Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_717.6734334318450.0
YMR101C (SRT1)3433409941e-135
Kwal_26.76493623158441e-111
CAGL0K03355g3422928401e-111
Sklu_2430.113892828451e-111
ABL022W4333277831e-101
KLLA0B12848g3613037171e-92
Scas_716.563302394653e-55
AER003C2742524412e-52
CAGL0C04279g2742474387e-52
KLLA0E17259g2752734334e-51
YBR002C (RER2)2862363997e-46
Kwal_27.109862852473873e-44
KLLA0C04862g63193654.6
AGR173C81555654.9
CAGL0M11616g488082647.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_717.67
         (343 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_717.67                                                           715   0.0  
YMR101C (SRT1) [4059] chr13 complement(468444..469475) cis-Preny...   387   e-135
Kwal_26.7649                                                          329   e-111
CAGL0K03355g complement(304962..305990) similar to sp|Q03175 Sac...   328   e-111
Sklu_2430.11 YMR101C, Contig c2430 20248-21417                        330   e-111
ABL022W [570] [Homologous to ScYMR101C (SRT1) - SH] complement(3...   306   e-101
KLLA0B12848g 1122397..1123482 similar to sp|Q03175 Saccharomyces...   280   1e-92
Scas_716.56                                                           183   3e-55
AER003C [2508] [Homologous to ScYBR002C (RER2) - SH] (638834..63...   174   2e-52
CAGL0C04279g 416100..416924 similar to sp|P35196 Saccharomyces c...   173   7e-52
KLLA0E17259g 1530035..1530862 similar to sp|P35196 Saccharomyces...   171   4e-51
YBR002C (RER2) [195] chr2 complement(241672..242532) Cis-prenylt...   158   7e-46
Kwal_27.10986                                                         153   3e-44
KLLA0C04862g 442167..444062 highly similar to sp|P46943 Saccharo...    30   4.6  
AGR173C [4484] [Homologous to ScYDR217C (RAD9) - SH] (1075115..1...    30   4.9  
CAGL0M11616g complement(1141541..1156183) similar to sp|Q12019 S...    29   7.2  

>Scas_717.67
          Length = 343

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/343 (100%), Positives = 343/343 (100%)

Query: 1   MFKAVLEVQIKWLFMLVKEIKHLVFRTIHNVKQHLTNFLFSLPIFVWFHKKTQLLLIKIL 60
           MFKAVLEVQIKWLFMLVKEIKHLVFRTIHNVKQHLTNFLFSLPIFVWFHKKTQLLLIKIL
Sbjct: 1   MFKAVLEVQIKWLFMLVKEIKHLVFRTIHNVKQHLTNFLFSLPIFVWFHKKTQLLLIKIL 60

Query: 61  SVAQVPEHVSFIMDGNRRYAKSRNLPLNKGHEAGGVTLLTLAYICKKIGVKCVSAYAFSI 120
           SVAQVPEHVSFIMDGNRRYAKSRNLPLNKGHEAGGVTLLTLAYICKKIGVKCVSAYAFSI
Sbjct: 61  SVAQVPEHVSFIMDGNRRYAKSRNLPLNKGHEAGGVTLLTLAYICKKIGVKCVSAYAFSI 120

Query: 121 ENFNRSKEEVDTLMELFSAKLDEFAKRAIDYRDPLYGSRLKVVGDHSLISKELRDKIYKV 180
           ENFNRSKEEVDTLMELFSAKLDEFAKRAIDYRDPLYGSRLKVVGDHSLISKELRDKIYKV
Sbjct: 121 ENFNRSKEEVDTLMELFSAKLDEFAKRAIDYRDPLYGSRLKVVGDHSLISKELRDKIYKV 180

Query: 181 EQLTTDGSDFTFYVCFPYTARNDIYHTMYNFIANPEPEKEKSEELTIEKFTSQMYLREFS 240
           EQLTTDGSDFTFYVCFPYTARNDIYHTMYNFIANPEPEKEKSEELTIEKFTSQMYLREFS
Sbjct: 181 EQLTTDGSDFTFYVCFPYTARNDIYHTMYNFIANPEPEKEKSEELTIEKFTSQMYLREFS 240

Query: 241 NKCDLLIRTSGHNRFSDYMLWQTHENGTIEFCNTFWPDFGFMGMYMIILKWSFFKTIQKF 300
           NKCDLLIRTSGHNRFSDYMLWQTHENGTIEFCNTFWPDFGFMGMYMIILKWSFFKTIQKF
Sbjct: 241 NKCDLLIRTSGHNRFSDYMLWQTHENGTIEFCNTFWPDFGFMGMYMIILKWSFFKTIQKF 300

Query: 301 NEMNFSLKTIWYEGPNSKIQNRYTKLEELPEPPVHVSVLGERE 343
           NEMNFSLKTIWYEGPNSKIQNRYTKLEELPEPPVHVSVLGERE
Sbjct: 301 NEMNFSLKTIWYEGPNSKIQNRYTKLEELPEPPVHVSVLGERE 343

>YMR101C (SRT1) [4059] chr13 complement(468444..469475)
           cis-Prenyltransferase (dehydrodolichyl diphosphate
           synthetase), synthesizes long-chain polyprenol compounds
           [1032 bp, 343 aa]
          Length = 343

 Score =  387 bits (994), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 250/340 (73%), Gaps = 4/340 (1%)

Query: 4   AVLEVQIKWLFMLVKEIKHLVFRTIHNVKQHLTNFLFSLPIFVWFHKKTQLLLIKILSVA 63
           +++++Q   L  L+ E K  +   + ++ Q +  ++ SL +F WF+   Q +LIK L V 
Sbjct: 5   SIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFYVNLQNILIKALRVG 64

Query: 64  QVPEHVSFIMDGNRRYAKSRNLPLNKGHEAGGVTLLTLAYICKKIGVKCVSAYAFSIENF 123
            VPEHVSFIMDGNRRYAKSR LP+ KGHEAGG+TLLTL YICK++GVKCVSAYAFSIENF
Sbjct: 65  PVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLLTLLYICKRLGVKCVSAYAFSIENF 124

Query: 124 NRSKEEVDTLMELFSAKLDEFAKRAIDYRDPLYGSRLKVVGDHSLISKELRDKIYKVEQL 183
           NR KEEVDTLM LF+ KLDEFAKRA DY+DPLYGS++++VGD SL+S E+R KI KVE++
Sbjct: 125 NRPKEEVDTLMNLFTVKLDEFAKRAKDYKDPLYGSKIRIVGDQSLLSPEMRKKIKKVEEI 184

Query: 184 TTDGSDFTFYVCFPYTARNDIYHTMYNFIANPEPEKEKSEELTIEKFTSQMYLREFSNKC 243
           T DG DFT ++CFPYT+RND+ HT+ + +   +  + KS  + I KFT++MY+   SNKC
Sbjct: 185 TQDGDDFTLFICFPYTSRNDMLHTIRDSVE--DHLENKSPRINIRKFTNKMYMGFHSNKC 242

Query: 244 DLLIRTSGHNRFSDYMLWQTHENGTIEFCNTFWPDFGFMGMYMIILKWSFFKTIQKFNEM 303
           +LLIRTSGH R SDYMLWQ HEN TIEF +T WP+F F  MY++ILKWSFF TIQK+NE 
Sbjct: 243 ELLIRTSGHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKYNEK 302

Query: 304 NFSLKTIWYEGPNSKIQNRYTKLE--ELPEPPVHVSVLGE 341
           N SL    +E   S  + + T +     P PP+ VSV G+
Sbjct: 303 NHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGD 342

>Kwal_26.7649
          Length = 362

 Score =  329 bits (844), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 158/315 (50%), Positives = 211/315 (66%), Gaps = 3/315 (0%)

Query: 28  IHNVKQHLTNFLFSLPIFVWFHKKTQLLLIKILSVAQVPEHVSFIMDGNRRYAKSRNLPL 87
           +H  K  + +F+ ++ I  W   + Q++L  IL V  +P HVSFIMDGNRRYAKS ++P+
Sbjct: 45  VHAQKLRIWSFVLNMAIVRWILIQIQMILTNILRVGPLPPHVSFIMDGNRRYAKSLSVPI 104

Query: 88  NKGHEAGGVTLLTLAYICKKIGVKCVSAYAFSIENFNRSKEEVDTLMELFSAKLDEFAKR 147
             GHEAG +TLL L   C+ +G+K VSAYAFSIENFNR +EEVDTL  L + KLDE A+R
Sbjct: 105 KAGHEAGALTLLNLLVTCRNLGIKTVSAYAFSIENFNRPQEEVDTLTGLLAEKLDEVARR 164

Query: 148 AIDYRDPLYGSRLKVVGDHSLISKELRDKIYKVEQLTTDGSDFTFYVCFPYTARNDIYHT 207
           A D    LYG RL+VVG+ S ISK L D+I +VE+LT +G   T Y+CFPYT+RNDIYH 
Sbjct: 165 ACDRESELYGLRLRVVGERSRISKSLNDRISRVERLTDEGDIMTLYICFPYTSRNDIYHA 224

Query: 208 MYNFIANPEPEKEKSEELTIEKFTSQMYLREFSNKCDLLIRTSGHNRFSDYMLWQTHENG 267
           +YN   + +       ++     T+ M+++E SNKCDLLIRTSGH R SDYMLWQ HENG
Sbjct: 225 IYNCAESCKYLNSPVSDIDETYLTNNMFMKEQSNKCDLLIRTSGHTRLSDYMLWQAHENG 284

Query: 268 TIEFCNTFWPDFGFMGMYMIILKWSFFKTIQKFNEMNFSLKT---IWYEGPNSKIQNRYT 324
            IEF NT WPDF F   + ++LKWSFF ++++    N SL++    +++      + +  
Sbjct: 285 VIEFSNTLWPDFDFFEFFKMLLKWSFFTSVRRKQLNNVSLRSQTLSFFKRTLFPFKRKQV 344

Query: 325 KLEELPEPPVHVSVL 339
             E+LPEPP  VSV+
Sbjct: 345 SYEDLPEPPQAVSVV 359

>CAGL0K03355g complement(304962..305990) similar to sp|Q03175
           Saccharomyces cerevisiae YMR101c, hypothetical start
          Length = 342

 Score =  328 bits (840), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 158/292 (54%), Positives = 202/292 (69%), Gaps = 10/292 (3%)

Query: 53  QLLLIKILSVAQVPEHVSFIMDGNRRYAKSRNLPLNKGHEAGGVTLLTLAYICKKIGVKC 112
           Q +LI  L    VP HV+FIMDGNRR+AKS+++PL KGHEAGG TLLTL YICK +GVKC
Sbjct: 52  QKMLIFALRTGPVPAHVAFIMDGNRRFAKSKDIPLRKGHEAGGETLLTLVYICKTLGVKC 111

Query: 113 VSAYAFSIENFNRSKEEVDTLMELFSAKLDEFAKRAIDYRDPLYGSRLKVVGDHSLISKE 172
           +SAYAFSIENFNR +EEV+TLM LF  KLDEFA++A DY+DPLYGS L++VGD SLIS E
Sbjct: 112 ISAYAFSIENFNRPREEVETLMNLFGDKLDEFAQKANDYKDPLYGSSLRIVGDRSLISPE 171

Query: 173 LRDKIYKVEQLTTDGSDFTFYVCFPYTARNDIYHTMYNFIANPEPEKEKSEELTIEKFTS 232
           LR++I  VE+LT +   F  Y+CFPYT+RNDI+ T+                L+I +FT 
Sbjct: 172 LRERIENVEKLTENSEKFILYICFPYTSRNDIFQTVTKVTDKYVQSNIIDSNLSINEFTK 231

Query: 233 QMYLREFSNKCDLLIRTSGHNRFSDYMLWQTHENGTIEFCNTFWPDFGFMGMYMIILKWS 292
            M+ +E+S+ CD+LIRTSGH R SD+MLWQ +E+ T+EF  + WP F F  MY+IIL+WS
Sbjct: 232 SMHFKEYSDNCDILIRTSGHKRLSDFMLWQVNEHATMEFSTSLWPQFNFFQMYLIILRWS 291

Query: 293 FFKTIQKFNEMNFSLKTIWYEGPNSKIQNRYTKL------EELPEPPVHVSV 338
            FK  Q +N  N S  + +     SK+   Y  +      E LP+PP+ V V
Sbjct: 292 MFKMFQIYNMNNVSKHSKF----GSKLYKPYKTILKYIFSERLPDPPMAVPV 339

>Sklu_2430.11 YMR101C, Contig c2430 20248-21417
          Length = 389

 Score =  330 bits (845), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 153/282 (54%), Positives = 192/282 (68%), Gaps = 5/282 (1%)

Query: 32  KQHLTNFLFSLPIFVWFHKKTQLLLIKILSVAQVPEHVSFIMDGNRRYAKSRNLPLNKGH 91
           K+    +L SLP+  W     Q  L+ IL    +P H+SFIMDGNRRYAKS  +P+ KGH
Sbjct: 70  KKQTYQYLLSLPLISWLITLLQDFLLDILRAGPLPNHISFIMDGNRRYAKSLGMPIIKGH 129

Query: 92  EAGGVTLLTLAYICKKIGVKCVSAYAFSIENFNRSKEEVDTLMELFSAKLDEFAKRAIDY 151
           EAG +TLL + Y CKK+G+K  SAYAFSIENFNR KEEVDTL  L + KLDE A +A D 
Sbjct: 130 EAGAITLLRMLYNCKKLGIKTTSAYAFSIENFNRPKEEVDTLTRLLAEKLDEIAVKAQDV 189

Query: 152 RDPLYGSRLKVVGDHSLISKELRDKIYKVEQLTT-----DGSDFTFYVCFPYTARNDIYH 206
           +D LYGS  KVVGD SLIS+EL DKI  VE++T      +      Y+CFPYT+RNDIYH
Sbjct: 190 KDELYGSSFKVVGDRSLISRELNDKITNVERMTAVNDVDEEKTSLLYICFPYTSRNDIYH 249

Query: 207 TMYNFIANPEPEKEKSEELTIEKFTSQMYLREFSNKCDLLIRTSGHNRFSDYMLWQTHEN 266
            MYN +   +     +E +++E  T  MY  EFSNKCDLLIRTSGH R SDYMLWQ+HEN
Sbjct: 250 AMYNTVERVKYHGMSTESISVESLTDAMYFDEFSNKCDLLIRTSGHTRLSDYMLWQSHEN 309

Query: 267 GTIEFCNTFWPDFGFMGMYMIILKWSFFKTIQKFNEMNFSLK 308
           G IEF  T WP + F+  Y+++++WSFF ++Q+F    FS +
Sbjct: 310 GMIEFSTTLWPSYTFLEFYLVLVRWSFFTSLQRFQTSGFSAR 351

>ABL022W [570] [Homologous to ScYMR101C (SRT1) - SH]
           complement(356930..358231) [1302 bp, 433 aa]
          Length = 433

 Score =  306 bits (783), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 151/327 (46%), Positives = 203/327 (62%), Gaps = 4/327 (1%)

Query: 16  LVKEIKHLV---FRTIHNVKQHLTNFLFSLPIFVWFHKKTQLLLIKILSVAQVPEHVSFI 72
           L   +K LV   ++  +  +  +++ LF   +        Q LL+KIL +  +P+HVSFI
Sbjct: 104 LRARVKRLVRGEWKQTYRNRPKISHILFQFGLLRMVVNFVQNLLLKILQMGPLPQHVSFI 163

Query: 73  MDGNRRYAKSRNLPLNKGHEAGGVTLLTLAYICKKIGVKCVSAYAFSIENFNRSKEEVDT 132
           MDGNRRYAKS NLPL  GHEAG V L+   + CK+ G++ VSAYAFSIENFNR KEE+DT
Sbjct: 164 MDGNRRYAKSMNLPLKLGHEAGSVALMRTLHTCKRAGIEAVSAYAFSIENFNRPKEEIDT 223

Query: 133 LMELFSAKLDEFAKRAIDYRDPLYGSRLKVVGDHSLISKELRDKIYKVEQLTTDGSDFTF 192
           L E+ S +L +FA RA + +D +YG+RL VVGD +L+S EL DKI  +E +T   + FT 
Sbjct: 224 LTEMLSRRLQDFANRATNLKDRMYGARLLVVGDRALLSPELNDKITYIEDMTKHNTAFTV 283

Query: 193 YVCFPYTARNDIYHTMYNFIANPEPEKEKSEELTIEKFTSQMYLREFSNKCDLLIRTSGH 252
           Y+C PYT RNDIYH M++ +   +     S++++ E  T+ MYL   SN+ D+L+RTSGH
Sbjct: 284 YICLPYTTRNDIYHAMFDLVRLCQAGALDSKDISTEMLTNAMYLGANSNRADILVRTSGH 343

Query: 253 NRFSDYMLWQTHENGTIEFCNTFWPDFGFMGMYMIILKWSFFKTIQKFNEM-NFSLKTIW 311
            R SDYMLWQ HE   IEF N  WPDF F   + I+LKWSF   + +  +      K   
Sbjct: 344 TRLSDYMLWQVHEQSYIEFSNCMWPDFTFRTFFTILLKWSFVTALHEARKQERLRRKLGT 403

Query: 312 YEGPNSKIQNRYTKLEELPEPPVHVSV 338
           Y       + R  +LE LP PP  +SV
Sbjct: 404 YARSLLARRARPVRLEALPPPPQAISV 430

>KLLA0B12848g 1122397..1123482 similar to sp|Q03175 Saccharomyces
           cerevisiae YMR101c SRT1 cis-prenyltransferase homologue,
           start by similarity
          Length = 361

 Score =  280 bits (717), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 143/303 (47%), Positives = 195/303 (64%), Gaps = 15/303 (4%)

Query: 44  IFVWFHKKTQLLLIKILSVAQVPEHVSFIMDGNRRYAKSRNLPLNKGHEAGGVTLLTLAY 103
           +F W     Q+ +++IL +  VP H+SFIMDGNRRYAK  + P+ +GH AGG TL+ + +
Sbjct: 63  LFAWL----QMFMVRILRMGPVPRHLSFIMDGNRRYAKKLDQPVKEGHRAGGATLIDILH 118

Query: 104 ICKKIGVKCVSAYAFSIENFNRSKEEVDTLMELFSAKLDEFAKRAIDYRDPLYGSRLKVV 163
           IC+++ V  VSAYAFSIENFNRS +EV TLMEL    +D+F +RA + +D LYG RL+VV
Sbjct: 119 ICRRLNVSSVSAYAFSIENFNRSPQEVATLMELLGYYIDQFTERATNAKDELYGIRLRVV 178

Query: 164 GDHSLISKELRDKIYKVEQLTTDGSDFTFYVCFPYTARNDIYHTMYNFIANPEPEKEKSE 223
           GD SL+S+EL  KI   E+LT DG +F  Y+  PYT+RNDI H+M       +     +E
Sbjct: 179 GDLSLLSEELLKKIRNAEKLTRDGQEFVLYLALPYTSRNDIAHSMQ---VTTDKCINSNE 235

Query: 224 ELTIEKFTSQMYLREFSNKCDLLIRTSGHNRFSDYMLWQTHENGTIEFCNTFWPDFGFMG 283
           ++T +  T  MY  ++SNKCDLLIRTSGH R SDYMLWQ HE   IEF +  WPDF F  
Sbjct: 236 DITEQALTDNMYFEQYSNKCDLLIRTSGHTRLSDYMLWQVHEGSIIEFVDCLWPDFNFWR 295

Query: 284 MYMIILKWSFFKTIQKFNEMNFSLKTIWYEGPN--------SKIQNRYTKLEELPEPPVH 335
           +Y I+LKWSF++T Q  +++   ++T     P         +  + +   L+ LP  P+ 
Sbjct: 296 LYWIMLKWSFYQTWQNASQLPDPVRTRTRVFPKISGALPIETLKRTKRVALDSLPAAPLA 355

Query: 336 VSV 338
           VSV
Sbjct: 356 VSV 358

>Scas_716.56
          Length = 330

 Score =  183 bits (465), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 94/239 (39%), Positives = 136/239 (56%), Gaps = 3/239 (1%)

Query: 65  VPEHVSFIMDGNRRYAKSRNLPLNKGHEAGGVTLLTLAYICKKIGVKCVSAYAFSIENFN 124
           VP HV FIMDGNRRYA+  +L + +GHEAG  T+  +  +C + GV+C + YAFSIENF 
Sbjct: 67  VPRHVGFIMDGNRRYARRNHLQVKEGHEAGFFTMSKILELCYESGVECATVYAFSIENFK 126

Query: 125 RSKEEVDTLMELFSAKLDEFAKRAIDYRDPLYGSRLKVVGDHSLISKELRDKIYKVEQLT 184
           RS  EVD LM+L   ++ +    A       YG +++++GD SL+ KELRD +    ++T
Sbjct: 127 RSPHEVDALMKLAKDRIRQIV--ASGEMAEKYGIKVRIIGDLSLLDKELRDDMNNAMEIT 184

Query: 185 TDGSDFTFYVCFPYTARNDIYHTMYNFIANPEPEKEKSEELTIEKFTSQMYLREFSNKCD 244
            +       +CFPYT R +I H+M N +   +   +  + +  E+  +           D
Sbjct: 185 KNNKRAVLNICFPYTGREEIVHSMQNVVELAQANSDDPKFIIDEQLINANLYTGDQPPLD 244

Query: 245 LLIRTSGHNRFSDYMLWQTHENG-TIEFCNTFWPDFGFMGMYMIILKWSFFKTIQKFNE 302
           LLIRTSG  R SD+M+WQ    G  IE  +  WPDFG + M  I+LK+ F K+    N+
Sbjct: 245 LLIRTSGMVRLSDFMVWQVSNKGVAIELIDCLWPDFGPLRMAWILLKFVFQKSFSNRNK 303

>AER003C [2508] [Homologous to ScYBR002C (RER2) - SH]
           (638834..639658) [825 bp, 274 aa]
          Length = 274

 Score =  174 bits (441), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 90/252 (35%), Positives = 146/252 (57%), Gaps = 8/252 (3%)

Query: 47  WFHKKTQLLLIKIL-SVAQVPEHVSFIMDGNRRYAKSRNLPLNKGHEAGGVTLLTLAYIC 105
           W   + + + + +L S  +VP+HV FIMDGNRRYAK  N+ + +GH AG +++  +  +C
Sbjct: 12  WLISRLKDVFVSVLRSSGRVPKHVGFIMDGNRRYAKKHNIEVREGHSAGFMSMNKVLELC 71

Query: 106 KKIGVKCVSAYAFSIENFNRSKEEVDTLMELFSAKLDEFAKRAIDYRDPLYGSRLKVVGD 165
            + GV   + +AFS++NF RS  EVD+LMEL   ++ +  +         YG  ++++GD
Sbjct: 72  YESGVTTATVFAFSVDNFRRSAFEVDSLMELAKERVMQITQHG--ELAEQYGIHVRIIGD 129

Query: 166 HSLISKELRDKIYKVEQLTTDGSDFTFYVCFPYTARNDIYHTMYNFIANPEPEKEKSEEL 225
            SL+  ++++++ + E+ T   +     VC PYTAR +I H M   IA+ + +      +
Sbjct: 130 RSLLPADVQEEMARAEKATEANTRAVLNVCIPYTARGEILHAMKGTIADAQSD---GAPI 186

Query: 226 TIEKFTSQMYLREFSNKCDLLIRTSGHNRFSDYMLWQTHENG-TIEFCNTFWPDFGFMGM 284
           T     + MY        DLLIRTSG +R SD++LWQ  + G  IE  +  WPDFG + M
Sbjct: 187 TEADLDAHMYTGGLP-PLDLLIRTSGVSRLSDFLLWQVCQKGVVIELLSCLWPDFGPLTM 245

Query: 285 YMIILKWSFFKT 296
             I+L+++F K+
Sbjct: 246 AWILLRYAFKKS 257

>CAGL0C04279g 416100..416924 similar to sp|P35196 Saccharomyces
           cerevisiae YBR002c RER2, hypothetical start
          Length = 274

 Score =  173 bits (438), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 101/247 (40%), Positives = 140/247 (56%), Gaps = 16/247 (6%)

Query: 55  LLIKILSVAQ-VPEHVSFIMDGNRRYAKSRNLPLNKGHEAGGVTLLTLAYICKKIGVKCV 113
           L+ + LSV+  VP H+ FIMDGNRRYAK + +   +GHEAG  ++  +  +C + GV   
Sbjct: 16  LISRTLSVSNCVPRHIGFIMDGNRRYAKKKQMESKEGHEAGFRSMSKILELCYEAGVDTA 75

Query: 114 SAYAFSIENFNRSKEEVDTLMELFSAKLDEFAKRAIDYRDPL---YGSRLKVVGDHSLIS 170
           + +AFSIENF RS  EVD +M L   ++     R I     L   YG R++V+GD SL+ 
Sbjct: 76  TVFAFSIENFKRSAYEVDAIMSLARERI-----RQIREHGELAQKYGVRIRVIGDISLLD 130

Query: 171 KELRDKIYKVEQLTTDGSDFTFYVCFPYTARNDIYHTMYNFIANPE-PEKEKSEELTIEK 229
           K+L  +I    +LT + +  T  +C PYT R +IYH+M   + +     K  SEE+  E 
Sbjct: 131 KDLLKEIKNTMELTRNNTRATLNICMPYTGREEIYHSMKTVLDDDSYSSKNISEEIIDEH 190

Query: 230 FTSQMYLREFSNKCDLLIRTSGHNRFSDYMLWQTHENGT-IEFCNTFWPDFGFMGMYMII 288
             +           DLLIRTSG  R SD+MLWQT  N   IEF +  WP+FG   M  I+
Sbjct: 191 LYTA-----GQPPLDLLIRTSGVTRLSDFMLWQTCSNDVMIEFIDCLWPEFGPFRMAWIL 245

Query: 289 LKWSFFK 295
           LK++F K
Sbjct: 246 LKFAFHK 252

>KLLA0E17259g 1530035..1530862 similar to sp|P35196 Saccharomyces
           cerevisiae YBR002c RER2 cis-prenyltransferase, a key
           enzyme in dolichol synthesis, start by similarity
          Length = 275

 Score =  171 bits (433), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 99/273 (36%), Positives = 156/273 (57%), Gaps = 11/273 (4%)

Query: 41  SLPIFVWFHKKTQLLLIKIL-SVAQVPEHVSFIMDGNRRYAKSRNLPLNKGHEAGGVTLL 99
           S P +  F +  +  L K++ S  +VP+HV+FIMDGNRR+AK  N+ +N+GH AG  ++ 
Sbjct: 6   SFPGYNQFLEMVKTTLAKVIRSSDKVPQHVAFIMDGNRRFAKKNNMEVNEGHNAGFESMC 65

Query: 100 TLAYICKKIGVKCVSAYAFSIENFNRSKEEVDTLMELFSAKLDEFAKRAIDYRDPLYGSR 159
            +  +C + G+K  + +AFSIENF RS  EV+ LMEL   K+ + ++         YG +
Sbjct: 66  RILELCYESGMKVATVFAFSIENFKRSTFEVNWLMELAKDKIKQISQHG--ELAEQYGIK 123

Query: 160 LKVVGDHSLISKELRDKIYKVEQLTTDGSDFTFYVCFPYTARNDIYHTMYNFI---ANPE 216
           ++++GD SL+  ++  ++   E++T + S     +CFPYT R +I H++   +   A  E
Sbjct: 124 VQIIGDRSLLPADVLKEVELAEEITMNNSRAVLNICFPYTGREEIVHSIQGIMKETAMGE 183

Query: 217 PEKEKSEELTIEKFTSQMYLREFSNKCDLLIRTSGHNRFSDYMLWQTHENG-TIEFCNTF 275
            +    +E TIE     +Y  +     +LLIRTSG  R SD++LWQ    G TIE  +  
Sbjct: 184 IDYRDIDEQTIE---DHLYT-QGQPPVELLIRTSGVTRLSDFLLWQLSNRGCTIELVDCL 239

Query: 276 WPDFGFMGMYMIILKWSFFKTIQKFNEMNFSLK 308
           WP+F    M  I++K++F KT    NE +  LK
Sbjct: 240 WPEFTPFSMLKILIKFAFKKTYSPSNEEDDELK 272

>YBR002C (RER2) [195] chr2 complement(241672..242532)
           Cis-prenyltransferase (dehydrodolichyl diphosphate
           synthetase), involved in dolichol synthesis [861 bp, 286
           aa]
          Length = 286

 Score =  158 bits (399), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 92/236 (38%), Positives = 133/236 (56%), Gaps = 14/236 (5%)

Query: 65  VPEHVSFIMDGNRRYAKSRNLPLNKGHEAGGVTLLTLAYICKKIGVKCVSAYAFSIENFN 124
           VP HV FIMDGNRR+A+ + + + +GHEAG V++  +  +C + GV   + +AFSIENF 
Sbjct: 31  VPRHVGFIMDGNRRFARKKEMDVKEGHEAGFVSMSRILELCYEAGVDTATVFAFSIENFK 90

Query: 125 RSKEEVDTLMELFSAKLDEFAKRAIDYRDPL---YGSRLKVVGDHSLISKELRDKIYKVE 181
           RS  EV++LM L   ++     R I  R  L   YG R+K++GD SL+ K L + +    
Sbjct: 91  RSSREVESLMTLARERI-----RQITERGELACKYGVRIKIIGDLSLLDKSLLEDVRVAV 145

Query: 182 QLTTDGSDFTFYVCFPYTARNDIYHTMYNFIANPEPEKEKSEELTIEKFTSQMYLREFSN 241
           + T +    T  +CFPYT R +I H M   I     + +K   +      S +Y      
Sbjct: 146 ETTKNNKRATLNICFPYTGREEILHAMKETIV----QHKKGAAIDESTLESHLYTAGVP- 200

Query: 242 KCDLLIRTSGHNRFSDYMLWQTHENGT-IEFCNTFWPDFGFMGMYMIILKWSFFKT 296
             DLLIRTSG +R SD+++WQ    G  IE  +  WP+FG + M  I+LK+SF K+
Sbjct: 201 PLDLLIRTSGVSRLSDFLIWQASSKGVRIELLDCLWPEFGPIRMAWILLKFSFHKS 256

>Kwal_27.10986
          Length = 285

 Score =  153 bits (387), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 83/247 (33%), Positives = 141/247 (57%), Gaps = 11/247 (4%)

Query: 55  LLIKILSVA-QVPEHVSFIMDGNRRYAKSRNLPLNKGHEAGGVTLLTLAYICKKIGVKCV 113
           L  +++ V+  VP HV  IMDGNRR+AK +++ + +GH AG  ++     +C + GV   
Sbjct: 20  LFSRVIQVSGNVPRHVGLIMDGNRRWAKLKHVEIKEGHNAGFHSMSRALELCYEAGVSTA 79

Query: 114 SAYAFSIENFNRSKEEVDTLMELFSAKLDEFAKRAIDYRDPLYGSRLKVVGDHSLISKEL 173
           + +AFSIENF RS  EV++LM L  + + +  +         +G ++ V+GD SL+  ++
Sbjct: 80  TVFAFSIENFKRSSAEVESLMNLARSGIRQVVQNG--EMAEKFGIKINVIGDRSLLPADV 137

Query: 174 RDKIYKVEQLTTDGSDFTFYVCFPYTARNDIYHTMYNFIANPEPEKEKSE---ELTIEKF 230
             ++   E++T   +     +CFPYT R+++ H++   +   +     +    E TI+KF
Sbjct: 138 LREVETAEEITKANTRAVLNICFPYTGRDELLHSIRGVVNEAQCGNLNTSDINEATIDKF 197

Query: 231 TSQMYLREFSNKCDLLIRTSGHNRFSDYMLWQ-THENGTIEFCNTFWPDFGFMGMYMIIL 289
              +Y    S   DLLIRTSG  R SD+++WQ + ++  IEF +  WPDFG   M  ++L
Sbjct: 198 ---LYTGG-SPPVDLLIRTSGVTRLSDFLIWQVSRKDVVIEFLDCLWPDFGSRQMAWLLL 253

Query: 290 KWSFFKT 296
           +++F +T
Sbjct: 254 RFAFSRT 260

>KLLA0C04862g 442167..444062 highly similar to sp|P46943
           Saccharomyces cerevisiae YLR289w GUF1, start by
           similarity
          Length = 631

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 43/93 (46%), Gaps = 4/93 (4%)

Query: 48  FHKKTQLLLIKILSVAQVPEHVSFIMDGNRRYAKSRNLPL----NKGHEAGGVTLLTLAY 103
           F++  +  L  +L +   P HV F  + +R YA      L    ++G +A  V    LAY
Sbjct: 91  FYQDPRTKLDYLLHLVDTPGHVDFRAEVSRSYASCGGALLLVDASQGVQAQTVANFYLAY 150

Query: 104 ICKKIGVKCVSAYAFSIENFNRSKEEVDTLMEL 136
                 +  ++     I + ++++E+V+ + EL
Sbjct: 151 SMDLKLIPVINKIDLDIADIDQAEEQVENMFEL 183

>AGR173C [4484] [Homologous to ScYDR217C (RAD9) - SH]
           (1075115..1077562) [2448 bp, 815 aa]
          Length = 815

 Score = 29.6 bits (65), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 1/55 (1%)

Query: 288 ILKWSFFKTIQKFNEMNFSLKTIWYEGPNSKIQNRYTKLEELPEPPVHVSVLGER 342
           + +WS     ++      S  T  Y+ PN    N Y    ++ E PVHVS LG++
Sbjct: 124 VERWSTASDAKRVMRAPGSSPTK-YKRPNYAAANLYGPSTQVIESPVHVSALGDQ 177

>CAGL0M11616g complement(1141541..1156183) similar to sp|Q12019
           Saccharomyces cerevisiae YLR106c, hypothetical start
          Length = 4880

 Score = 29.3 bits (64), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 38/82 (46%), Gaps = 10/82 (12%)

Query: 79  YAKSRNLPLNKGHEAGGVTLLTLAYICKKIGVKCVSAYAFSIENFNRSKEEVDTLM--EL 136
           Y   + + LNKG  + G+++  L  +C ++         F+  N   S   ++T +  ++
Sbjct: 495 YQDPKFISLNKGSHSRGISIRDLTKLCHRL------TSIFTANNIKDSDHLIETSVFDDI 548

Query: 137 FSAKLDEFAKRAIDYR--DPLY 156
           F+   D F     +YR  +PLY
Sbjct: 549 FAETADCFTAAVGEYRALEPLY 570

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.138    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,843,547
Number of extensions: 521248
Number of successful extensions: 1826
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1832
Number of HSP's successfully gapped: 24
Length of query: 343
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 241
Effective length of database: 13,065,073
Effective search space: 3148682593
Effective search space used: 3148682593
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 62 (28.5 bits)