP 457

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 67/164 (40%), Gaps = 20/164 (12%)

Query: 340 NFLITSSMDRTVKLWHL--ERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWS 397
           + +++   D TVKLW    +R+       H   +  + F  +D   F+SG  D +V++W 
Sbjct: 162 HLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDF-TSDSSQFLSGSYDQQVKIWD 220

Query: 398 ILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQ 457
               ++T   +      S    P  G   +VG  +  +    T+  E+     V D    
Sbjct: 221 TETGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSSSKIKHYDTRVSEKDGLVQVYD---- 276

Query: 458 ERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFD 501
                    HH   ++ +   KY PD S + + +S D  +RI++
Sbjct: 277 ---------HH---LSSILAIKYFPDGS-KFISSSEDKTLRIWN 307

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 37/89 (41%), Gaps = 1/89 (1%)

Query: 307 NELNLYAPVFNPSCFKIFKEHTADVLDLDW-SKNNFLITSSMDRTVKLWHLERQTSLKTF 365
           N + L+    +  C + F  H+  +  LD+ S ++  ++ S D+ VK+W  E     K  
Sbjct: 171 NTVKLWDFYHDRKCLRDFVGHSKPIKTLDFTSDSSQFLSGSYDQQVKIWDTETGKVTKRL 230

Query: 366 QHQDFVTCVRFHPTDDRFFISGCLDHKVR 394
                     F PT    F+ G    K++
Sbjct: 231 NTYSTPNSAEFRPTSGNEFVVGLSSSKIK 259

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 38/72 (52%), Gaps = 3/72 (4%)

Query: 327 HTADVLDLDWS-KNNFLITSSMDRTVKLWHLERQTSLKT-FQHQDFVTCVRFHPTDDRFF 384
           H   VL +D S  +  +ITSS D+ +K+W L+     K+ F HQD +  V+F P    FF
Sbjct: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPQSHNFF 631

Query: 385 ISGCLDHKVRLW 396
            S   D  V+ W
Sbjct: 632 -SCSKDAVVKYW 642

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 98/215 (45%), Gaps = 31/215 (14%)

Query: 304 SSTNELNLYAPVF---NPSCFKIFKEHT-------ADVLDLDWSKNNFLITSSMDRTVKL 353
           +S+N +  Y+  +   +P+     K HT        DV  +D S +N L+ ++ + ++K+
Sbjct: 357 TSSNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKI 416

Query: 354 WHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEI--TFEFDCQD 411
           W+++    ++TF+    +TC +F P      I G  + +++L+ +  + +  T E     
Sbjct: 417 WNIKTHKCIRTFECGYALTC-KFLP-GGLLVILGTRNGELQLFDLASSSLLDTIEDAHDA 474

Query: 412 LITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDK---NTQERNTASTKIHH 468
            I SL L+  DGK  + G+ +  V         +   F V +     T+ +     K+HH
Sbjct: 475 AIWSLDLTS-DGKRLVTGSADKTV---------KFWDFKVENSLVPGTKNKFLPVLKLHH 524

Query: 469 GPRVT---GLECFKYEPDNSLRIVVTSSDSRIRIF 500
              +     + C +  PD+   + ++  D+ +++F
Sbjct: 525 DTTLELTDDILCVRVSPDDRY-LAISLLDNTVKVF 558

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 56/115 (48%), Gaps = 14/115 (12%)

Query: 339 NNFLITSSMDRTVKLWHLERQTSLKT----FQHQDFVTCVRFHPTDDRFFISGCLDHKVR 394
           N  L+++S D T+++W   R  +L      + H   +T    H  DD   IS  +D  +R
Sbjct: 335 NKLLLSASDDNTLRVW---RGGNLNPSHVFYGHSQSITSA--HWVDDDTIISTSMDGSIR 389

Query: 395 LWSILENEITFEFDCQDLITSLT--LSPGDGKYTIVGTFNGYVHVL-LTKGLEQV 446
           +WS+  N  T      D + + T  LSP  GK+   GT +G V V  + K L+Q+
Sbjct: 390 VWSLASNS-TVASATVDGVPNFTGALSPDQGKFA-TGTLDGEVMVYDIQKLLQQL 442

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 39/83 (46%), Gaps = 2/83 (2%)

Query: 316 FNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVR 375
            NPS   +F  H+  +    W  ++ +I++SMD ++++W L   +++ +           
Sbjct: 355 LNPS--HVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTG 412

Query: 376 FHPTDDRFFISGCLDHKVRLWSI 398
               D   F +G LD +V ++ I
Sbjct: 413 ALSPDQGKFATGTLDGEVMVYDI 435

>CAGL0J08998g 882655..886500 highly similar to sp|P38968
           Saccharomyces cerevisiae YDL195w SEC31 component of the
           COPII coat of ER-golgi vesicles, start by similarity
          Length = 1281

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 104/241 (43%), Gaps = 23/241 (9%)

Query: 333 DLDWSKNNFLITSSMDR-TVKLW-------HLERQTSLKTFQHQDFVTCVRFHPTDDRFF 384
           DLDWS +N  I  +MD   V+++        L++Q S K   H   V  V+F+   +   
Sbjct: 67  DLDWSADNKYIAGAMDNGAVEIYEFNSSKQELKKQGSFKN--HSTVVRTVKFNSKQNNVL 124

Query: 385 ISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFN-GYVHVLLTKGL 443
           +SG    ++ +W  L   +  + + Q L   +++SP D  +++  ++N    HV  +   
Sbjct: 125 LSGGNSQEIFIWD-LNKLLDSKANYQPLTPGVSMSPIDEIHSL--SWNKSLAHVFASASN 181

Query: 444 EQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIV-VTSSDSR--IRIF 500
              +S   +    +  + + T  + G + +     ++ P NS R+   TS+D+   I ++
Sbjct: 182 SSFASIWDLKAKKEVIHLSYTSQNTGLK-SDFSAVEWHPLNSTRVATATSNDNEPLILVW 240

Query: 501 D--XXXXXXXXXXXGFQSGASQHKACLATVKGQQ---VVLSSSDDHWVHGWKLKSSTSLT 555
           D                 G    K  L+    QQ   ++LSS+ D  V  W  +S  +LT
Sbjct: 241 DLRNSNTPLQTLSAANNQGHGHSKGILSLDWCQQDENLLLSSARDSSVMLWNPQSGEALT 300

Query: 556 E 556
           E
Sbjct: 301 E 301

>CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces
           cerevisiae YOR269w PAC1, hypothetical start
          Length = 467

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 13/88 (14%)

Query: 320 CFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ--HQDFVTCV--- 374
           C    + HT+ V DL   + + L + S D T+K W L     +KT+   H +F+ C+   
Sbjct: 379 CVMTLRGHTSWVKDLK-LRGDHLFSCSDDETIKCWDLNTGNCVKTWSSIHNNFINCIDID 437

Query: 375 ------RFHPTDDR-FFISGCLDHKVRL 395
                 +F P+  R   +SG +D+KV++
Sbjct: 438 REATIEQFSPSLQREILVSGDMDNKVKI 465

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 6/63 (9%)

Query: 336 WSKNN--FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHK 392
           W K+N   L +SS D TVK+W +     L++F  H ++V  +      D + +SG LD  
Sbjct: 230 WQKDNDVLLASSSRDATVKVWRVNDSRCLQSFSPHSEWVKSIDVL---DEYILSGSLDST 286

Query: 393 VRL 395
           +RL
Sbjct: 287 LRL 289

>YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of the
           COPII coat of secretory pathway vesicles involved in
           endoplasmic reticulum to Golgi transport, associated
           with Sec13p, member of WD (WD-40) repeat family [3822
           bp, 1273 aa]
          Length = 1273

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 52/241 (21%), Positives = 98/241 (40%), Gaps = 29/241 (12%)

Query: 333 DLDWSKNNFLITSSMDR-TVKLWHLERQ----TSLKTF-QHQDFVTCVRFHPTDDRFFIS 386
           DLDWS NN +I  ++D  +++L+          S+  F  H   V  V+F+   D    S
Sbjct: 67  DLDWSHNNKIIAGALDNGSLELYSTNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLAS 126

Query: 387 GCLDHKVRLWSILENEITFEFDCQDLITSLT-LSPGDGKYTI-----VGTFNGYVHVLLT 440
           G  + ++ +W + +        C +  ++ T L+PG    ++     +       HV  +
Sbjct: 127 GGNNGEIFIWDMNK--------CTESPSNYTPLTPGQSMSSVDEVISLAWNQSLAHVFAS 178

Query: 441 KGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTS---SDSRI 497
            G    +S   +    +  + + T  + G +   L   ++ P NS R+   +   +D  I
Sbjct: 179 AGSSNFASIWDLKAKKEVIHLSYTSPNSGIK-QQLSVVEWHPKNSTRVATATGSDNDPSI 237

Query: 498 RIFD--XXXXXXXXXXXGFQSGASQHKACLATVKGQQVVLSSSDDHWVHGWKLKSSTSLT 555
            I+D             G Q G      C    + + ++LSS  D+ V  W  +S+  L+
Sbjct: 238 LIWDLRNANTPLQTLNQGHQKGILSLDWCH---QDEHLLLSSGRDNTVLLWNPESAEQLS 294

Query: 556 E 556
           +
Sbjct: 295 Q 295

 Score = 37.7 bits (86), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 40/88 (45%), Gaps = 5/88 (5%)

Query: 327 HTADVLDLDW--SKNNFLITSSMDRTVKLWHLERQTSLKTFQHQ-DFVTCVRFHPTDDRF 383
           H   +L LDW     + L++S  D TV LW+ E    L  F  + ++    +F P     
Sbjct: 256 HQKGILSLDWCHQDEHLLLSSGRDNTVLLWNPESAEQLSQFPARGNWCFKTKFAPEAPDL 315

Query: 384 FISGCLDHKVRLWSILENEITFEFDCQD 411
           F     D+K+ +   L+N +T   D Q+
Sbjct: 316 FACASFDNKIEV-QTLQN-LTNTLDEQE 341

>Kwal_27.12667
          Length = 721

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 40/93 (43%), Gaps = 3/93 (3%)

Query: 311 LYAPVFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQD 369
            Y P    S F    + +   LD D           +D +VK+W+L ++T +     H  
Sbjct: 389 FYEPGTQISSFPKAHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLA 448

Query: 370 FVTCVRFHPTDDRFFISGCLDHKVRLWSILENE 402
            V+C++    D    I+G  D  ++LW I + E
Sbjct: 449 SVSCMQME--DSHSLITGGRDALLKLWDIEKAE 479

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 35/87 (40%), Gaps = 18/87 (20%)

Query: 327 HTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSL--------------KTFQ-HQDFV 371
           H A V  +    ++ LIT   D  +KLW +E+   L               TF  H D +
Sbjct: 446 HLASVSCMQMEDSHSLITGGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFDAHVDEI 505

Query: 372 TCVRFHPTDDRFFISGCLDHKVRLWSI 398
           T + F   +    +SG  D  +R W +
Sbjct: 506 TALHF---EGNSLVSGSQDRTIRQWDL 529

>Scas_603.5
          Length = 589

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 2/72 (2%)

Query: 328 TADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHPTDDRFFIS 386
           T   LD D S          + ++K+W LE    +     H   VTC++ HP D +  I+
Sbjct: 296 TVTCLDFDLSTKMLYTAGKYNTSIKVWDLETNDQVMDLDDHIASVTCMQLHP-DSKTLIT 354

Query: 387 GCLDHKVRLWSI 398
           G  D  ++LW +
Sbjct: 355 GSKDATLKLWDL 366

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 319 SCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ 366
           SC   F+ HTA++  + +  N +L+++S D++++ W L     ++T +
Sbjct: 382 SCINTFEAHTAEITSVSYD-NEYLLSASRDKSIRQWDLTTGNCVQTLE 428

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 16/70 (22%)

Query: 342 LITSSMDRTVKLWH--LERQTSL----------KTFQ-HQDFVTCVRFHPTDDRFFISGC 388
           LIT S D T+KLW   L  QTSL           TF+ H   +T V +   D+ + +S  
Sbjct: 352 LITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVSY---DNEYLLSAS 408

Query: 389 LDHKVRLWSI 398
            D  +R W +
Sbjct: 409 RDKSIRQWDL 418

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 7/97 (7%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILE 400
           L T + D  V+LW L     ++T + H D VT ++F   D    ++G LD+ +R+W +  
Sbjct: 580 LATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQF---DSLNLVTGSLDNSIRIWDLRT 636

Query: 401 NEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHV 437
             +   F  +  +T L     D    +V    G V V
Sbjct: 637 GTLADTFSYEHPVTCLQF---DLNKIVVANQEGTVKV 670

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 322 KIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRF 376
           +  + H+  V  L +   N L+T S+D ++++W L   T   TF ++  VTC++F
Sbjct: 601 RTLEGHSDAVTSLQFDSLN-LVTGSLDNSIRIWDLRTGTLADTFSYEHPVTCLQF 654

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 74/195 (37%), Gaps = 34/195 (17%)

Query: 327 HTADVLDLDWSKNNFLITSSMDRTVKLWHLER----------QTSLKTFQ-HQDFVTCVR 375
           H A V  +   + N LIT   D  +K+W +++          +  + TF  H D +T + 
Sbjct: 453 HLATVSCMQMDQYNTLITGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEITALS 512

Query: 376 FHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSP---GDG------KYT 426
           F   +    +SG  D  +R W +   +     D  +  T   LS    G G       + 
Sbjct: 513 FEANN---LVSGSQDRTIRQWDLNNGKCVQTLDI-NFATGGNLSRSMIGSGFLNTNNDHP 568

Query: 427 IVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSL 486
           I+G    Y   L T   + +        + +      T   H   VT L+       +SL
Sbjct: 569 IIGAIQCYDAALATGTKDGIVRLW----DLRSGRVVRTLEGHSDAVTSLQF------DSL 618

Query: 487 RIVVTSSDSRIRIFD 501
            +V  S D+ IRI+D
Sbjct: 619 NLVTGSLDNSIRIWD 633

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 50/97 (51%), Gaps = 5/97 (5%)

Query: 327 HTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFF 384
           H  D+ D+ W+ ++  L+T  +DR+V +W+      LK F  HQ  V  V F P  +++F
Sbjct: 130 HDNDIQDICWAPDSSILVTVGLDRSVIVWNGLNFERLKRFDVHQSLVKGVIFDPA-NKYF 188

Query: 385 ISGCLDHKVRLWSILE-NEITFEFDCQDLITSLTLSP 420
            +   D  +R++   +  E++F  + Q ++     SP
Sbjct: 189 ATASDDRTMRVFRYHKTGEVSFTIE-QVIVEPFIASP 224

>Scas_713.50
          Length = 983

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 38/72 (52%), Gaps = 3/72 (4%)

Query: 327 HTADVLDLDWS-KNNFLITSSMDRTVKLWHLERQTSLKT-FQHQDFVTCVRFHPTDDRFF 384
           H   VL +D S  +  +ITSS D+ +K+W L+     K+ F HQD +  V+F P    FF
Sbjct: 610 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFF 669

Query: 385 ISGCLDHKVRLW 396
            S   D  ++ W
Sbjct: 670 -SCSKDGIIKYW 680

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 44/106 (41%), Gaps = 19/106 (17%)

Query: 308 ELNLYAPVFNPSCFKIFKEHTADVLDLDW-SKNNFLITSSMDRTVKLWHLERQTSL---- 362
           EL L+    +     I + H A +  LD  S    LIT S D++VK W+ + +  L    
Sbjct: 491 ELQLFDLASSTQIANIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGT 550

Query: 363 -------------KTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRL 395
                         T +  D +  VR  P +D+F     LD+ V++
Sbjct: 551 SDKFVPKLGLHHDTTLELSDDILSVRVSP-EDKFLAVSLLDNTVKV 595

 Score = 30.4 bits (67), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 32/49 (65%), Gaps = 1/49 (2%)

Query: 330 DVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHP 378
           D+  +D S +N L+ ++ + ++K+W+L+ +  ++TF+    +TC +F P
Sbjct: 431 DIRSIDISDDNKLLATASNGSLKIWNLKTKLCIRTFECGYALTC-KFLP 478

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 3/82 (3%)

Query: 320 CFKIFKEHTADVLDLDWSK-NNFLITSSMDRTVKLWHLERQTSLKTFQHQDFV--TCVRF 376
           C   F+EHT+ V  + ++K    L ++S+D TV+ W L R  + + F   + V  TC+  
Sbjct: 375 CLATFEEHTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAV 434

Query: 377 HPTDDRFFISGCLDHKVRLWSI 398
            P+ +           V +WS+
Sbjct: 435 EPSGEVVSAGSTDSFDVFVWSV 456

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
           ++T++ D  +K+W +     L TF+ H   VT V+F       F S  LD  VR W ++
Sbjct: 356 VVTAAEDGKIKVWDVASGFCLATFEEHTSAVTAVQFAKKGQVLF-SASLDGTVRAWDLI 413

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 321 FKIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHL---ERQTSLKTFQ-HQDFVTCVR 375
           +++   H  D+    WS ++ FL+T+S D T ++W +   +++    T   H+D+V    
Sbjct: 139 YRVHAGHFQDITSFTWSHDSRFLLTTSKDLTSRVWSINSEDKELVATTLAGHRDYVLGAY 198

Query: 376 FHPTDDRFF 384
           F+ T ++ +
Sbjct: 199 FNSTQEKIY 207

>CAGL0G03399g complement(325879..326988) highly similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2, start by
           similarity
          Length = 369

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 4/75 (5%)

Query: 326 EHTADVLDLDWSKNNFLITSS-MDRTVKLWHLERQTSLKTFQHQDFVTCVRF---HPTDD 381
           EH   VL   WS +   I S   D TVKL+ +    S +   H D V  +RF    PT+ 
Sbjct: 77  EHNGPVLCTRWSLDGARIASGGCDNTVKLYDVASGQSQQIGSHNDAVKSLRFVQCGPTNT 136

Query: 382 RFFISGCLDHKVRLW 396
              ++G  D  ++ W
Sbjct: 137 ECLVTGSWDKTIKFW 151

>ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1557
           bp, 518 aa]
          Length = 518

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 2/71 (2%)

Query: 327 HTADVLDLDWSKNNFLITSSMDRTVKLWHLER--QTSLKTFQHQDFVTCVRFHPTDDRFF 384
           H A V          L+T++ DR V++W +    + +L+     D+V  V F P      
Sbjct: 125 HPAHVTKFHPLDKQTLVTATDDRVVRVWDISHAYEPTLELLGASDYVRSVCFVPGAPHMV 184

Query: 385 ISGCLDHKVRL 395
           +SGC D  VRL
Sbjct: 185 VSGCYDGVVRL 195

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 4/80 (5%)

Query: 360 TSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILEN-EITFE-FDCQDLITSLT 417
            S+K   H   VT  +FHP D +  ++   D  VR+W I    E T E     D + S+ 
Sbjct: 118 VSIKASTHPAHVT--KFHPLDKQTLVTATDDRVVRVWDISHAYEPTLELLGASDYVRSVC 175

Query: 418 LSPGDGKYTIVGTFNGYVHV 437
             PG     + G ++G V +
Sbjct: 176 FVPGAPHMVVSGCYDGVVRL 195

>Scas_581.3
          Length = 626

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 27/59 (45%)

Query: 367 HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKY 425
           H   VT +RFHP +D    SG +D    LW    N++    D ++ + ++   P    Y
Sbjct: 490 HSSDVTSLRFHPQNDDLLCSGSMDWNCHLWDTFNNDLIDSIDLKEDVIAVQWLPDRDTY 548

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 51/107 (47%), Gaps = 8/107 (7%)

Query: 321 FKIFKEHTADVLD--LDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHP 378
           F+ F  H  DV+   +D  K + +I+ S D+++K+W ++         H D+V+ VR   
Sbjct: 100 FQTFVGHKGDVMSVAID-KKASMIISGSRDKSIKVWSIKGDCLATLIGHNDWVSQVRIAN 158

Query: 379 T---DDRF-FISGCLDHKVR-LWSILENEITFEFDCQDLITSLTLSP 420
           +   DD+   IS   D  V+ LW+       +     D + +L+ SP
Sbjct: 159 SSDDDDKVTVISAGNDKMVKVLWNSAAKVPMYTLSAGDEVYALSFSP 205

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 54/116 (46%), Gaps = 6/116 (5%)

Query: 322 KIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHPT 379
           K FK H+  V D   ++N  + ++ S D+T++LW +    + +TF  H+  V  V     
Sbjct: 59  KSFKGHSHIVQDCTLTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAIDKK 118

Query: 380 DDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTL---SPGDGKYTIVGTFN 432
                ISG  D  +++WSI  + +       D ++ + +   S  D K T++   N
Sbjct: 119 -ASMIISGSRDKSIKVWSIKGDCLATLIGHNDWVSQVRIANSSDDDDKVTVISAGN 173

>Kwal_47.17465
          Length = 800

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 327 HTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFF 384
           H  D+ D+ W+ ++  L+T  +DR+V +W+      +K F  HQ  V  V F P  +++F
Sbjct: 78  HDNDIQDICWAPDSSILVTVGLDRSVIVWNGSTFEKIKRFDVHQSLVKGVIFDPA-NKYF 136

Query: 385 ISGCLDHKVRLW 396
            +   D  VR++
Sbjct: 137 ATASDDRTVRIF 148

>Scas_720.45
          Length = 755

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 373 CVRFHPTDDRFFISGCLDHKVRLWSI 398
           CV F+P D   F SGCLD  V++WS+
Sbjct: 2   CVAFNPKDPNTFASGCLDRTVKVWSL 27

 Score = 37.4 bits (85), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWS 397
           +LITSS D T K+W  + ++ + T + H   V+   FHPT     ISG  D  +++W+
Sbjct: 57  YLITSSDDLTCKVWDYQTKSCVATLEGHMANVSFAVFHPT-LPIIISGSEDGTLKIWN 113

>Kwal_23.5035
          Length = 744

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 36/74 (48%), Gaps = 2/74 (2%)

Query: 327 HTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRF-HPTDDRFF 384
           H   V  L +  +  L++ S DR+V++W+++       F+ H   V C+        +F 
Sbjct: 409 HDGGVWALKYGHDGILVSGSTDRSVRVWNIKSGKCTHVFKGHTSTVRCLDIVEHNGKKFI 468

Query: 385 ISGCLDHKVRLWSI 398
           ++G  DH + +W +
Sbjct: 469 VTGSRDHTLHVWKL 482

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 27/131 (20%), Positives = 59/131 (45%), Gaps = 6/131 (4%)

Query: 310 NLYAPVFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQ 368
           N Y   F P      + HT  ++     +++++IT + D+ ++++  + +  +     H 
Sbjct: 352 NWYDSKFKPH-RTTLRGHTMKIVTCLQFEDDYVITGADDKMIRVYDAKTEKFITQLSGHD 410

Query: 369 DFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQ-DLITSLTLSPGDG-KYT 426
             V  +++    D   +SG  D  VR+W+I   + T  F      +  L +   +G K+ 
Sbjct: 411 GGVWALKY--GHDGILVSGSTDRSVRVWNIKSGKCTHVFKGHTSTVRCLDIVEHNGKKFI 468

Query: 427 IVGTFNGYVHV 437
           + G+ +  +HV
Sbjct: 469 VTGSRDHTLHV 479

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 2/63 (3%)

Query: 337 SKNNFLITSSMDRTVKLWHLERQTSLKTFQHQ-DFVTCVRFHPTDDRFFISGCLDHKVRL 395
           +++ ++ ++S D+ VK W LER T ++ F      V  V  HP+ D   +S   D  VR+
Sbjct: 166 ARHPYMFSASQDKLVKCWDLERNTVVRDFHGTLSGVHSVDLHPSLD-LIVSAGRDSVVRV 224

Query: 396 WSI 398
           W I
Sbjct: 225 WDI 227

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILE 400
           +++ S D TVKLW L     +KT   H+  V  + F+PT+   F S C D  +R W +++
Sbjct: 255 IVSCSTDATVKLWDLVAGKPMKTLTHHKRNVRDLAFNPTEFS-FASACTD-DIRSWKLVD 312

Query: 401 NEITFEFDCQDLITSLTLS 419
            ++   F+ + L    TL+
Sbjct: 313 GQLLTNFNSEALGIVNTLA 331

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 81/220 (36%), Gaps = 47/220 (21%)

Query: 354 WHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLI 413
           WH   + +     H  +V CV   P D+ +F +G  D  +R+W                 
Sbjct: 99  WHAPWKLTRVINGHTGWVRCVCVDPVDNAWFATGSNDSTIRVWD---------------- 142

Query: 414 TSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFH----------VVDKNTQERNTAS 463
               L+ G  K T+ G      H++  + +  +S+ H          +V     ERNT  
Sbjct: 143 ----LATGKLKVTLQG------HIMTVRDI-CISARHPYMFSASQDKLVKCWDLERNTVV 191

Query: 464 TKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFDXXXXXXXXXXXGFQSGASQHKA 523
              H    ++G+      P   L IV    DS +R++D           G + G      
Sbjct: 192 RDFHG--TLSGVHSVDLHPSLDL-IVSAGRDSVVRVWDIRSRSCVLTLAGHR-GPINKVR 247

Query: 524 CLATVKGQQVVLSSSDDHWVHGWKL---KSSTSLTESEKN 560
           CL  V  Q  ++S S D  V  W L   K   +LT  ++N
Sbjct: 248 CLP-VDPQ--IVSCSTDATVKLWDLVAGKPMKTLTHHKRN 284

>CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces
           cerevisiae YBR103w SIF2 SIR4P interacting protein, start
           by similarity
          Length = 535

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 317 NPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLW 354
           N +    F  HT  ++ L W  N+ LI++SMD +VKLW
Sbjct: 390 NGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLW 427

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 1/60 (1%)

Query: 337 SKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLW 396
           S+   L +++ D T+++WH     S+  F +    T V     ++   IS  +D  V+LW
Sbjct: 369 SETKLLASAADDNTIRVWHGGNGNSIHCF-YGHTQTIVSLKWVNNDMLISASMDGSVKLW 427

>KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces
           cerevisiae YDR142c PAS7 peroxisomal import protein -
           peroxin singleton, start by similarity
          Length = 372

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 323 IFKEHTADVLDLDWS--KNNFLITSSMDRTVKLWHLERQTSLKTFQHQD 369
           I+KEH  +V   +W+  +    ++SS D  VKLW L R  SL T    D
Sbjct: 99  IYKEHQREVFSCNWNMIQKQMFVSSSWDGKVKLWSLMRPQSLMTMSPND 147

>Kwal_23.5351
          Length = 474

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 63/148 (42%), Gaps = 12/148 (8%)

Query: 300 DQKISSTNELNLYAPVFNPSCFK-------IFKEHTADVLDLDW-SKNNFLITSSMDRTV 351
           D ++ +T   +    ++NP           + + H A V  + +   + F+ ++S D T 
Sbjct: 236 DSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTW 295

Query: 352 KLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQ 410
           +LW +ER+T L+  + H   V C+ F   D     S  LD    +W +         +  
Sbjct: 296 RLWDVERETELQLQEGHAKEVYCLDFQ-CDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGH 354

Query: 411 -DLITSLTLSPGDGKYTIVGTFNGYVHV 437
              I  ++ SP +G +   G+ +G V V
Sbjct: 355 AKPIYGVSWSP-NGHHVATGSGDGTVQV 381

>Kwal_27.10385
          Length = 536

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 328 TADVLDLDWSKN-NFLITSSMDRTVKLWHLERQTSL-KTFQHQDFVTCVRFHPTDDRFFI 385
           ++++ DL WS + N+++T SMD +++++ +E  T +     H  +V  V + P ++ F  
Sbjct: 136 SSEIYDLAWSPDDNYIVTGSMDNSLRIFEVEEGTCVANAADHNHYVQGVVWDPQNE-FIF 194

Query: 386 SGCLDHKVRLWSI 398
           S   D  V ++ I
Sbjct: 195 SQSADRSVHVYRI 207

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 49/113 (43%), Gaps = 17/113 (15%)

Query: 320 CFKIFKEHTADVLDLDWSKN-NFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRF-- 376
            FK  K HTA+V  + + K  + ++++S D  V++W+  +        H D V C++   
Sbjct: 48  VFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNFPKLRE----GHMDEVECIQVIK 103

Query: 377 --------HPTDDRFFISGCLDHKVRLWSILENEITF--EFDCQDLITSLTLS 419
                           + GC D  + +WS +E++     EF  Q  +  L LS
Sbjct: 104 HHKHTITVFAVLKNLLVVGCADGSISVWSFIEDQYVLQEEFSVQKGVFPLCLS 156

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 71/190 (37%), Gaps = 32/190 (16%)

Query: 334 LDWSKNNF-LITSSMDRTVKLWHLE-----------------RQTSLKTFQHQDFVTCVR 375
           L W K    L+TS+ D  V +W  +                 +  S  T     F +C+ 
Sbjct: 285 LQWHKTKLQLLTSTADTAVMVWEPDTISGIWICSSRLGELSSKGASTATGSSGGFWSCIW 344

Query: 376 F-HPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGY 434
           F H   D    +G    K   W I  +     +D +  IT  T S  D  ++I G +   
Sbjct: 345 FTHDGKDVILTNG----KTGSWRIWTSTDGLLWDQELGITGATKSVTDVAWSIDGNY--- 397

Query: 435 VHVLLTKGLEQVSSFHV---VDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVT 491
              LL+  L+Q +        + +  ER T S      P++ G +    EP ++ R V  
Sbjct: 398 ---LLSTSLDQTTRLFAEWKYETSGVERKTPSWCEMARPQIHGYDMLCVEPISNTRFVSG 454

Query: 492 SSDSRIRIFD 501
             +  +R FD
Sbjct: 455 GDEKILRSFD 464

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 45/98 (45%), Gaps = 6/98 (6%)

Query: 308 ELNLYAPVFNPSCFKIFK-EHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ 366
           E ++   VF P C  + + E T  +L +  +  N  I S +  +  +  LE  T L+   
Sbjct: 143 EFSVQKGVF-PLCLSMHEIEKTQFILAIGGTNVNVFIYSLVSNSEGVSKLEFATKLE--G 199

Query: 367 HQDFVTCVRFHPT--DDRFFISGCLDHKVRLWSILENE 402
           H+D++  + F  T   D    SG  D  +RLW I  NE
Sbjct: 200 HEDWIKSLVFRETVPGDYLLASGSQDRYIRLWRIRTNE 237

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 5/48 (10%)

Query: 317 NPSCFKIFKE--HTADVLDLDW---SKNNFLITSSMDRTVKLWHLERQ 359
           N    + FKE  H+  + D DW   +K    IT+S D+T+K W L ++
Sbjct: 641 NSFVLRSFKEKPHSRIIWDADWVPLAKGLAFITASRDKTLKFWRLSKE 688

>Scas_720.95
          Length = 515

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLW 396
           ++T + D T ++W  + QT   T   H ++V CV + P  +    +G +D+ +RLW
Sbjct: 159 MVTGAGDNTARIWDCDTQTPKATLTGHFNWVLCVSYCPNGE-VIATGSMDNTIRLW 213

>YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal
           biogenesis protein (peroxin) that serves as import
           receptor for proteins containing peroxisomal targeting
           signal 2 (PTS2), member of WD (WD-40) repeat family
           [1128 bp, 375 aa]
          Length = 375

 Score = 37.4 bits (85), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 309 LNLYAPVFNPSCFKIFKEHTADVLDLDW---SKNNFLITSSMDRTVKLWHLERQTSLKTF 365
           L L+   F      IFKEH  +V   +W   ++ NFL +SS D ++K+W   R+ SL T 
Sbjct: 85  LRLFDTTFKEFPIAIFKEHEREVFSCNWNLVNRQNFL-SSSWDGSIKIWSPLRKQSLMTL 143

>Scas_718.6*
          Length = 546

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 48/99 (48%), Gaps = 5/99 (5%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
            L +S  D ++++WH +++     F  H   +  + +   +D   IS  +D  VR+WS++
Sbjct: 384 LLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW--INDDLVISASMDGSVRIWSVV 441

Query: 400 EN-EITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHV 437
           EN  +       + I    +S    K+ I G+ NG ++V
Sbjct: 442 ENCLVGMAMVDGNAIICGKISHDKNKFAI-GSMNGQINV 479

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 17/81 (20%), Positives = 41/81 (50%), Gaps = 2/81 (2%)

Query: 319 SCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWH-LERQTSLKTFQHQDFVTCVRFH 377
           +C   F  H+  ++ L W  ++ +I++SMD +V++W  +E           + + C +  
Sbjct: 403 NCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKIS 462

Query: 378 PTDDRFFISGCLDHKVRLWSI 398
              ++F I G ++ ++ ++ I
Sbjct: 463 HDKNKFAI-GSMNGQINVYDI 482

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/66 (18%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 332 LDLDWSKNNFLITSSMDRTVKLWHLERQTSL-KTFQHQDFVTCVRFHPTDDRFFISGCLD 390
           +D++W   + L+   ++ ++ ++ ++    + K   HQ  ++C+ F+        S   D
Sbjct: 332 VDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSD 391

Query: 391 HKVRLW 396
           + +R+W
Sbjct: 392 YSIRIW 397

 Score = 30.0 bits (66), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 91/211 (43%), Gaps = 34/211 (16%)

Query: 298 KLDQKISSTNELNLYAPVFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDR-TVKLWHL 356
           K D+KI S+  L L  P    +   I    T  +  L WS +  LI +S++   ++LW+ 
Sbjct: 213 KEDKKIISS--LELRHPF---ALSSITGRKTNQITALSWSPDGELIITSVENGELRLWNK 267

Query: 357 E-RQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITS 415
           + R  ++  F H+  +  ++++  D + FIS  LD+   LW+ +   I   F+ +  + +
Sbjct: 268 DGRLQNVFNF-HRSPIVSIKWNE-DSKHFISLDLDNITILWNAINGIILQHFEPEQKLEN 325

Query: 416 LTLSPG------DGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQERNTASTKIHHG 469
            T S G      D    +V   NG + V            + +D N   +       H G
Sbjct: 326 NTESLGVDIEWVDKDKLVVPGVNGSILV------------YSIDDN---KPIGKLLGHQG 370

Query: 470 PRVTGLECFKYEPDNSLRIVVTSSDSRIRIF 500
                + C ++  ++ L +  + SD  IRI+
Sbjct: 371 T----ISCIEFNVNSRLLLTSSDSDYSIRIW 397

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 37.4 bits (85), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 72/177 (40%), Gaps = 24/177 (13%)

Query: 327 HTADVLDLDWSKN-NFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFI 385
           H   +  LDW  + N L++   D  VKLW +   +  +   H   V+ V+ HP+  R   
Sbjct: 214 HEGKIGGLDWHPDGNHLLSGGGDNLVKLWDMTSNSFEELRGHAGRVSRVKVHPS-GRLAA 272

Query: 386 SGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQ 445
           S   D    LW  LE ++            L L  G  K      F     +L + GL+ 
Sbjct: 273 SASFDLTWILWD-LERKV-----------ELQLQEGHSKAVYTIAFQSDGALLASAGLDA 320

Query: 446 VSSFHVVDKNTQERNTASTKIH-HGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFD 501
           V +  + D  + E      K+  H   ++G++   + P N  ++    +D  +R++D
Sbjct: 321 VCA--IWDLRSGE---PIMKLEGHAGAISGVD---WSP-NGYQLATAGADGTVRVWD 368

>KLLA0F21406g complement(1996260..1998377) similar to sp|P47025
           Saccharomyces cerevisiae YJL112w MDV1, start by
           similarity
          Length = 705

 Score = 37.4 bits (85), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILE 400
           L T + D  V+LW L     ++  + H D +T ++F   D    ++G +D  +R+W +  
Sbjct: 570 LATGTKDGIVRLWDLRSGKVVRMLEGHTDAITSLQF---DSVNLVTGAMDRSIRIWDLRT 626

Query: 401 NEITFEFDCQDLITSL 416
             ++  F  +  ITSL
Sbjct: 627 GILSDVFAYEQPITSL 642

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 9/79 (11%)

Query: 325 KEHTADV--LDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDD 381
           K H  D+  LD D          S+D +VK+W L ++  + T   H   ++C++     D
Sbjct: 394 KAHDEDITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQIATLHGHLASISCMQI----D 449

Query: 382 RF--FISGCLDHKVRLWSI 398
           ++   I+G  D  ++LW I
Sbjct: 450 QYSTLITGGRDAVLKLWDI 468

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 320 CFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRF 376
             ++ + HT  +  L +   N L+T +MDR++++W L        F ++  +T + F
Sbjct: 589 VVRMLEGHTDAITSLQFDSVN-LVTGAMDRSIRIWDLRTGILSDVFAYEQPITSLHF 644

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 36/86 (41%), Gaps = 17/86 (19%)

Query: 327 HTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTS-------------LKTFQ-HQDFVT 372
           H A +  +   + + LIT   D  +KLW +++  +             L TF  H D +T
Sbjct: 439 HLASISCMQIDQYSTLITGGRDAVLKLWDIDKAMADEASNSSEDNDACLYTFDSHVDEIT 498

Query: 373 CVRFHPTDDRFFISGCLDHKVRLWSI 398
            + F   D    +SG  D  VR W +
Sbjct: 499 AISF---DGDNLVSGSQDRTVRQWDL 521

>Kwal_26.8953
          Length = 458

 Score = 37.0 bits (84), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 10/90 (11%)

Query: 313 APVFNPS-----CFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLK--TF 365
           AP  NP+       K  K H++ V D+   + NF+I+ S DR+V++W LE   +++  T 
Sbjct: 365 APQPNPARAHFTLVKTLKGHSSWVRDIR-VRGNFIISCSDDRSVRVWDLETGETVREITD 423

Query: 366 QHQDFVTCV--RFHPTDDRFFISGCLDHKV 393
            H  F  C+       + +  +SG  D KV
Sbjct: 424 SHTGFANCIDTDCGGLNRQLLVSGGADGKV 453

>Sklu_2317.3 YDR142C, Contig c2317 5804-6910
          Length = 368

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 2/45 (4%)

Query: 323 IFKEHTADVLDLDWSKNN--FLITSSMDRTVKLWHLERQTSLKTF 365
           IF+EH  +V   +W+  N    ++SS D TVK+W   RQ SL T 
Sbjct: 99  IFQEHQKEVFSCNWNLVNKQTFVSSSWDGTVKIWSPMRQESLTTL 143

>Scas_442.2*
          Length = 795

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 83/189 (43%), Gaps = 25/189 (13%)

Query: 327 HTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDD---- 381
           HT  V  L +S ++ +L++   DR   +W  + +T   T +++      R     D    
Sbjct: 615 HTLTVTKLRFSPDSKYLLSVCRDRQWVVWERDPETDKFTLKYKTAKPHTRIIWDGDWAPL 674

Query: 382 ---RFFISGCLDHKVRLWSILENEITFEFD----CQDLITSLTL--SPGDGKYTIV-GTF 431
                F++G  D  ++LW   EN+  F+ +       L+T+L++  S  DG+  I  G  
Sbjct: 675 EFGNVFVTGSRDRTIKLWKFDENKSNFDLENSLNMTSLVTALSVXDSVLDGRLLIAXGLE 734

Query: 432 NGYVHVLLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVT 491
           +G +++      +  S F VV+         +  I    ++T L   + + +N L +   
Sbjct: 735 DGSIYIY---KYDSTSGFDVVE-------VLNDLITPAEKLTRLRWSRSQRNNKLWLAAA 784

Query: 492 SSDSRIRIF 500
           SSD+  RI+
Sbjct: 785 SSDTSTRIY 793

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 3/44 (6%)

Query: 321 FKIFKEHTADVLDLDWSK---NNFLITSSMDRTVKLWHLERQTS 361
           +K  K HT  + D DW+     N  +T S DRT+KLW  +   S
Sbjct: 656 YKTAKPHTRIIWDGDWAPLEFGNVFVTGSRDRTIKLWKFDENKS 699

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 5/59 (8%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ----HQDFVTCVRFHPTDDRFFISGCLDHKVRLW 396
           ++     +T+ LW+   + S   F     H+  VTCV+F  TD  + +S   DH V++W
Sbjct: 29  IVAFGAGQTIALWNPLDENSQGVFATLKGHEAEVTCVKF-ITDTPYMVSCSEDHHVKIW 86

>ADL218C [1523] [Homologous to ScYNL035C - SH] (319676..320887)
           [1212 bp, 403 aa]
          Length = 403

 Score = 36.6 bits (83), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 347 MDRTVKLWHL-ERQTSLKTF--QHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENE 402
           +D  V L+ L E    L+ F   H D VT V+FHPTD    +SG  D  V ++ + ++E
Sbjct: 123 VDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSE 181

>Scas_397.2
          Length = 410

 Score = 36.6 bits (83), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 41/67 (61%), Gaps = 2/67 (2%)

Query: 304 SSTNELNLYAPVFNPSCFKIFKEHTADVLD-LDWSKNNFLITSSMDRTVKLWHLERQTSL 362
           SS  +L L++ + + SC +IF+ HT+ + D +   +    ++SS+D T+KLW     +++
Sbjct: 158 SSDMQLKLWS-IKDASCPRIFRGHTSKITDSVLIERGRDFVSSSLDGTMKLWECGSGSTV 216

Query: 363 KTFQHQD 369
           +TF  ++
Sbjct: 217 RTFMRRE 223

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 37.0 bits (84), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 87/201 (43%), Gaps = 41/201 (20%)

Query: 327 HTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFF 384
           H  D+ D+ W+ ++  L+T  +DR+V +W+      LK F  HQ  V  V F P  +++F
Sbjct: 136 HDNDIQDICWAPDSSILVTVGLDRSVIVWNGSTFEKLKRFDVHQSLVKGVVFDPA-NKYF 194

Query: 385 ISGCLDHKVRLWSI---------LENEITFEFDCQDLITSL---TLSPGDGKYTIVGTFN 432
            +   D  ++++           +E+ IT  F    L T     + SP      +    N
Sbjct: 195 ATTSDDRTMKIFRYHKTGDISFTIEHIITEPFKESPLTTYFRRPSWSPDGQHIAVPNATN 254

Query: 433 GYVHVLLTKGLEQVSSFHVVDKNTQERNT------ASTKI-HHGPRV----TGLECFK-Y 480
           G            VSS  +V++ T + N       A T++    PR+     G++  K  
Sbjct: 255 G-----------PVSSMAIVNRGTWDTNVSLIGHDAPTEVARFNPRLFERNAGVKQKKDD 303

Query: 481 EPDNSLRIVVTSSDSRIRIFD 501
           +P+N+L   V  +D ++  FD
Sbjct: 304 DPENAL---VGQNDDKVHHFD 321

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score = 36.6 bits (83), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 17/74 (22%), Positives = 37/74 (50%), Gaps = 2/74 (2%)

Query: 327 HTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDD-RFF 384
           H   V  L ++    L++ S DRTV++W +++      F+ H   V C+      + ++ 
Sbjct: 421 HDGGVWALKYAHGGILVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKNIKYI 480

Query: 385 ISGCLDHKVRLWSI 398
           ++G  D+ + +W +
Sbjct: 481 VTGSRDNTLHVWKL 494

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 71/167 (42%), Gaps = 24/167 (14%)

Query: 287 STNFRRAQTLEKLDQ----KISSTNEL----NLYAPVFNPSCFKIFKEHTADVLDLDWSK 338
           S N + +Q   KL Q    ++S    +    N Y P F P      + H   V+     +
Sbjct: 333 SLNLKLSQKYPKLSQQDRLRLSFLENIFILKNWYNPKFVPQR-TTLRGHMTSVITCLQFE 391

Query: 339 NNFLITSSMDRTVKLWH-LERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWS 397
           +N++IT + D+ ++++  + ++  L+   H   V  +++        +SG  D  VR+W 
Sbjct: 392 DNYVITGADDKMIRVYDSINKKFLLQLSGHDGGVWALKY--AHGGILVSGSTDRTVRVWD 449

Query: 398 ILENEITFEFD-------CQDLITSLTLSPGDGKYTIVGTFNGYVHV 437
           I +   T  F        C D++    +     KY + G+ +  +HV
Sbjct: 450 IKKGCCTHVFKGHNSTVRCLDIVEYKNI-----KYIVTGSRDNTLHV 491

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 3/75 (4%)

Query: 320 CFKIFKEHTADV--LDLDWSKN-NFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRF 376
           C  +FK H + V  LD+   KN  +++T S D T+ +W L +++S+     +     V  
Sbjct: 455 CTHVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFH 514

Query: 377 HPTDDRFFISGCLDH 391
            P ++ +F+     H
Sbjct: 515 TPEENPYFVGVLRGH 529

>Kwal_56.23920
          Length = 937

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 66/150 (44%), Gaps = 20/150 (13%)

Query: 300 DQKISSTNELNLYAPVFNPSCFKIFKE---HTADVLDLDWS-KNNFLITSSMDRTVKLWH 355
           D ++ + + L+    VF     K F     H   VL +D S  +  LITSS D+ +K+W 
Sbjct: 536 DNRLLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWG 595

Query: 356 LERQTSLKT-FQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDC----- 409
           L+     ++ F H D +  V F P    FF S   D  V+ W         +F+C     
Sbjct: 596 LDFGDCHRSLFAHNDSIMKVVFVPESHNFF-SCSKDALVKYWD------GDKFECIQKLA 648

Query: 410 --QDLITSLTLSPGDGKYTIVGTFNGYVHV 437
             Q  + +L +S  DG++ +  + +  + V
Sbjct: 649 AHQKEVWTLAIS-SDGRFVVSASHDQSIRV 677

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 327 HTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHP 378
           H +DV  +D S +N L+ ++ + T+K+W+++  + ++TF+    + C +F P
Sbjct: 384 HRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCIRTFECGYALAC-KFLP 434

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/74 (22%), Positives = 37/74 (50%), Gaps = 2/74 (2%)

Query: 327 HTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDD-RFF 384
           H   V  L ++ N  L++ S DR+V++W++        F+ H   V C+     +  ++ 
Sbjct: 408 HDGGVWALKYAGNGILVSGSTDRSVRIWNIHLGKCTHVFKGHTSTVRCLDIVEHEGVKYI 467

Query: 385 ISGCLDHKVRLWSI 398
           ++G  D+ + +W +
Sbjct: 468 VTGSRDNTLHIWKL 481

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 61/131 (46%), Gaps = 6/131 (4%)

Query: 310 NLYAPVFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWH-LERQTSLKTFQHQ 368
           N Y P F P      K H   V+     ++N++IT + D+ ++++  + ++  ++   H 
Sbjct: 351 NWYNPDFIPQ-RTTLKGHMTSVVTCLQFEDNYVITGADDKMIRIYDSITKKFLIELSGHD 409

Query: 369 DFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQ-DLITSLTLSPGDG-KYT 426
             V  +++    +   +SG  D  VR+W+I   + T  F      +  L +   +G KY 
Sbjct: 410 GGVWALKY--AGNGILVSGSTDRSVRIWNIHLGKCTHVFKGHTSTVRCLDIVEHEGVKYI 467

Query: 427 IVGTFNGYVHV 437
           + G+ +  +H+
Sbjct: 468 VTGSRDNTLHI 478

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 44/110 (40%), Gaps = 29/110 (26%)

Query: 320 CFKIFKEHTADVLDLDWSKNN---FLITSSMDRTVKLWHLERQTSLKT------------ 364
           C  +FK HT+ V  LD  ++    +++T S D T+ +W L + +                
Sbjct: 442 CTHVFKGHTSTVRCLDIVEHEGVKYIVTGSRDNTLHIWKLPQMSDSNIDEGMPNVYSNNG 501

Query: 365 --FQHQD-----FVTCVRFHPTD-------DRFFISGCLDHKVRLWSILE 400
             F H       FV  +R H           R  ISG  D+ + +W I++
Sbjct: 502 PLFFHSPEENPYFVGVLRGHIASVRTVSGHGRIVISGSYDNNLIVWDIIQ 551

>Kwal_26.7570
          Length = 218

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 320 CFKIFKEHTADVLDLDWSKN-NFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHP 378
           C + F  H +DVL +   +  + ++++S D+TVK+W+   +  +    H D+V+ VR  P
Sbjct: 99  CIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNTLGECMVTLLGHNDWVSQVRVAP 158

Query: 379 TD 380
            +
Sbjct: 159 NE 160

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 62/158 (39%), Gaps = 10/158 (6%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILE 400
           +++ S D TV+LW +    +LK    H+  V  +  HP +  F IS      +R W + E
Sbjct: 271 VVSCSADATVRLWDITAGKTLKVLTHHKRSVRDIGIHPGE--FSISSACTDDIRSWKLPE 328

Query: 401 NEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTK---GLEQVSSFHVVDKNTQ 457
            ++   F  +      TLS         G+ NG +     K     +Q+ +  +      
Sbjct: 329 GQLLTNFQSEKTGIINTLSINQDDVLFAGSDNGVLSFYDYKTGHKYQQLDTTEIPGSLES 388

Query: 458 ERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDS 495
           ER   ++        TGL     E D S++I     D+
Sbjct: 389 ERGILTSTFDQ----TGLRLITGESDKSIKIWKQDQDA 422

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 327 HTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFF 384
           H   V D+  SK + ++ ++S D+ VK W LE+   ++ +  H   V  V  HPT +   
Sbjct: 171 HIMTVKDICISKRHPYMFSASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHPTLNLIA 230

Query: 385 ISGCLDHKVRLWSI 398
            +G  D  VRLW I
Sbjct: 231 TAG-RDSVVRLWDI 243

>YNL035C (YNL035C) [4552] chr14 complement(568520..569689) Protein
           containing three WD domains (WD-40 repeats), which may
           mediate protein-protein interactions, has moderate
           similarity to uncharacterized C. albicans Orf6.3370p
           [1170 bp, 389 aa]
          Length = 389

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 347 MDRTVKLWHLER-QTSLKTF--QHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENE 402
           +D  V ++ + +  T L++    H D VTC++FHP+D    +SG  D    ++ + ++E
Sbjct: 124 IDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 56/116 (48%), Gaps = 16/116 (13%)

Query: 327 HTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFF 384
           H  D+ D+ W+ ++  L+T  +DR++ +W+      +K F  HQ  V  V F P  +++F
Sbjct: 133 HDNDIQDICWAPDSSILVTVGLDRSIIVWNGSTFEKIKRFDVHQSHVKGVVFDPA-NKYF 191

Query: 385 ISGCLDHKVRLWSI---------LENEITFEFDCQDLIT---SLTLSPGDGKYTIV 428
            +   D  V+++           +E+ IT  F    L T    L+ SP DG++  V
Sbjct: 192 ATASDDRTVKVFRYHKGTDLSFTIEHIITEPFQGSPLTTYFRRLSWSP-DGQHIAV 246

>Scas_605.18
          Length = 424

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 50/123 (40%), Gaps = 7/123 (5%)

Query: 323 IFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHP--- 378
           IFK HT  + D+++  N+ +ITSS D T  LW + +   ++ +  H   V  +   P   
Sbjct: 175 IFKGHTCYISDIEFLDNSHIITSSGDMTCALWDIPKAKRVREYADHLGDVLALALPPPSA 234

Query: 379 ---TDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYV 435
              T    F S   D    +W    +    +F   D   +      DG   + G  +G +
Sbjct: 235 DENTGANIFASCGSDGYTYIWDTRTSAAVQKFFASDTDVNAIQFFKDGNSIVTGGDDGVI 294

Query: 436 HVL 438
           ++ 
Sbjct: 295 NMF 297

>Scas_685.11
          Length = 384

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 38/68 (55%), Gaps = 2/68 (2%)

Query: 333 DLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDH 391
           D + S N +L+++S D  + +W ++   +  T + H   +  V  HP++ R  IS   DH
Sbjct: 98  DGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSN-RVAISVSEDH 156

Query: 392 KVRLWSIL 399
            +RLW+++
Sbjct: 157 SIRLWNLM 164

>YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein
           essential for replication of M double-stranded RNA
           (dsRNA) virus, member of the WD (WD-40) repeat family
           [1407 bp, 468 aa]
          Length = 468

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 39/65 (60%), Gaps = 3/65 (4%)

Query: 337 SKNN-FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVR 394
           SKN+ +L+++S D  + +W ++   ++ T + H   V  V  HPT+ R  IS   DH +R
Sbjct: 170 SKNSKWLLSASEDHKIMVWRVKDWETVGTLKGHTARVNDVDIHPTN-RIAISVSDDHSIR 228

Query: 395 LWSIL 399
           LW+++
Sbjct: 229 LWNLM 233

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 50/102 (49%), Gaps = 22/102 (21%)

Query: 312 YAPVFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTF-QHQDF 370
           + P+F+      F+ H+  +  L  S+  +L++ S D  ++++ L+++  L T   HQ  
Sbjct: 96  FMPIFH------FQAHSLSIKCLAVSRR-YLVSGSNDEHIRIYDLQKRKELGTLLSHQGS 148

Query: 371 VTCVRF-HPT-------------DDRFFISGCLDHKVRLWSI 398
           +T ++F HP              + ++ +S   DHK+ +W +
Sbjct: 149 ITALQFSHPASSSEDAAVSKGSKNSKWLLSASEDHKIMVWRV 190

>Kwal_27.11550
          Length = 407

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 351 VKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENE 402
           +K WH   ++ + +  H D +T ++FHPTD    +SG  D  V ++ + + E
Sbjct: 132 MKAWHQPLRSLVDS--HHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLTQPE 181

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 47/93 (50%), Gaps = 11/93 (11%)

Query: 337 SKNNFLITSSMDRTVKLWHLERQT-SLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRL 395
           +K N L   + D++ K++ + +    LK+F+ +     + +HP ++  F  GC D  ++ 
Sbjct: 260 TKGNLLAVVAKDKSCKIFDIRQNMKELKSFRDESDYMSLTWHPINESIFTVGCYDGSLKH 319

Query: 396 WSILEN--------EITFEFDCQDLITSLTLSP 420
           + +L++        +I +  D    ITSL+ +P
Sbjct: 320 FDLLQDTGSSNSFHDIPYAHD--KCITSLSYNP 350

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 338 KNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLW 396
           ++ +L + S D+TVK W LE+   ++ +  H   V  V  HPT D    +G  D  ++LW
Sbjct: 193 RHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAG-RDSVIKLW 251

Query: 397 SI 398
            +
Sbjct: 252 DM 253

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 23/45 (51%)

Query: 354 WHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           WH   + S     H  +V CV   P D+ +FI+G  D  +++W +
Sbjct: 125 WHAPWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDL 169

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 60/151 (39%), Gaps = 10/151 (6%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILE 400
           +++SS D TV+LW +    ++K    H+  V     HP +  F ++      +R W + E
Sbjct: 281 VVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRATALHPKE--FSVASACTDDIRSWGLAE 338

Query: 401 NEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKG---LEQVSSFHVVDKNTQ 457
             +   F+ +      TLS         G  NG +     K     + +++  +V     
Sbjct: 339 GSLLTNFESEKTGIINTLSINQDDVLFAGGDNGVLSFYDYKSGHKYQSLATREMVGSLEG 398

Query: 458 ERNTASTKIHHGPRVTGLECFKYEPDNSLRI 488
           ER+   +        TGL     E D S++I
Sbjct: 399 ERSVLCSTFDK----TGLRLITGEADKSIKI 425

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 70/165 (42%), Gaps = 24/165 (14%)

Query: 339 NNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDR--FFISGCLDHKVRLW 396
           N + IT S D T+K+W L       T      V  VR     DR  +  S   D  V+ W
Sbjct: 152 NEWFITGSNDTTMKVWDLATGKLKTTLAGH--VMTVRDVAVSDRHPYLFSVSEDKTVKCW 209

Query: 397 SILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNT 456
            + +N+I      +D    L+     G  T+  + +  + ++ T G + V        + 
Sbjct: 210 DLEKNQI-----IRDYYGHLS-----GVRTV--SIHPTLDLIATAGRDSVIKLW----DM 253

Query: 457 QERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFD 501
           + R    T + H   +  ++C   +P    ++V +S+D+ +R++D
Sbjct: 254 RTRIPVITLVGHKGPINQVQCTPVDP----QVVSSSTDATVRLWD 294

>Sklu_1880.3 YDR364C, Contig c1880 4293-5708
          Length = 471

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/89 (21%), Positives = 42/89 (47%), Gaps = 1/89 (1%)

Query: 307 NELNLYAPVFNPSCFKIFKEHTADVLDLDW-SKNNFLITSSMDRTVKLWHLERQTSLKTF 365
           N +N++      +  + ++ H   V D+++ S     ++ S D+T+K+W  E        
Sbjct: 201 NVINIWDMYHERTLLRDYRGHRKAVRDINFNSDGTEFLSVSFDQTLKVWDTETGKVKSRL 260

Query: 366 QHQDFVTCVRFHPTDDRFFISGCLDHKVR 394
           +      C  +HPT++  +I G  + ++R
Sbjct: 261 KWHSVPNCATYHPTNNNEYIVGLSNSEIR 289

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 38/189 (20%), Positives = 74/189 (39%), Gaps = 29/189 (15%)

Query: 322 KIFKEHTADVLDLDWSKNNF-LITSSMDRTVKLWHLERQTSLKTFQH--QDFVTCVRFHP 378
           + +  H + ++ L +  +    I+SS D+TV++W  +    +K      Q  +  +  HP
Sbjct: 303 QTYNHHLSSIISLKYFPDGSKFISSSEDKTVRIWENQVNIPIKQISDTSQYSMPYLEIHP 362

Query: 379 TDDRFFISGCLDHKVRLWSILENEITFEFD------CQDLITSLTLSPGDGKYTIVGTFN 432
            +  +F +  +D+ +  +S+                C     +   SP DG+Y + G   
Sbjct: 363 -EQHYFSAQSMDNAIYSFSMKPKYKKNLKKVFRGHLCAGFGINFGFSP-DGQYIVSGDSR 420

Query: 433 GYVHVLLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTS 492
           G V V   K    +  F V D               G  VT L    + P  + +++ + 
Sbjct: 421 GSVVVWDWKTTRTLKRFEVPD---------------GKPVTTL---AWHPQETSKMLCSG 462

Query: 493 SDSRIRIFD 501
           +  +I +FD
Sbjct: 463 NGGKIYLFD 471

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 35/182 (19%), Positives = 71/182 (39%), Gaps = 22/182 (12%)

Query: 324 FKEHTADVLDLDW--SKNNFLITSSMDRTVKLWHL-ERQTSLKTFQ-HQDFVTCVRFHPT 379
           FK H      L +     +  ++   D  + +W +   +T L+ ++ H+  V  + F+ +
Sbjct: 174 FKGHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYHERTLLRDYRGHRKAVRDINFN-S 232

Query: 380 DDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLL 439
           D   F+S   D  +++W     ++        +    T  P +    IVG  N  +    
Sbjct: 233 DGTEFLSVSFDQTLKVWDTETGKVKSRLKWHSVPNCATYHPTNNNEYIVGLSNSEIR--- 289

Query: 440 TKGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRI 499
                     H   + + +     T  HH   ++ +   KY PD S + + +S D  +RI
Sbjct: 290 ----------HYDSRVSNKEGLIQTYNHH---LSSIISLKYFPDGS-KFISSSEDKTVRI 335

Query: 500 FD 501
           ++
Sbjct: 336 WE 337

>Scas_660.8
          Length = 510

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 339 NNFLITSSMDRTVKLWHLER--QTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLW 396
           N  LIT+S DR ++LW +    Q  L+     D+V  V   P+     +SG  D  +RL+
Sbjct: 137 NKTLITASDDRVIRLWDISNAYQPQLELTGSTDYVRSVTCVPSAPHMIVSGSYDGIIRLY 196

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 34/71 (47%), Gaps = 4/71 (5%)

Query: 375 RFHPTDDRFFISGCLDHKVRLWSILENEITFEFDC---QDLITSLTLSPGDGKYTIVGTF 431
           +FHP D++  I+   D  +RLW I  N    + +     D + S+T  P      + G++
Sbjct: 131 KFHPQDNKTLITASDDRVIRLWDI-SNAYQPQLELTGSTDYVRSVTCVPSAPHMIVSGSY 189

Query: 432 NGYVHVLLTKG 442
           +G + +  T+ 
Sbjct: 190 DGIIRLYDTRA 200

>CAGL0J06512g complement(620516..622153) similar to sp|Q04199
           Saccharomyces cerevisiae YML102w CAC2, start by
           similarity
          Length = 545

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 329 ADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFIS 386
           +++ DL WS ++ +L+T+SMD ++K+++++    +   + H  +V  V + P  +++ IS
Sbjct: 153 SEIYDLSWSPDDKYLVTASMDNSLKVFNVDTGNCVAFAKDHNHYVQGVTWDPL-NQYIIS 211

Query: 387 GCLDHKVRLWSI 398
             +D  + ++ I
Sbjct: 212 QSVDRSINIYEI 223

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 2/74 (2%)

Query: 324 FKEHTADVLDLDWS-KNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDD 381
            + H+A VL + ++ K N L T+S+D ++K W +   T LKT   H D V  +     D 
Sbjct: 92  LRGHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGTLLKTMSAHSDPVVSIDTPDCDA 151

Query: 382 RFFISGCLDHKVRL 395
               SG  D  +R+
Sbjct: 152 TILSSGSYDGLIRI 165

>KLLA0E18139g 1608371..1609351 highly similar to sp|P36104
           Saccharomyces cerevisiae YKL018w singleton, start by
           similarity
          Length = 326

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 60/132 (45%), Gaps = 24/132 (18%)

Query: 321 FKIFKEHTADVLDLDWSK-NNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPT 379
            + F+ H A V D+  S  ++  +++S D +V+LW L R +  +        TC+ + P+
Sbjct: 105 LRYFQGHGALVSDIQMSPLDDTFLSASYDESVRLWDL-RSSKAQALIPSLVPTCIAYDPS 163

Query: 380 DDRFFISGCLDHKVRLWSILE------------------NEITFEFDCQDLITSLTLSPG 421
              F I    +H+V L+++                    N++ F  D + L+    L+  
Sbjct: 164 GLVFAIGNPENHEVGLYNVKHLKAGPFLVINVDPSFDQWNKLEFSNDGKYLL----LASS 219

Query: 422 DGKYTIVGTFNG 433
            GK+ I+ +F+G
Sbjct: 220 AGKHLIMDSFDG 231

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 38/78 (48%), Gaps = 10/78 (12%)

Query: 343 ITSSMDRTVKLWHL--ERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
           I SS  ++  + HL  E  T L+ FQ H   V+ ++  P DD F +S   D  VRLW + 
Sbjct: 84  IYSSTMKSFDIRHLNLETNTYLRYFQGHGALVSDIQMSPLDDTF-LSASYDESVRLWDLR 142

Query: 400 ENEITFEFDCQDLITSLT 417
            ++       Q LI SL 
Sbjct: 143 SSK------AQALIPSLV 154

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 323 IFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHPTDD 381
           IFK HT  + ++++  +N ++T+S D T  LW + +   +  F  H   V  +   PT+ 
Sbjct: 211 IFKGHTCYISEIEFLDDNSILTASGDMTCALWDITKSKRINEFADHLGDVLSLSAAPTET 270

Query: 382 R----FFISGCLDHKVRLW 396
                 F SG  D  + +W
Sbjct: 271 EGNGNVFASGGSDGYLYIW 289

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 28/130 (21%), Positives = 56/130 (43%), Gaps = 13/130 (10%)

Query: 340 NFLITSSMDRTVKLWHLER-----QTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKV 393
           N + ++ +D    ++ + R     Q  +  F+ H  +++ + F   DD   ++   D   
Sbjct: 182 NLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCYISEIEF--LDDNSILTASGDMTC 239

Query: 394 RLWSILENEITFEF-----DCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSS 448
            LW I +++   EF     D   L  + T + G+G     G  +GY+++   +    V S
Sbjct: 240 ALWDITKSKRINEFADHLGDVLSLSAAPTETEGNGNVFASGGSDGYLYIWDKRVPTSVQS 299

Query: 449 FHVVDKNTQE 458
           F V D +  +
Sbjct: 300 FFVSDSDVSK 309

>Sklu_2384.3 YKL018W, Contig c2384 6547-7533
          Length = 328

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 321 FKIFKEHTADVLDLDWSK-NNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPT 379
            + F  H A V D++ S   +  +++S D +V+LW L R +  +        TC+ + P+
Sbjct: 105 LRYFTGHGALVSDIEMSPLEDVFLSASYDESVRLWDL-RTSKAQAIVPSLVPTCIAYDPS 163

Query: 380 DDRFFISGCLDHKVRLWSI 398
              F I    +H++ L++I
Sbjct: 164 GLVFAIGNPENHEIGLYNI 182

>Kwal_33.15591
          Length = 714

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 332 LDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDH 391
           +D+D S   F  + S D TVK+  +E +T      H+ FV  V+F P  D   IS   D 
Sbjct: 190 IDIDASGEKF-ASCSNDGTVKINDMEGKTLKTLVGHESFVYSVKFAPNGD--VISCGEDR 246

Query: 392 KVRLW 396
            VR+W
Sbjct: 247 TVRIW 251

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 5/63 (7%)

Query: 324 FKEHTADVLDLDW-SKNNFLITSSMDRTVKLWHLERQTSLKTFQ--HQDFVTCVRFHPTD 380
            K HTA V D+    +  F +T+S D T+KLW  E +  LKTF   H D +  +    + 
Sbjct: 139 LKGHTASVWDVKMLPEVGFYMTASADGTIKLW--EGEKVLKTFTGLHTDVIRHIDIDASG 196

Query: 381 DRF 383
           ++F
Sbjct: 197 EKF 199

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 47/103 (45%), Gaps = 8/103 (7%)

Query: 333 DLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDH 391
           + DW     L T S DR++ LW LE  T LKT + H + V  V F   + +   +G  D 
Sbjct: 540 EYDW----LLATCSGDRSINLWSLESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGA-DG 594

Query: 392 KVRLWSILENEITFEFDCQ-DLITSLTLSPGDGKYTIVGTFNG 433
            V++W     E     D   + I +L ++  DG+  I    +G
Sbjct: 595 LVKIWDCSTGECVRTLDAHNNRIWALAVA-NDGQLIITADADG 636

>Scas_699.5
          Length = 494

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 44/103 (42%), Gaps = 11/103 (10%)

Query: 340 NFLITSSMDRTVKLWHLERQTSLKT--FQHQDFVTCVRFHPTDDRFFISGCLDHKVRLW- 396
           N LI+SS+D T  +W L+    +KT    H   V  VRF     + F S   D  VR++ 
Sbjct: 246 NLLISSSIDTTCIVWDLQSSNYVKTQLIAHDSEVYDVRFLTQSTQLFASCGGDGSVRVFD 305

Query: 397 --SILENEITFEFDCQDL------ITSLTLSPGDGKYTIVGTF 431
             S+  + I +E    DL         L L P      ++ TF
Sbjct: 306 LRSLAHSTIIYEPPVSDLNPDTSQFALLRLEPSPHDPNVMATF 348

>KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305
           Saccharomyces cerevisiae YMR093w singleton, start by
           similarity
          Length = 520

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 339 NNFLITSSMDRTVKLWHLER--QTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLW 396
           N  L+T++ DR V+LW +    + +L+     D+V  V F P       +G  D  VRL+
Sbjct: 137 NKTLVTANDDRVVRLWDVSHAYEPTLQLTGASDYVRSVCFVPNAPHMVATGSYDGVVRLY 196

Query: 397 SI 398
            I
Sbjct: 197 DI 198

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 320 CFKIFKEHTADVLDLDWSK-NNFLITSSMDRTVKLWHLERQTSLKTF 365
           C   F EH   V  ++++K    L ++S+D TVK W L R  + +TF
Sbjct: 375 CLATFDEHAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRTF 421

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 43/84 (51%), Gaps = 8/84 (9%)

Query: 306 TNELNLYAPVFNPSCFKIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHL---ERQTS 361
           T E   +AP      ++I   H +D+  L WSK++ F+I++S D T ++W +   E+  +
Sbjct: 127 TTEDRQFAPFVR---YRIHAGHFSDITSLTWSKDSRFIISTSKDLTARIWSVNSEEKNLA 183

Query: 362 LKTFQ-HQDFVTCVRFHPTDDRFF 384
             TF  H+D V    F    ++ +
Sbjct: 184 STTFAGHRDNVIGAYFSDDQEKIY 207

>KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces
           cerevisiae YLR409c singleton, start by similarity
          Length = 942

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/72 (20%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 327 HTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFI 385
           H+  +   D+S +  ++++SS+D T++ W L     +   + ++ +T ++F P  D    
Sbjct: 586 HSNRISSFDFSPDGRWIVSSSLDSTIRTWDLPTGGCIDGMKVENVITNIKFSPNGDLLAT 645

Query: 386 SGCLDHKVRLWS 397
           +    + + LW+
Sbjct: 646 TSVSGNGISLWA 657

>Kwal_56.23895
          Length = 367

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 2/61 (3%)

Query: 323 IFKEHTADVLDLDWSKNN--FLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTD 380
           IF EH  +V   +W+  N    ++SS D TVK+W   R  SL T   +         P+ 
Sbjct: 99  IFHEHEKEVFSCNWNLINKQLFVSSSWDGTVKVWSPTRPKSLATLTPKPMAAQNPLMPSK 158

Query: 381 D 381
           D
Sbjct: 159 D 159

>YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein
           required in ubiquitin proteolysis and found complexed
           with Cdc48p, has WD (WD-40) repeats [2148 bp, 715 aa]
          Length = 715

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 40/77 (51%), Gaps = 10/77 (12%)

Query: 324 FKEHTADVLD---LDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ--HQDFVTCVRFHP 378
            + H A V D   + +S+N FL T+S D+T+KLW  ++   +KTF   H D V       
Sbjct: 133 LQAHNASVWDAKVVSFSENKFL-TASADKTIKLWQNDK--VIKTFSGIHNDVVR--HLAV 187

Query: 379 TDDRFFISGCLDHKVRL 395
            DD  FIS   D  ++L
Sbjct: 188 VDDGHFISCSNDGLIKL 204

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 45/213 (21%), Positives = 70/213 (32%), Gaps = 69/213 (32%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILE 400
           ++T   D T ++W  + QT   T   H+++V CV +   D     +G +D+ +RLW    
Sbjct: 161 VVTGGGDNTARIWDCDTQTPKVTLNGHRNWVLCVSWS-ADGEVIATGSMDNTIRLWDAES 219

Query: 401 NEITFEF--DCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQE 458
            +   +        ITSLT  P                             H+V      
Sbjct: 220 GKPLGDALRGHSKWITSLTWEP----------------------------IHLV------ 245

Query: 459 RNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFDXXXXXXXXXXXGFQSGA 518
                                 EP +  R+   S D  IRI+D           G     
Sbjct: 246 ----------------------EPGSKPRLASASKDGTIRIWDSSRRVCLMTLGG----- 278

Query: 519 SQHKACLATVK--GQQVVLSSSDDHWVHGWKLK 549
             H   ++ VK  G+ ++ S S D  V  W +K
Sbjct: 279 --HTNSVSCVKWGGEGILYSGSHDKTVRAWDMK 309

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 47/91 (51%), Gaps = 4/91 (4%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
           +++++S D ++KLW  +  T L TF+ H   V  V +  +D R  +S   D  +++W + 
Sbjct: 418 YIVSASFDNSIKLWDGKEGTFLSTFRGHVASVYQVAWS-SDCRLLVSCSKDTTLKVWDVK 476

Query: 400 ENEITFEFDC-QDLITSLTLSPGDGKYTIVG 429
             +++ +    QD + ++  S  DGK    G
Sbjct: 477 TRKLSVDLPGHQDEVYTVDWSV-DGKRVCSG 506

>Kwal_55.21450
          Length = 503

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 32/164 (19%), Positives = 67/164 (40%), Gaps = 20/164 (12%)

Query: 340 NFLITSSMDRTVKLWHLERQTSL-KTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWS 397
           +  +++  D  VK+W L R   L + ++ H   V  + F+ ++   F+S   D ++++W 
Sbjct: 224 HLCLSAGNDNQVKIWDLYRDRELLRDYRGHSKAVRGISFN-SEGSEFLSVSFDQQIKIWD 282

Query: 398 ILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQ 457
               ++  ++    +       P +    IVG  N  +              H   + + 
Sbjct: 283 TETGKVRHQYSYSCIPNCAEFRPSNSNEFIVGLSNSEIR-------------HYDLRTSH 329

Query: 458 ERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFD 501
           +        HH   ++ +   KY PD S + V +S D  +RI++
Sbjct: 330 KNGLVQVYDHH---LSSIIALKYFPDGS-KFVSSSEDKSMRIWE 369

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 29/144 (20%), Positives = 61/144 (42%), Gaps = 11/144 (7%)

Query: 322 KIFKEHTADVLDLDW-SKNNFLITSSMDRTVKLWHLERQTSLKTFQH--QDFVTCVRFHP 378
           +++  H + ++ L +    +  ++SS D+++++W  +    +K      Q  +  +  HP
Sbjct: 335 QVYDHHLSSIIALKYFPDGSKFVSSSEDKSMRIWENQINIPIKQISDTSQYSMPYIGIHP 394

Query: 379 TDDRFFISGCLDHKVRLWSI---LENEITFEFD---CQDLITSLTLSPGDGKYTIVGTFN 432
            +  +F +  +D+ +  +S+    +      F    C         SP DG+Y   G   
Sbjct: 395 -EQNYFAAQSMDNAIYAFSMKPKYKRHPKKHFSGHKCAGFGIGFGFSP-DGQYIASGDTR 452

Query: 433 GYVHVLLTKGLEQVSSFHVVDKNT 456
           G V++   K    +  F V DK T
Sbjct: 453 GRVYIWDWKTTHLLKHFDVPDKKT 476

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/93 (17%), Positives = 43/93 (46%), Gaps = 1/93 (1%)

Query: 307 NELNLYAPVFNPSCFKIFKEHTADVLDLDW-SKNNFLITSSMDRTVKLWHLERQTSLKTF 365
           N++ ++    +    + ++ H+  V  + + S+ +  ++ S D+ +K+W  E       +
Sbjct: 233 NQVKIWDLYRDRELLRDYRGHSKAVRGISFNSEGSEFLSVSFDQQIKIWDTETGKVRHQY 292

Query: 366 QHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
            +     C  F P++   FI G  + ++R + +
Sbjct: 293 SYSCIPNCAEFRPSNSNEFIVGLSNSEIRHYDL 325

>CAGL0G01628g complement(151262..152392) similar to sp|P53962
           Saccharomyces cerevisiae YNL035c, hypothetical start
          Length = 376

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%)

Query: 367 HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENE 402
           HQD +T + FHP D    +SG  D    ++ +LE E
Sbjct: 140 HQDDITSIAFHPADANVLLSGSTDGYTNVYDLLEPE 175

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 66/170 (38%), Gaps = 36/170 (21%)

Query: 310 NLYAPV--FNPSCFKIFKEHTADV--LDLDWSKNNFLITSSMDRTVKLWHLERQTSLKT- 364
           NL +P    +  C   F+ HT +V  L LD S   FL++ S DRT++ W L     L+T 
Sbjct: 482 NLTSPTNHIDSPCVHTFEAHTDEVTALSLDPS---FLVSGSQDRTIRQWDLRSGKCLQTI 538

Query: 365 ---------------FQHQDFVTCVRFHPTD------DRFFISGCLDHKVRLWSILENEI 403
                                +T     P+       D    +G  D  VRLW +   ++
Sbjct: 539 DLSFANVLTTSTNVDLSKSTLLTQRNERPSIGALQSFDAALATGTKDGVVRLWDLRSGKV 598

Query: 404 TFEFDCQ-DLITSLTLSPGDGKYTIVGTFNGYVHVL-LTKGLEQVSSFHV 451
                   D ITSL     D    + G+++  V +  L  GL  ++ FH 
Sbjct: 599 IRTLKGHTDAITSLKF---DSACLVTGSYDRTVRIWDLRTGL--LNKFHA 643

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 367 HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           H DF+TC+ F         +G LDH V++W +
Sbjct: 397 HDDFLTCLDFDAPFGTLCTAGYLDHTVKIWDL 428

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 332 LDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLD 390
           LD D           +D TVK+W L +Q  +     H   + C++ +  D    ++G  D
Sbjct: 404 LDFDAPFGTLCTAGYLDHTVKIWDLSKQNKIGELAGHLATINCMQIN-RDYGTLVTGGRD 462

Query: 391 HKVRLWSI 398
             ++LW++
Sbjct: 463 AALKLWNL 470

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 4/77 (5%)

Query: 324 FKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVT--CVRFHPTDD 381
           F  HT  +   DW  ++ LI++SMD +V++W + +Q +L      D V   C     +D 
Sbjct: 374 FYGHTQSITYADWLDDDRLISTSMDGSVRVWSV-KQNALVGLSVVDGVPIFCGTLS-SDK 431

Query: 382 RFFISGCLDHKVRLWSI 398
           + F +G LD +V ++++
Sbjct: 432 QKFATGTLDGEVSVYNV 448

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 51/113 (45%), Gaps = 7/113 (6%)

Query: 337 SKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRL 395
           S N  L+++S D+T++ W      S   F  H   +T   +   DD   IS  +D  VR+
Sbjct: 346 SDNKLLLSASDDKTLRTWRGGNANSSNCFYGHTQSITYADW--LDDDRLISTSMDGSVRV 403

Query: 396 WSILENEITFEFDCQDLITSL--TLSPGDGKYTIVGTFNGYVHVLLTKGLEQV 446
           WS+ +N +       D +     TLS    K+   GT +G V V   K L +V
Sbjct: 404 WSVKQNALV-GLSVVDGVPIFCGTLSSDKQKFA-TGTLDGEVSVYNVKKLLEV 454

>Scas_719.30
          Length = 940

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 16/75 (21%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 324 FKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDR 382
           F  H+  +  LD+S +  +++++S+D T++ W L     +   + +   T V+F P  D 
Sbjct: 582 FWGHSNRITALDFSPDGRWIVSASLDSTIRTWDLPTGGCIDGIKLESVATDVKFSPNGDM 641

Query: 383 FFISGCLDHKVRLWS 397
              +  + + + +W+
Sbjct: 642 LATTHVIGNGIYIWN 656

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 321 FKIFKEHTADVLDLDWSK---NNFLITSSMDRTVKLWHLERQTS-----LKTFQHQDFVT 372
           FK  K HT  + D DW+     N  +T+S D+TVK+W  +++ +       + +H   VT
Sbjct: 646 FKNEKPHTRIIWDADWAPLEFGNVFVTASRDKTVKVWRHQKEPADDYVLEASIKHTKAVT 705

Query: 373 CVRFH 377
            +  H
Sbjct: 706 AISIH 710

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 367 HQDFVTCVRFHPTDDRFFISGCLDHKVRLW 396
           H+  VTCVRF P  D F +S   DH V++W
Sbjct: 58  HEAEVTCVRFVPDSD-FMVSASEDHHVKIW 86

>KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces
           cerevisiae YKL213c DOA1 involved in ubiquitin-dependent
           proteolysis, start by similarity
          Length = 706

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 43/88 (48%), Gaps = 10/88 (11%)

Query: 324 FKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ--HQDFV--TCVRFHPT 379
            K H+A V D     +  ++T+S D TVKLW  +  T  KTF   H D V   C+     
Sbjct: 134 LKGHSASVWDAKLLNDGSVLTASADTTVKLW--KNGTLAKTFDKLHSDVVRNICIL---D 188

Query: 380 DDRFFISGCLDHKVRLWSILENEITFEF 407
           D + F+S   D  ++L S LE  I  EF
Sbjct: 189 DGKHFVSCSNDGTLKL-SNLEGGILHEF 215

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 45/91 (49%), Gaps = 9/91 (9%)

Query: 338 KNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFV--TCVRFHPTDDRFFISGCLDHKVRL 395
           + N L   S D+T K++ + RQ + + F  +D V    +++HP D+  F  GC D  ++ 
Sbjct: 261 QGNLLSVISKDKTCKVYDI-RQQAKELFSVRDDVDYMTLQWHPIDETVFTVGCYDGSIKH 319

Query: 396 WSI-LENEI-----TFEFDCQDLITSLTLSP 420
           + +  EN+         +  +  +TSL  SP
Sbjct: 320 FDLSQENQPNKPTHNIPYAHEKCVTSLAYSP 350

>Kwal_33.15475
          Length = 783

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 35/73 (47%), Gaps = 18/73 (24%)

Query: 301 QKISSTNELNLYAPVFNPSCFKIFKEHTADVLDLDWSKNNF---LITSSMDRTVKLWHL- 356
           +K S+TNE  L         FK  K HT  + D DW+   F    +T+S D+ +K W L 
Sbjct: 626 KKNSATNEFEL--------TFKNEKAHTRIIWDCDWAPTEFGHVFVTASRDKHIKAWKLS 677

Query: 357 ------ERQTSLK 363
                 E+Q +LK
Sbjct: 678 EDGQQYEQQHALK 690

>Scas_601.2
          Length = 389

 Score = 33.9 bits (76), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 20/36 (55%)

Query: 367 HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENE 402
           H D VTC+++HP D    +SG  D    ++ + E E
Sbjct: 150 HHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAE 185

>YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in
           the absence of Cin8p, contains WD (WD-40) repeats [1485
           bp, 494 aa]
          Length = 494

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 36/73 (49%), Gaps = 7/73 (9%)

Query: 326 EHTADVLDLDWSKNN--FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDR 382
           EH    + + W KNN   + + S D+TVK+W      SLKTFQ H  +V  +        
Sbjct: 253 EHIVSAVKI-WQKNNDVHIASCSRDQTVKIWDFHNGWSLKTFQPHSQWVRSID---VLGD 308

Query: 383 FFISGCLDHKVRL 395
           + ISG  D  +RL
Sbjct: 309 YIISGSHDTTLRL 321

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 26/43 (60%)

Query: 323 IFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTF 365
           IFK HT  + D++++ N  ++T+S D T  LW + +   ++ +
Sbjct: 176 IFKGHTCYISDIEFTDNAHILTASGDMTCALWDIPKAKRVREY 218

>Scas_693.36
          Length = 375

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 323 IFKEHTADVLDLDWSKNN--FLITSSMDRTVKLWHLERQTSLKTFQ 366
           IF EH  +V+  +W+  N     +SS D TVK+W   R+ SL T +
Sbjct: 99  IFNEHKKEVMSCNWNLINKTMFTSSSWDGTVKIWSPTRKESLLTLR 144

>Scas_595.3*
          Length = 555

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 50/102 (49%), Gaps = 15/102 (14%)

Query: 365 FQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWS---ILENEITFEFDC--QDLITSL-TL 418
           F   D +TCV F P D +F I G  D ++ L+    I++N   +E +   + + T   T 
Sbjct: 240 FSKGDLITCVSFSPRDTKFVI-GTKDGRILLFDQDLIIDNYEKYEDEVFLEPIFTYKNTA 298

Query: 419 SPG--------DGKYTIVGTFNGYVHVLLTKGLEQVSSFHVV 452
           S G        DG+  IVG   G+++++  +     +S+H++
Sbjct: 299 SKGLGCIEWLSDGESLIVGDETGFINIINIRSTLDPNSYHLM 340

>Sklu_1659.2 YMR092C, Contig c1659 410-2251
          Length = 613

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 57/114 (50%), Gaps = 8/114 (7%)

Query: 340 NFLITSSMDRTVKLWHLERQTSLKTFQHQDFVT--CVRFHPTDDRFFISGCLDHKVRLWS 397
           N  +TSS D T+KLW +E    L+++  ++ ++   V    T D   ++  LD  + ++ 
Sbjct: 265 NKFVTSSADCTLKLWDVESSKCLQSWSLENTLSNQQVGVAVTKDHEIVALSLDGTLNIFK 324

Query: 398 ILENEITFEFDCQDL-ITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFH 450
           I E+ +    +  +  IT+L ++P      + G+++G V   + +    + ++H
Sbjct: 325 IGEDSLVRRIEGHNKGITALVVNP-----LVSGSYDGRVVQWINENEPHMENYH 373

>CAGL0K00275g complement(25300..27447) similar to sp|P36037
           Saccharomyces cerevisiae YKL213c DOA1, hypothetical
           start
          Length = 715

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 334 LDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKV 393
           L++  N+   + S D T+KL +LE +       H+ FV CV+ H  +  F  S   D  V
Sbjct: 186 LEYISNDIFASCSNDGTIKLLNLEGEIKNVFEGHESFVYCVK-HMNNTLF--SCGEDSTV 242

Query: 394 RLWSI 398
           R+WSI
Sbjct: 243 RIWSI 247

>Sklu_2379.7 YBR246W, Contig c2379 13796-14935 reverse complement
          Length = 379

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 53/127 (41%), Gaps = 14/127 (11%)

Query: 318 PSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFH 377
           P C +I +E    V   D +K+    T S+D   +  HL     L T +    +  ++  
Sbjct: 18  PCCLRILQEKYIIVGTYDLNKSTGSRTGSLDIYDENLHL-----LNTTKTYGAILDLKLS 72

Query: 378 PTDDRFFISGCLDHKVRLWSIL--ENEITFE-------FDCQDLITSLTLSPGDGKYTIV 428
           P D+    +      V LW I+  +N IT E       FD   L+TSL  SP + +  +V
Sbjct: 73  PFDEYLLATAHSTGNVLLWKIILEDNVITLEEIANLQVFDTDCLVTSLHFSPLESQTLLV 132

Query: 429 GTFNGYV 435
               G +
Sbjct: 133 TATTGEI 139

>CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces
           cerevisiae YGR200c subunit of elongating RNA polymerase
           II holoenzyme, start by similarity
          Length = 793

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 367 HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLIT 414
           H+  VTCV+F P  D   +S   DH V+LW     E + E +C   IT
Sbjct: 57  HEAEVTCVKFMPGTD-ILVSASEDHHVKLWKYKAPE-SEELECIQTIT 102

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%)

Query: 344 TSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVR 394
           +SS D+TVK+W  E    +     +    C+ FHP +    + G  D K+R
Sbjct: 235 SSSYDKTVKIWDTETGDIINRLSFKATPNCMTFHPQNKEQLLVGFSDSKIR 285

>AAR078W [264] [Homologous to ScYLR196W (PWP1) - SH]
           complement(483989..485677) [1689 bp, 562 aa]
          Length = 562

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 5/74 (6%)

Query: 327 HTADVLDLDWSKN--NFLITSSMDRTVKLW---HLERQTSLKTFQHQDFVTCVRFHPTDD 381
           HT  VL L  +++    L ++S D TVKLW   H     SL        V+  ++HP+D 
Sbjct: 270 HTDAVLSLAHNRHFRAVLASTSADHTVKLWDLNHGRAARSLDAVHSATAVSSSQWHPSDG 329

Query: 382 RFFISGCLDHKVRL 395
              ++   D +V L
Sbjct: 330 SILLTAGYDSRVAL 343

>KLLA0D00814g complement(76687..77913) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2 subunit of the
           major yeast histone acetyltransferase, start by
           similarity
          Length = 408

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 2/62 (3%)

Query: 340 NFLITSSMDRTVKLWHLER-QTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWS 397
           N L  +  D  V L+ L R Q  L +   H+D VT + F P  D    S   D ++ +W 
Sbjct: 271 NLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWD 330

Query: 398 IL 399
           + 
Sbjct: 331 LF 332

>Scas_465.4
          Length = 1002

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 327 HTADVLDLDWSKNNFLITS-SMDRTVKLWHLERQTSLKT-FQHQDFVTCVRFHPTDDRFF 384
           H   +     S N   ITS S DR++KLW+L+    L T + H   +  ++F   D +  
Sbjct: 178 HEGSIFYATISDNGRYITSCSDDRSIKLWNLQTGEELCTGWGHTARIWNLKFFNNDTQ-L 236

Query: 385 ISGCLDHKVRLWSILENE 402
           IS   D+  R+W IL++E
Sbjct: 237 ISVSEDNTCRVWDILQDE 254

>YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in
           telomere silencing, interacts with Sir4p and targets
           Sir4p from telomeres to other sites, component of Set3p
           complex, has WD (WD-40) repeats [1608 bp, 535 aa]
          Length = 535

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 47/109 (43%), Gaps = 9/109 (8%)

Query: 339 NNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           N  L+++S D T+++WH     S   F              DD+  IS  +D  VRLWS+
Sbjct: 371 NKLLLSASDDGTLRIWHGGNGNSQNCFYGHSQSIVSASWVGDDKV-ISCSMDGSVRLWSL 429

Query: 399 LENEITFEFDCQDLITSLTLSPG----DGKYTIVGTFNGYVHVLLTKGL 443
            +N +        ++  + +  G    DG+   V   +G V+V   K L
Sbjct: 430 KQNTLL----ALSIVDGVPIFAGRISQDGQKYAVAFMDGQVNVYDLKKL 474

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 24/39 (61%)

Query: 324 FKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSL 362
           F  H+  ++   W  ++ +I+ SMD +V+LW L++ T L
Sbjct: 397 FYGHSQSIVSASWVGDDKVISCSMDGSVRLWSLKQNTLL 435

>Sklu_675.1 YMR146C, Contig c675 761-1687
          Length = 308

 Score = 33.1 bits (74), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 57/130 (43%), Gaps = 18/130 (13%)

Query: 324 FKEHTADVLDLDWSK-NNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDR 382
           F+ H   +  +D  +   + +T S D +VKLW +   +++ T++ +  V  V F P  D+
Sbjct: 48  FEGHMGTIWSIDVDQFTEYAVTGSADFSVKLWKVCDGSNVYTWKTKTPVRRVEFSPAGDK 107

Query: 383 FF--ISGCLDHK--VRLWSILEN-----------EITFEFDCQD--LITSLTLSPGDGKY 425
               + G + +   V ++ ++ N           E  FE    D   I S+     +GKY
Sbjct: 108 ILAVLDGVMGYAGSVTVYDVVRNTETNEIVNINEEPVFEILTHDDFGIASVASWGFEGKY 167

Query: 426 TIVGTFNGYV 435
            + G  +G V
Sbjct: 168 IVAGHKDGKV 177

>AER035W [2540] [Homologous to ScYOL087C - SH]
           complement(699524..702544) [3021 bp, 1006 aa]
          Length = 1006

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 51/124 (41%), Gaps = 24/124 (19%)

Query: 383 FFISGCLDHKVRLWSIL--ENEITFEFD---CQDLITSLTLSPGDGKYTIVGTFNGYVHV 437
            F +G LD KV+ W +   E  + FE+D    Q+  +   L     +  ++G  NG + +
Sbjct: 147 LFATGGLDKKVKFWELQGREARVLFEYDNAQPQETGSVYALCALSPQEVVIGDNNGDLKI 206

Query: 438 LLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRI 497
           +     E V   HVV               HG  V   +      D   R++ TSSD  +
Sbjct: 207 ISAVTGELV---HVVSG------------AHGSNVRLAQLL----DQGRRLITTSSDGAV 247

Query: 498 RIFD 501
           +++D
Sbjct: 248 KLWD 251

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           ++ T S D+TVK+W LE  T LKT + H + V    F     +   +G  D  +++W I
Sbjct: 551 WIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGA-DGLIKVWDI 608

>CAGL0K11836g complement(1142213..1143781) similar to tr|Q12021
           Saccharomyces cerevisiae YDR030c RAD28, hypothetical
           start
          Length = 522

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 367 HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEIT--FEFD 408
           H   +TC+ ++  D+  F++G  DH V+LW     E    + FD
Sbjct: 191 HTYGITCLAWYGPDNGIFLTGSNDHAVKLWDTASFEAVKCYNFD 234

>Kwal_14.1597
          Length = 380

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 70/195 (35%), Gaps = 29/195 (14%)

Query: 311 LYAPVFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDF 370
           LY     P C +IF++    +   D  K + + T S+D             LK +     
Sbjct: 11  LYHTEKPPCCLRIFRDEIILLGTYDLDKPSGIRTGSIDVVDS-----ELKPLKQYSTYGA 65

Query: 371 VTCVRFHPTDDRFFISGCLDHKVRLWSI-----------LENEITFE-FDCQDLITSLTL 418
           V  ++  P DD    S      V LW I           LE+    + FD   L+TSL  
Sbjct: 66  VLDLKISPFDDTLLASAHSTGNVELWHIKCDIKEPQGIELEHLANLQIFDTDTLVTSLHF 125

Query: 419 SPGDGKYTIVGTFNGYVHVL-LTKG---------LEQVSSFHVVDKNTQERNTASTKIHH 468
           SP +    +V   +G   +L L  G          E  SS  ++ K    ++ A  +   
Sbjct: 126 SPLNPGCVMVTATSGETRLLDLEYGSATFTSLGVYEHYSSVDLLSKEVNGKSVAVVETDT 185

Query: 469 GPRV--TGLECFKYE 481
            P      LEC+  E
Sbjct: 186 MPLAHEHALECWTAE 200

>Scas_715.22
          Length = 607

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 67/179 (37%), Gaps = 43/179 (24%)

Query: 323 IFKEHTADVLDLDWSKN--NFLITSSMDRTVKLWHLERQT---SLKTFQHQDFVTCVRFH 377
           I   HT  VL L  +K     L ++S D TVKLW L   T   SL +  +   V+   +H
Sbjct: 318 ITTHHTDAVLSLSHNKQFRAVLASTSADHTVKLWDLNTATAARSLASIHNNKNVSSSEWH 377

Query: 378 PTDDRFFISGCLDHKVRL--------------WSILENEITFEFDCQDLITSLTLSPGDG 423
            ++    ++G  D ++ L              WS++  E   E +C            D 
Sbjct: 378 VSNGSILLTGGYDSRIALSDVRISDEKQMSKYWSVMPGE---EIECTTF--------ADE 426

Query: 424 KYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEP 482
              + GT  G ++           SF +  +N +      T   H   ++ L C K+ P
Sbjct: 427 NIILCGTDAGNIY-----------SFDI--RNNENSKPVWTLKAHDAGISSLSCNKFIP 472

>AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH]
           complement(1497416..1499560) [2145 bp, 714 aa]
          Length = 714

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 72/179 (40%), Gaps = 28/179 (15%)

Query: 323 IFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDR 382
           +   H+ +V  L+ +++  L++SS D+T ++W     T  +     +           DR
Sbjct: 103 LLAGHSGNVCALE-ARDGQLVSSSWDQTARVW--REGTEERALSGHNATVWHALALGYDR 159

Query: 383 FFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKG 442
            F++   D  ++LW    +  T+     D++  L L+P DG +    + +G V V     
Sbjct: 160 -FLTASADKTIKLWDGARDLATYNVHT-DVVRHLALAP-DGHHFASCSNDGSVKV----- 211

Query: 443 LEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFD 501
                       +T +  T  T   H   V    C KY PD  L  V    D  +R++D
Sbjct: 212 ------------HTLDGKTVRTFDGHESFVY---CVKYLPDGGL--VSCGEDKTVRVWD 253

>Kwal_34.15818
          Length = 349

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 324 FKEHTADVLDLDWSK-NNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDR 382
           F+ H   +  +D  +   + +T S D ++KLW ++  T++ T++ +  V  V+F P+ D+
Sbjct: 48  FEGHQGTIWSIDVDQFTQYAVTGSADFSIKLWKVQDGTNVFTWKTKTPVRRVQFSPSGDK 107

Query: 383 FFISGCLD 390
             I   LD
Sbjct: 108 --ILAVLD 113

>ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH]
           complement(868744..872445) [3702 bp, 1233 aa]
          Length = 1233

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 333 DLDWSKNNFLITSSMDRTVKLWHL--ERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLD 390
           DLDWS++  ++  +++  V  +    ER++  +  +H   V  VRF+       +SG   
Sbjct: 66  DLDWSRDGAMLAGALENGVVEFFCARERRSVARVARHTTGVRAVRFNAKQANVAVSGGSQ 125

Query: 391 HKVRLW 396
            ++ +W
Sbjct: 126 GEIFVW 131

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 55/150 (36%), Gaps = 46/150 (30%)

Query: 300 DQKISSTNELNLYAPVFNPSCFKIFKE---HTADVLDLDWSKNN-FLITSSMDRTVKLWH 355
           D K  + + L+    VF     K F     H   VL +D S ++  ++T S D+ +K+W 
Sbjct: 539 DDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWG 598

Query: 356 LERQTSLKT-FQHQDFVTCVRFHP------------------------------------ 378
           L+     K+ F HQD +  V+F P                                    
Sbjct: 599 LDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVW 658

Query: 379 -----TDDRFFISGCLDHKVRLWSILENEI 403
                 D  F IS   DH +R+W   E+++
Sbjct: 659 SISVSNDGTFVISTGHDHSIRVWEETEDQV 688

>KLLA0A08866g 776960..778231 weakly similar to sp|P53196
           Saccharomyces cerevisiae YGL004c singleton, hypothetical
           start
          Length = 423

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 37/87 (42%), Gaps = 10/87 (11%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTF-----QHQDFVTCVRFHPTDDRFFISGCLDHKVRLW 396
            ++SS+D  +K+W     T L+TF        DF    R      R F+S   D  ++LW
Sbjct: 173 FLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDR-----GRNFVSASSDGSLKLW 227

Query: 397 SILENEITFEFDCQDLITSLTLSPGDG 423
               +   F  +  D I  ++L+   G
Sbjct: 228 ECSTSACVFTLNSNDGINCISLANYQG 254

>Scas_544.4
          Length = 524

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 43/92 (46%), Gaps = 24/92 (26%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTF-QHQDF--------------VTCVRFHPTDDRFFIS 386
           + T S+DRT+K+W + +      + Q++DF              V+ V + PTD     +
Sbjct: 353 IATGSLDRTLKIWDIRKIIEKPDWSQYEDFPSHEIVSTYDSRLSVSGVSYSPTDGTLVCN 412

Query: 387 GCLDHKVRLWSI--------LENEITFEFDCQ 410
           G  D  +RL+ +        L+ ++T + +CQ
Sbjct: 413 G-YDDTIRLFDVKEPKLPEDLQPKLTLKHNCQ 443

>Kwal_14.884
          Length = 395

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 341 FLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSIL 399
           +LI++S D  + +W ++   +  T + H   +     HP++ R  IS   DH +RLW+++
Sbjct: 114 WLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSN-RIAISVSEDHSIRLWNLM 172

>Scas_701.45
          Length = 1276

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 9/75 (12%)

Query: 333 DLDWSKNNFLITSSMDRTVKLWHLERQ-----TSLKTF----QHQDFVTCVRFHPTDDRF 383
           DLDWS +N  I  ++D   K+    ++      SLK+     +H   V  +RF+P     
Sbjct: 69  DLDWSFDNKFIAGALDDNGKIELFSKEENDTKISLKSLGKFKKHTTAVNTLRFNPKQQNV 128

Query: 384 FISGCLDHKVRLWSI 398
             S   + ++ +W I
Sbjct: 129 LASAGNNGEILIWDI 143

>Kwal_47.19083
          Length = 324

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 56/137 (40%), Gaps = 30/137 (21%)

Query: 306 TNELNLYAPVFNPSCFKI--FKEHTADVLDLDWSKNNFLITSSMDR----TVKLWHLER- 358
            ++L    P++N   F I   +E +  V D+ +S    L+  + D      V L+  E  
Sbjct: 136 VSQLETLRPIYNFEGFGIKGTEESSGTVRDVKFSPMGELLAVANDSGPYGCVTLYETEYG 195

Query: 359 -------------QTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITF 405
                        QTS+  F H  +V  V F+ T +     G  D K+R+W + + E   
Sbjct: 196 ERIGNLTVPTHSTQTSIANFTHDGWVFNVSFNSTGEYLATCG-YDGKIRVWDVKQKE--- 251

Query: 406 EFDCQDLITSLTLSPGD 422
                  +++L +S GD
Sbjct: 252 ------RVSTLNISAGD 262

>YPL247C (YPL247C) [5203] chr16 complement(82625..84196) Protein
           containing four WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           weak similarity to a region of retinoblastoma binding
           protein 4 (human RBBP4), which associates with histone
           acetylation proteins [1572 bp, 523 aa]
          Length = 523

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 7/83 (8%)

Query: 331 VLDLDWS--KNNFLITSSMDRTVKLWHLERQTSLKT--FQHQDFVTCVRFHPTDDRFFIS 386
           +   DW+    N +I+SS+D T  +W L+    +KT    H   V  VRF     + F S
Sbjct: 246 ITSFDWNTVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFAS 305

Query: 387 GCLDHKVRLW---SILENEITFE 406
              D  VR++   S+  + I +E
Sbjct: 306 CGGDGSVRVFDLRSLAHSTIIYE 328

>Sklu_1985.3 YLR196W, Contig c1985 4838-6544 reverse complement
          Length = 568

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 42/95 (44%), Gaps = 19/95 (20%)

Query: 327 HTADVLDLDWSKN--NFLITSSMDRTVKLWHLERQT---SLKTFQHQDFVTCVRFHPTDD 381
           HT  VL L  +++    L ++S D TVKLW L       S+ +  +   V+  ++H TD 
Sbjct: 278 HTDAVLSLSHNRHFRAVLASTSADHTVKLWDLNNGIAARSIASIHNNKNVSSSQWHSTDG 337

Query: 382 RFFISGCLDHKV--------------RLWSILENE 402
              ++G  D +V              + WS++  E
Sbjct: 338 SILLTGGYDSRVAVSDVRIADDSAMSKYWSVMAGE 372

>KLLA0C16533g complement(1448866..1450404) similar to sgd|S0002315
           Saccharomyces cerevisiae YDL156w, start by similarity
          Length = 512

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 43/91 (47%), Gaps = 23/91 (25%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTF-QHQDF--------------VTCVRFHPTDDRFFIS 386
           + T S+DRT+K+W   +  +   + Q++DF              V+ V + P D+    +
Sbjct: 351 IATGSLDRTLKIWDTRKIVNKPEWSQYEDFASHEIVATYDSRLSVSAVSYSPMDETLVCN 410

Query: 387 GCLDHKVRLWSI-------LENEITFEFDCQ 410
           G  D  +RL+ +       L+ ++T + +CQ
Sbjct: 411 GY-DDTIRLFDVSGTLPEDLQPKLTLKHNCQ 440

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 339 NNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWS 397
           N +L+++S D  + +W ++   +  T + H   +     HP++ R  +S   DH +RLW+
Sbjct: 103 NKWLLSASEDHKIIVWRVKDWENFGTLKGHTARINDFDIHPSN-RVAVSVSEDHSIRLWN 161

Query: 398 IL 399
           ++
Sbjct: 162 LM 163

>ACR194C [1241] [Homologous to ScYDL156W - SH] (690186..691727)
           [1542 bp, 513 aa]
          Length = 513

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 49/101 (48%), Gaps = 23/101 (22%)

Query: 332 LDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTF-QHQDF--------------VTCVRF 376
           + +D S+   + T+S+DRT+++W L +  +   + Q++D+              V+ V +
Sbjct: 337 MAIDPSRPYSVATASLDRTLRIWDLRKTVAKPDWSQYEDYASHEVVSTYNSRLSVSAVSY 396

Query: 377 HPTDDRFFISGCLDHKVRLW-------SILENEITFEFDCQ 410
            P D     +G  D+ VRL+       S L+ + T + +C+
Sbjct: 397 APIDHTLVCNG-YDNTVRLFNARADLPSELQPDFTIQHNCK 436

>Kwal_56.24661
          Length = 561

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 43/102 (42%), Gaps = 22/102 (21%)

Query: 327 HTADVLDLDWSKN--NFLITSSMDRTVKLWHLERQTSLKTF---QHQDFVTCVRFHPTDD 381
           HT  VL L  SK     L ++S D TVKLW L    + ++F        V+  ++H T  
Sbjct: 274 HTDAVLSLSHSKQFRAVLASTSADHTVKLWDLNAGIAARSFASIHSNKNVSSSQWHSTSG 333

Query: 382 RFFISGCLDHKVRL--------------WSILENEITFEFDC 409
              ++G  D ++ L              WS++  E   E +C
Sbjct: 334 SVLLTGGYDSRIALTDVRIADDSQMSKYWSVMSGE---EVEC 372

>Kwal_26.8975
          Length = 445

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 38/90 (42%), Gaps = 6/90 (6%)

Query: 315 VFNPSCFKIFK-EHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTC 373
           V  PS  K F  E     LD+   K   +++ S D  V+ W+L  +   +   H   V  
Sbjct: 90  VLPPSYLKSFNNEDWVSALDVGGDK---IVSGSYDGIVRTWNLSGKVEKQYAGHSGAVRA 146

Query: 374 VRFHPTDDRFFISGCLDHKVRLWSILENEI 403
           V++        +SG  D  +RLW    +E+
Sbjct: 147 VKY--ISSTRLVSGANDRTLRLWKTKNDEL 174

>CAGL0H00781g complement(77292..78833) similar to tr|Q12523
           Saccharomyces cerevisiae YPL247c, hypothetical start
          Length = 513

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 38/86 (44%), Gaps = 8/86 (9%)

Query: 317 NPSCFKIFKEHTADVLDLDWSK--NNFLITSSMDRTVKLWHLERQTSLKT--FQHQDFVT 372
           NPS    F   T+      W+    N LI+SS+D T  +W L+    +KT    H   V 
Sbjct: 228 NPSVLGEFPPITS----FHWNPVDTNILISSSIDTTCIVWDLQSSNYVKTQLIAHDSEVF 283

Query: 373 CVRFHPTDDRFFISGCLDHKVRLWSI 398
            VRF     + F S   D  VR++ +
Sbjct: 284 DVRFLTQSTQLFASCGGDGSVRVFDL 309

>YDL156W (YDL156W) [714] chr4 (174919..176487) Protein containing
           three WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has moderate similarity to
           uncharacterized C. albicans Orf6.7171p [1569 bp, 522 aa]
          Length = 522

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 25/93 (26%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTF-QHQDF--------------VTCVRFHPTDDRFFIS 386
           + T S+DRT+K+W          + Q++D+              V+ V + PTD     +
Sbjct: 349 IATGSLDRTLKIWDTRNLVKKPEWSQYEDYPSHEIVSTYDSRLSVSAVSYSPTDGTLVCN 408

Query: 387 GCLDHKVRLWSI---------LENEITFEFDCQ 410
           G  D  +RL+ +         LE ++T + +CQ
Sbjct: 409 G-YDDTIRLFDVKSRDHLSAKLEPKLTIQHNCQ 440

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/92 (20%), Positives = 43/92 (46%), Gaps = 8/92 (8%)

Query: 337 SKNNFLITSSMDRTVKLWHLERQT-SLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRL 395
           ++ N L   S D+++K++ + +    L+T +       + +HP ++  F  GC +  ++ 
Sbjct: 258 TQGNLLAVVSKDKSIKIYDMRQHMRELQTIRDDMDYMSLSWHPINETIFSVGCYNGAIKH 317

Query: 396 WSILENEI-------TFEFDCQDLITSLTLSP 420
           + +L +         T  +  +  +TSL  SP
Sbjct: 318 FDLLHDNSNSTPACHTIPYAHEKSVTSLAYSP 349

>KLLA0D17116g 1451064..1452395 similar to sgd|S0002572 Saccharomyces
           cerevisiae YDR165w, start by similarity
          Length = 443

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 6/86 (6%)

Query: 341 FLITSSMDRTVKLWHLERQTSLK--TFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSI 398
           +++T+  D  +++ H  +   +    F H++FV+ +      D+   S   D  V  W+ 
Sbjct: 212 YIVTADRDEHIRISHYPQSFIVDKWLFGHEEFVSTICIPEWSDKLLFSAGGDKFVFSWNW 271

Query: 399 LENEITFEFDCQDLI----TSLTLSP 420
               + F+FD  DLI    TS  L+P
Sbjct: 272 KTGALLFKFDYTDLIQKYLTSDHLAP 297

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 3/80 (3%)

Query: 327 HTADVLDLDWSKNNFLITS-SMDRTVKLWHLERQTSLKT-FQHQDFVTCVRFHPTDDRFF 384
           H   +  +  S++N LI S S DR+++LW  E    L   + H   +  ++F   D+   
Sbjct: 178 HEGSIFYIQSSEHNKLIASCSDDRSIRLWDRETGKELSIGWSHTARIWNLKFFNNDEN-L 236

Query: 385 ISGCLDHKVRLWSILENEIT 404
           +S   D   R+W+I+ N+I+
Sbjct: 237 VSVSEDCTCRVWNIIPNDIS 256

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 337 SKNNFLITSSMDRTVKLWHLERQTSLKTFQ----HQDFVTCVRFHPTDDRFFISGCLDHK 392
           +K N L+  S D++ +++ +  + S+K         D++T + +HP ++  F   C D  
Sbjct: 272 TKGNLLMAISKDKSCRVFDI--RYSMKELMCVRDETDYMT-LEWHPINESMFTLACYDGS 328

Query: 393 VRLWSILENE----ITFEFDCQDLITSLTLSP 420
           ++ + +L+N     +T  +     ITSL+ +P
Sbjct: 329 LKHFDLLQNLNEPILTIPYAHDKCITSLSYNP 360

>Scas_512.3
          Length = 534

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%)

Query: 175 DRAIWITKFSLDGKFMASAGKSGIIRVWKVLNSPIERWELGSSVDS 220
           ++AI + KF+  G  +ASAG  G I +WK  +   +  E  + VDS
Sbjct: 67  EQAINVVKFNSPGTILASAGDDGQILLWKQQDVNEQNGETAAPVDS 112

>CAGL0M09845g 975007..977817 highly similar to sp|Q06078
           Saccharomyces cerevisiae YLR409c, start by similarity
          Length = 936

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/72 (19%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 327 HTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFI 385
           H   +   D+S +  +L+++S+D T++ W L   + +   + +   T ++F P  D    
Sbjct: 582 HGNRITAFDFSPDGRWLVSASLDSTIRTWDLPTGSCIDGVKIESVATNLKFSPNGDMLAT 641

Query: 386 SGCLDHKVRLWS 397
           +  + + + +W+
Sbjct: 642 THVIGNGIFIWT 653

>Scas_684.7
          Length = 511

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 37/85 (43%), Gaps = 11/85 (12%)

Query: 325 KEHTADVLDLDWS-KNNFLITSSMDR-TVKLWHL-----ERQTSLKTFQHQDF----VTC 373
           K    DV  + WS K  +L+ S  D  T  +W L     E   S++     DF    +T 
Sbjct: 363 KASNTDVNVISWSEKLGYLLASGDDNGTWGVWDLRQFSPENAGSVQPVAQYDFHKGAITS 422

Query: 374 VRFHPTDDRFFISGCLDHKVRLWSI 398
           + F+P D+     G  D+ V LW +
Sbjct: 423 ISFNPLDESIIAVGSEDNTVTLWDL 447

>Scas_692.29
          Length = 456

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 342 LITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILEN 401
           +IT+S D  ++ W+L  +   +   H   +  V+F    D   +S   D  +RLW    N
Sbjct: 118 IITASYDGVIRTWNLSGKVQKQYSGHSGPIRAVKF--ISDTRLVSAGNDRTLRLWKTKNN 175

Query: 402 E-ITFEFDCQD 411
           + +   FD +D
Sbjct: 176 DSVVQHFDEED 186

>Scas_670.22
          Length = 437

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 305 STNELNLY-APVFNPSCF--KIFKEHTADVLDLDWSKNN-FLITSSMDRTVKLWHLE 357
           ST ++ +Y    F PSC     F  HT  +  + WS +  +L+T S D  VK+W L+
Sbjct: 46  STGDVVIYDMDTFRPSCILGSKFGAHTRIIQSISWSPDGRYLLTGSGDWIVKVWDLQ 102

>YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component of
           U3 snoRNP (renamed small subunit processome) which is
           required for 18S biogenesis, has WD (WD-40) repeats
           [1542 bp, 513 aa]
          Length = 513

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 29/72 (40%), Gaps = 2/72 (2%)

Query: 327 HTADVLDLDWSKNNFLITSSMDRTVKLWHLER--QTSLKTFQHQDFVTCVRFHPTDDRFF 384
           H   V       N  L T+S DR  +LW +    +  L+     D+V  + F P      
Sbjct: 125 HPTHVTKFHTQDNKILATASDDRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAAPHLV 184

Query: 385 ISGCLDHKVRLW 396
            +G  D  +RL+
Sbjct: 185 ATGSYDGLIRLY 196

>Kwal_56.23035
          Length = 424

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 23/46 (50%)

Query: 371 VTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSL 416
           +T V+++  D+  F +G  DHKV++W     E+    D    +  L
Sbjct: 145 ITSVQWYGADNGLFFTGSNDHKVKVWDTNAFEVASTIDVGHRVVQL 190

>CAGL0F01793g complement(177696..178790) highly similar to sp|P32353
           Saccharomyces cerevisiae YLR056w ERG3 C-5 sterol
           desaturase, start by similarity
          Length = 364

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 15/24 (62%)

Query: 857 DGEHVTNNPIKMGVRCDVCHGMRF 880
           DG+H++NNP+  G  C   H + F
Sbjct: 273 DGQHMSNNPVVNGTACHTVHHLYF 296

>Kwal_47.17572
          Length = 434

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 327 HTADVLDLDWSKNN-FLITSSMDRTVKLWHL 356
           H   +  + WSKN  +L+TSS D TVK+W L
Sbjct: 72  HVRSIQSIAWSKNGRYLLTSSRDWTVKVWDL 102

>KLLA0C14190g complement(1227049..1228836) some similarities with
           ca|CA5008|IPF12577 Candida albicans unknown function,
           hypothetical start
          Length = 595

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 39/90 (43%), Gaps = 18/90 (20%)

Query: 602 ENGKHS--HLKLTSLIPHCHN---GSTVIKNSDGISFHAHHAPVTTAIVAPSGTAKTLSL 656
           ENGKH+   LK+T + P+  N   GS   K   G++F      V   IVA          
Sbjct: 447 ENGKHTKFRLKVTVVKPNKDNQVLGSMKFKTQSGVNFEKD---VLNEIVAKVKET----- 498

Query: 657 SNDFIYELSSEFAMESRDFEMNTNSDTHSV 686
                Y + S +++E  D E+ TN   H +
Sbjct: 499 -----YGIESPYSIEYMDIEIKTNEKLHQI 523

>Sklu_2435.13 YPR137W, Contig c2435 18346-20073
          Length = 575

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 7/74 (9%)

Query: 357 ERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEF-----DCQD 411
           ++Q   K   H  ++T +   P  +  F+SG  +  ++LW I EN   FE      +C+ 
Sbjct: 463 QQQLQDKNLTHPYWITSLHAIPYSN-VFVSGSWNGSLKLWKISENLREFEILAELPNCRG 521

Query: 412 LITSLTLSPGDGKY 425
           L+T++  +   GKY
Sbjct: 522 LVTNIQ-AVESGKY 534

>Scas_631.17
          Length = 474

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 322 KIFKEHTADVLDLDWSKNNFLITSS-MDRTVKLWHLE 357
           K  + HT  +LD+D S++  LI SS  DR++KLW  E
Sbjct: 438 KTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLWKQE 474

>Kwal_56.23685
          Length = 1102

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 9/77 (11%)

Query: 330 DVLDLDWS----KNNFLITSSMDRTVKLWHLERQTSLKTFQ----HQDFVTCVRFHPTDD 381
           +V D+ WS    K +++I++S  + + LW+L R +S         H   +T + FHPT  
Sbjct: 69  EVADVQWSPHPSKPSWVISTSNQKAL-LWNLSRNSSDAIEHVLHGHSRAITDINFHPTHP 127

Query: 382 RFFISGCLDHKVRLWSI 398
               +  +D  V  W +
Sbjct: 128 EILATCSIDAYVHAWDM 144

>KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1
           Kluyveromyces lactis heterotrimeric G protein beta
           subunit, start by similarity
          Length = 436

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 56/136 (41%), Gaps = 5/136 (3%)

Query: 323 IFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTF-QHQDFVTCVRFHPTD- 380
           IFK HT  +   ++     ++T+S D T  +W + +   +  F  H   V  +   P + 
Sbjct: 170 IFKGHTCYISATEFLDERTILTASGDMTCAMWDIPKSKRVTEFIDHLGDVLTMDLPPANT 229

Query: 381 DRF---FISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHV 437
            R+   FI+G  D    LW + +      F   D   S      +G+  + G+ +G   +
Sbjct: 230 GRYGHNFITGGSDGYAYLWDVRQPNSAQSFFISDSDVSAIKFFNNGESFMAGSDDGSARL 289

Query: 438 LLTKGLEQVSSFHVVD 453
              +   Q+S++   D
Sbjct: 290 FDLRSDCQISTYSFSD 305

>KLLA0E08415g 759718..760986 similar to sp|P53962 Saccharomyces
           cerevisiae YNL035c singleton, start by similarity
          Length = 422

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 21/36 (58%)

Query: 367 HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENE 402
           H D +T ++FHP D    +SG  D  V ++ + +++
Sbjct: 146 HHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQDD 181

>ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH]
           complement(647933..649102) [1170 bp, 389 aa]
          Length = 388

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 339 NNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWS 397
           N +L+++S D T+ +W ++   +    + H   +  +  HP++    +S   DH +RLW+
Sbjct: 103 NKWLLSASEDHTIIIWRVKDWENFGKLKGHNARINDLDIHPSNRVASVSE--DHSIRLWN 160

Query: 398 IL 399
           ++
Sbjct: 161 LM 162

>CAGL0E00979g complement(89546..90811) similar to tr|Q03774
           Saccharomyces cerevisiae YDR165w, start by similarity
          Length = 421

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 17/81 (20%), Positives = 38/81 (46%), Gaps = 2/81 (2%)

Query: 335 DWSKNNFLITSSMDRTVKLWHLERQTSLKT--FQHQDFVTCVRFHPTDDRFFISGCLDHK 392
           D +  +++IT+  D  +K+ H  +   +    F H++FV+ V       +F  S   D +
Sbjct: 183 DANNKSYIITTDRDEHIKISHYPQTFIVDKWLFGHKEFVSSVDLPKWQTKFLFSAGGDKE 242

Query: 393 VRLWSILENEITFEFDCQDLI 413
           +  W+    E+  ++  +D +
Sbjct: 243 IFAWNWQSGELLSQYSFEDAV 263

>Kwal_27.11585
          Length = 823

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 4/97 (4%)

Query: 339 NNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWS 397
           +  L T S D+T+K+W LE  + +KT + H + V    F   + +   +G  D  +++W 
Sbjct: 558 DKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGA-DGLIKVWD 616

Query: 398 ILENEITFEFDCQ-DLITSLTLSPGDGKYTIVGTFNG 433
           +   E     D   + I +L++   DGK  +    +G
Sbjct: 617 LSTGECIRTLDAHSNRIWALSV-LSDGKEFVTADADG 652

>YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protein
           containing five WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           low similarity to a region of S. pombe Tup11p, which is
           a transcriptional repressor functioning redundantly with
           Tup12p [3042 bp, 1013 aa]
          Length = 1013

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 37/76 (48%), Gaps = 3/76 (3%)

Query: 327 HTADVLDLDWSKNN-FLITSSMDRTVKLWHLERQTSLKT-FQHQDFVTCVRFHPTDDRFF 384
           H   +  ++ S N  ++ + S DR+++LW LE    L   + H   +  + F   D +  
Sbjct: 178 HEGSIFYVNLSNNGRYVASCSDDRSIRLWDLETGKQLSVGWSHTARIWNLMFFDNDSK-L 236

Query: 385 ISGCLDHKVRLWSILE 400
           IS   D   R+W+I+E
Sbjct: 237 ISVSEDCTCRVWNIIE 252

>Scas_652.16
          Length = 345

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 17/26 (65%)

Query: 178 IWITKFSLDGKFMASAGKSGIIRVWK 203
           IW   ++L G  ++SAG  G +R+WK
Sbjct: 303 IWSVSWNLTGTILSSAGDDGKVRLWK 328

 Score = 30.0 bits (66), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 23/34 (67%), Gaps = 3/34 (8%)

Query: 324 FKEHTADVLDLDWSKNNF---LITSSMDRTVKLW 354
           +K H + ++ +DW+   +   ++++S D+TVKLW
Sbjct: 54  WKAHDSSIVSVDWASPEYGRIIVSASYDKTVKLW 87

>Kwal_56.24332
          Length = 418

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 41/86 (47%), Gaps = 7/86 (8%)

Query: 336 WSK--NNFLITSSMDRTVKLWHLERQTSLKT--FQHQDFVTCVRFHPTDDRFFISGCLDH 391
           W+K   N +I+SS+D T  +W L+    +KT    H   V  V+F     + F S   D 
Sbjct: 173 WNKIDPNLIISSSIDTTCTVWDLQSPNYVKTQLIAHDSEVYDVKFLAQSTQLFASCGGDG 232

Query: 392 KVRLW---SILENEITFEFDCQDLIT 414
            VR++   S+  + I +E + Q   T
Sbjct: 233 SVRVFDLRSLAHSTIIYEPNGQSAAT 258

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 54/123 (43%), Gaps = 10/123 (8%)

Query: 320 CFKIFKEHTADVLDLDWSKN-NFLITSSMDRTVKLW---HLERQTSLKTFQHQDFVTCVR 375
           C  + +EH+ DV  + W ++   L +SS D TV++W     + +       H+  V    
Sbjct: 147 CISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSD 206

Query: 376 FHPTDDRF-FISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGK--YTIVGTFN 432
           F  ++      SG  D  VR+W + ++   +E   Q+ I    L     +  Y++  +  
Sbjct: 207 FEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYE---QEWIQESILPKAHTRAVYSVNWSPK 263

Query: 433 GYV 435
           GY+
Sbjct: 264 GYI 266

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 327 HTADVLDLDWSKN-NFLITSSMDRTVKLWH 355
           HT  ++ LD S N +FL++   DR++KLW+
Sbjct: 436 HTDKIISLDISNNSHFLVSGGWDRSIKLWN 465

>KLLA0F06754g complement(650475..651509) similar to sp|P53011
           Saccharomyces cerevisiae YGL100w SEH1 nuclear pore
           protein, start by similarity
          Length = 344

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 47/112 (41%), Gaps = 14/112 (12%)

Query: 324 FKEHTADVLDLDWSKNNF---LITSSMDRTVKLWHLERQT-SLKTFQHQDFVTC------ 373
           +K H + ++ LDW+   F   + + S D+T+KLW  +     L   + Q   T       
Sbjct: 51  WKAHDSSIVSLDWAAPEFGRIIASVSYDKTIKLWEEDPDALELSGKRWQKLCTLNDATGP 110

Query: 374 ---VRFHPTDDRFFISGCL-DHKVRLWSILENEITFEFDCQDLITSLTLSPG 421
              V+F P+     ++    D K+RL+  LE+     +     IT L   P 
Sbjct: 111 LFSVKFAPSHLGLRLAALGNDGKLRLYDALESSDLRSWTLTSEITVLNTPPA 162

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.129    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,555,154
Number of extensions: 1000748
Number of successful extensions: 5252
Number of sequences better than 10.0: 308
Number of HSP's gapped: 5084
Number of HSP's successfully gapped: 550
Length of query: 908
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 797
Effective length of database: 12,753,511
Effective search space: 10164548267
Effective search space used: 10164548267
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)