Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_717.6661261232040.0
YMR100W (MUB1)62057413181e-175
CAGL0K03333g60254713091e-174
ABL020W61060310861e-141
Kwal_26.764756553910681e-139
Sklu_2430.132061704986e-59
KLLA0B12892g6251274181e-43
Sklu_2284.359296780.27
Kwal_55.2166059797760.48
Scas_588.1183551740.81
Scas_669.201397386731.1
CAGL0H05049g907114731.2
CAGL0I00880g736143683.6
CAGL0L00539g22348673.7
KLLA0C09570g49457674.4
YOR260W (GCD1)57837675.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_717.66
         (612 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_717.66                                                          1238   0.0  
YMR100W (MUB1) [4058] chr13 (466299..468161) Zinc finger protein...   512   e-175
CAGL0K03333g 302891..304699 similar to sp|Q03162 Saccharomyces c...   508   e-174
ABL020W [572] [Homologous to ScYMR100W (MUB1) - SH] complement(3...   422   e-141
Kwal_26.7647                                                          416   e-139
Sklu_2430.13 YMR100W, Contig c2430 23178-23793                        196   6e-59
KLLA0B12892g 1124666..1126543 weakly similar to sp|Q03162 Saccha...   165   1e-43
Sklu_2284.3 YKR069W, Contig c2284 2234-4012 reverse complement         35   0.27 
Kwal_55.21660                                                          34   0.48 
Scas_588.11                                                            33   0.81 
Scas_669.20                                                            33   1.1  
CAGL0H05049g complement(483870..486593) similar to sp|P11325 Sac...    33   1.2  
CAGL0I00880g 64400..66610 weakly similar to sp|P30620 Saccharomy...    31   3.6  
CAGL0L00539g complement(59774..60445) similar to sp|Q03233 Sacch...    30   3.7  
KLLA0C09570g complement(831137..832621) similar to sp|P09032 Sac...    30   4.4  
YOR260W (GCD1) [5048] chr15 (813982..815718) Translation initiat...    30   5.4  

>Scas_717.66
          Length = 612

 Score = 1238 bits (3204), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/612 (97%), Positives = 594/612 (97%)

Query: 1   MRDSNHRSVTSNKPVIVITSTSYDRRALDVNSDRPLVSSLNHLTYQVCNSVKIRETIAND 60
           MRDSNHRSVTSNKPVIVITSTSYDRRALDVNSDRPLVSSLNHLTYQVCNSVKIRETIAND
Sbjct: 1   MRDSNHRSVTSNKPVIVITSTSYDRRALDVNSDRPLVSSLNHLTYQVCNSVKIRETIAND 60

Query: 61  GAMDRIVSILRSCHFSLYELLDLPLRHVSNHKMAQDIWKKKKQALMGWKWLLGLQCLVLT 120
           GAMDRIVSILRSCHFSLYELLDLPLRHVSNHKMAQDIWKKKKQALMGWKWLLGLQCLVLT
Sbjct: 61  GAMDRIVSILRSCHFSLYELLDLPLRHVSNHKMAQDIWKKKKQALMGWKWLLGLQCLVLT 120

Query: 121 GTRGPEDIRRKVFHAGIIPILATILDNYLLYHKNYDYMKGEPLSFDFKALDTEQMFHFLR 180
           GTRGPEDIRRKVFHAGIIPILATILDNYLLYHKNYDYMKGEPLSFDFKALDTEQMFHFLR
Sbjct: 121 GTRGPEDIRRKVFHAGIIPILATILDNYLLYHKNYDYMKGEPLSFDFKALDTEQMFHFLR 180

Query: 181 VDKNETYEDYLEFVVGKDLFRLSDDDDFINEELLRDEKINPSDFGDVWSIFTSKDGENPF 240
           VDKNETYEDYLEFVVGKDLFRLSDDDDFINEELLRDEKINPSDFGDVWSIFTSKDGENPF
Sbjct: 181 VDKNETYEDYLEFVVGKDLFRLSDDDDFINEELLRDEKINPSDFGDVWSIFTSKDGENPF 240

Query: 241 MDEDNAYYKSNFPIPREFYLGRIVPKLDDILWSLQLLAFLSKYSYTRRELQSSEFVERLS 300
           MDEDNAYYKSNFPIPREFYLGRIVPKLDDILWSLQLLAFLSKYSYTRRELQSSEFVERLS
Sbjct: 241 MDEDNAYYKSNFPIPREFYLGRIVPKLDDILWSLQLLAFLSKYSYTRRELQSSEFVERLS 300

Query: 301 FRGMINRARSRLSGIYKGNIVGAHYTPSLLKEKSPSPELGFPDMYNFEGKNDIHESLSQP 360
           FRGMINRARSRLSGIYKGNIVGAHYTPSLLKEKSPSPELGFPDMYNFEGKNDIHESLSQP
Sbjct: 301 FRGMINRARSRLSGIYKGNIVGAHYTPSLLKEKSPSPELGFPDMYNFEGKNDIHESLSQP 360

Query: 361 TTDKFLEELLDVKRKCAEISAKTDGENELLNRNPYEQLNIQISTNNSSDRHVQESQLIDN 420
           TTDKFLEELLDVKRKCAEISAKTDGENELLNRNPYEQLNIQISTNNSSDRHVQESQLIDN
Sbjct: 361 TTDKFLEELLDVKRKCAEISAKTDGENELLNRNPYEQLNIQISTNNSSDRHVQESQLIDN 420

Query: 421 FNANWNYRDLCKDLDEDTWNHIQKKEPINLFPLVENFTPGNSNPKDVVYWSSVIMRNSCR 480
           FNANWNYRDLCKDLDEDTWNHIQKKEPINLFPLVENFTPGNSNPKDVVYWSSVIMRNSCR
Sbjct: 421 FNANWNYRDLCKDLDEDTWNHIQKKEPINLFPLVENFTPGNSNPKDVVYWSSVIMRNSCR 480

Query: 481 KDEEKGVRQCANFACGKWEEYPKQFAKCRRCKSTKYCSRACQLKSWKFHRYWCNETKLPS 540
           KDEEKGVRQCANFACGKWEEYPKQFAKCRRCKSTKYCSRACQLKSWKFHRYWCNETKLPS
Sbjct: 481 KDEEKGVRQCANFACGKWEEYPKQFAKCRRCKSTKYCSRACQLKSWKFHRYWCNETKLPS 540

Query: 541 QGXXXXXXXXXXXXXXXXXXMASGAETISTHSATAVRSVQRIANNHSTLLDNVDETTEPP 600
           QG                  MASGAETISTHSATAVRSVQRIANNHSTLLDNVDETTEPP
Sbjct: 541 QGNSTTTESPSTNTTQTEPTMASGAETISTHSATAVRSVQRIANNHSTLLDNVDETTEPP 600

Query: 601 PESNNMTLNMDH 612
           PESNNMTLNMDH
Sbjct: 601 PESNNMTLNMDH 612

>YMR100W (MUB1) [4058] chr13 (466299..468161) Zinc finger protein,
           involved in the regulation of bud site selection [1863
           bp, 620 aa]
          Length = 620

 Score =  512 bits (1318), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 266/574 (46%), Positives = 369/574 (64%), Gaps = 56/574 (9%)

Query: 1   MRDSNHRSVTSNKPVIVITSTSYDRRALDVNSDRPLVSSLNHLTYQVCNSVKIRETIAND 60
           MRDSNHRS+TSNKP++ ITST YDRRALD+NS  PL++SLN+LTY   NS K+RET+AND
Sbjct: 1   MRDSNHRSLTSNKPIVTITSTVYDRRALDINSSIPLINSLNYLTYLTSNSSKVRETVAND 60

Query: 61  GAMDRIVSILRSCHFSLYELLDLPLRHVSNHKMAQDIWKKKKQALMGWKWLLGLQCLVLT 120
           GA++R+VSILRSCH SL+ELLDL L + + H+  +D+WK+K+ AL  WKW L  QCLVLT
Sbjct: 61  GALERLVSILRSCHLSLFELLDLDLENFNEHENIKDLWKEKRLALCAWKWTLTFQCLVLT 120

Query: 121 GTRGPEDIRRKVFHAGIIPILATILDNYLLYHKNYDYMKGEPLSFDFKALDTEQMFHFLR 180
           GTRG E IR+KV  +G++ +L T+LDNYLLYHKNYD++K + ++FDFK + TE M+ F+R
Sbjct: 121 GTRGTEQIRKKVVMSGVLSVLVTVLDNYLLYHKNYDFIKDQTMTFDFKGITTETMYKFMR 180

Query: 181 VDKNETYEDYLEFVVGKDLFRLSDDDDFINEELLRDEKINPSDFGDVWSIFT-------- 232
            D+NETY+ Y+EF+ G+D  +LS D +F+NE L+      P+DF D+W  F         
Sbjct: 181 KDENETYQQYIEFITGQDKLKLSTDKNFLNERLVAPSMTIPTDFSDIWGRFADLASNFEP 240

Query: 233 SKDGENPFMDEDNAYYKSNF-----------------PIPREFYLGRIVPKLDDILWSLQ 275
            ++  +  +D D+     NF                   PREF+LGRIVPK DD++WSLQ
Sbjct: 241 DQERHDDDIDIDSEVESENFDAHKNFFSQPDINRPTISTPREFFLGRIVPKQDDVIWSLQ 300

Query: 276 LLAFLSKYSYTRRELQSSEFVERLSFRGMINRARSRLSGIYKGNIVGAHYTPSLLKEKSP 335
           LLAF+SKY+Y +  LQ+ E VE LSFR M  + + R+S              + L+E+  
Sbjct: 301 LLAFVSKYTYMKSTLQNVELVESLSFRSMAYKIKQRISE------------ENDLEEQER 348

Query: 336 SPELGFPDMYNFEGKNDIHES----LSQPTTDKFLEELLDVKRKCAEISAKTDGENELLN 391
              +    +Y +  KN  + S    L     D F +EL ++  +C +     + +NE+ N
Sbjct: 349 DVTVKLSSLYPYLSKNPENNSKVKALDTSKMDPFFKELEELSNRCQQ-----EEQNEICN 403

Query: 392 R-----NPYEQLNIQISTNNSS-----DRHVQESQLIDNFNANWNYRDLCKDLDEDTWNH 441
                 N +E+  +   +++++     +R     ++ DNF   W+Y  + K+L    + +
Sbjct: 404 NHCPVLNLFERYRVPKPSDDNAYGKDKERINLRKKISDNFERRWSYDKMKKELTNIVYKN 463

Query: 442 IQKKEPINLFPLVENFTPGNSNPKDVVYWSSVIMRNSCRKDEEKGVRQCANFACGKWEEY 501
                 +N+FPLVE +T    N  DV+YWSSVIMRNSCRK+E  GVRQCANF+CGKWE++
Sbjct: 464 KVLTNVVNIFPLVEKYTVSAENTHDVIYWSSVIMRNSCRKNEILGVRQCANFSCGKWEDF 523

Query: 502 PKQFAKCRRCKSTKYCSRACQLKSWKFHRYWCNE 535
           P+QFAKCRRCK TKYCSR CQLK+W +HRYWC+E
Sbjct: 524 PRQFAKCRRCKRTKYCSRKCQLKAWGYHRYWCHE 557

>CAGL0K03333g 302891..304699 similar to sp|Q03162 Saccharomyces
           cerevisiae YMR100w involved in budding, start by
           similarity
          Length = 602

 Score =  508 bits (1309), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 255/547 (46%), Positives = 355/547 (64%), Gaps = 31/547 (5%)

Query: 1   MRDSNHRSVTSNKPVIVITSTSYDRRALDVNSDRPLVSSLNHLTYQVCNSVKIRETIAND 60
           MRDSNHRS+++NKPVI ITST YDRRALD+ S  PL++SLNHLTY   NS KIRETIAND
Sbjct: 1   MRDSNHRSISNNKPVITITSTVYDRRALDIESTVPLINSLNHLTYLTSNSAKIRETIAND 60

Query: 61  GAMDRIVSILRSCHFSLYELLDLPLRHVSNHKMAQDIWKKKKQALMGWKWLLGLQCLVLT 120
           GA+DR+VSIL +CH SL+E+LD  L     H+ A+ I+K+K+ AL  WKW L  QCLVLT
Sbjct: 61  GALDRLVSILHNCHLSLHEILDKDLEFFKTHERAKSIYKRKRLALCAWKWTLAFQCLVLT 120

Query: 121 GTRGPEDIRRKVFHAGIIPILATILDNYLLYHKNYDYMKGEPLSFDFKALDTEQMFHFLR 180
           GTRG E IR+KV  AG+IP+LAT+LDNY+L+HK+YD+++ E L F+   + T   +  LR
Sbjct: 121 GTRGTEQIRKKVVLAGVIPVLATVLDNYMLFHKHYDFIRDETLDFEIDEILTFDSYKLLR 180

Query: 181 VDKNETYEDYLEFVVGKDLFRLSDDDDFINEELLRDEKINPSDFGDVWSIF------TSK 234
            +  ETYE+Y+ +++G+D  + +D   F  EEL        +DF DVW  +      T  
Sbjct: 181 KNSEETYEEYISYLIGRDKLKPTDFKRFSVEELTTPIMTCATDFRDVWQRYNDSPLPTPS 240

Query: 235 DGENPFMDEDNAYYKSN-----FPIPREFYLGRIVPKLDDILWSLQLLAFLSKYSYTRRE 289
           D  N  + E+N +Y+++        PR F++G+I+PK DD++WSLQLLAF+SKY+Y +++
Sbjct: 241 DKSNAKL-EENCFYENDEEKFLVSTPRSFFIGKIIPKQDDVIWSLQLLAFISKYTYMKQK 299

Query: 290 LQSSEFVERLSFRGMINRARSRLSGIYKGNIVGAHYTP-SLLKEKSPSPELGFPDMYNFE 348
           LQ+ E ++ LSFR MI R + R    +  N+     +P S+ K  S   E    D+ +  
Sbjct: 300 LQNVELIDSLSFRSMIERYKKRKMTTFSNNL-----SPLSISKNLSEKDENIVGDIKDES 354

Query: 349 GKNDIHESLSQPTTDKFLEELLDVKRKCAEISAKTDGENELLNRNPYEQLNIQISTNNSS 408
              ++   ++ P     ++E+++  ++C +I  K         R   +        N  S
Sbjct: 355 DITNLQMKINNP----IIKEIMECGKRCLKIEKK---------RKECKPKCRTCILNMKS 401

Query: 409 DRHVQESQLIDNFNANWNYRDLCKDLDEDTWNHIQKKEPINLFPLVENFTPGNSNPKDVV 468
             +++  QL   F+  WNY+ + K L ++TWN    K+ IN FPLVE +T  + N  D++
Sbjct: 402 PPYIKNLQLNKYFDRLWNYQKVSKRLTDETWNSFISKQLINAFPLVEKYTITDKNTHDII 461

Query: 469 YWSSVIMRNSCRKDEEKGVRQCANFACGKWEEYPKQFAKCRRCKSTKYCSRACQLKSWKF 528
           YWSSVIMRNSCRK+E  GVRQCANF+CGKWE YP++FAKCRRCK TKYCSR CQL++WK 
Sbjct: 462 YWSSVIMRNSCRKNEVTGVRQCANFSCGKWERYPREFAKCRRCKRTKYCSRECQLEAWKH 521

Query: 529 HRYWCNE 535
           HRYWC+E
Sbjct: 522 HRYWCHE 528

>ABL020W [572] [Homologous to ScYMR100W (MUB1) - SH]
           complement(359098..360930) [1833 bp, 610 aa]
          Length = 610

 Score =  422 bits (1086), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 235/603 (38%), Positives = 343/603 (56%), Gaps = 75/603 (12%)

Query: 1   MRDSNHRSVTSNKPVIVITSTSYDRRALDVNSDRPLVSSLNHLTYQVCNSVKIRETIAND 60
           MR+ NHRSV SN+   +I+ T YDRRALD  +D PL++SLNHLT+   +S K+RET++ D
Sbjct: 1   MRELNHRSVLSNRASFIISQTVYDRRALDNVADLPLINSLNHLTFLTSSSAKVRETMSED 60

Query: 61  GAMDRIVSILRSCHFSLYELLDLPLRHVSNHKMAQDIWKKKKQALMGWKWLLGLQCLVLT 120
           GA++R+VSIL  C+ +L++L  + L           I +++K A++ WKW L  QCLVLT
Sbjct: 61  GALERLVSILHDCYLTLHDLC-IGLHVGFRMGTVDSIVRQRKMAMVAWKWTLAFQCLVLT 119

Query: 121 GTRGPEDIRRKVFHAGIIPILATILDNYLLYHKNYDYMKGEPLSFDFKALDTEQMFH--- 177
           GTRG ++IR++V H+G+IPI+AT+LDNY++YHKN+D+ + EP+ FDFK++ +  +F    
Sbjct: 120 GTRGTQEIRKQVAHSGVIPIIATVLDNYMIYHKNFDFFRDEPIEFDFKSIASGNIFQLQP 179

Query: 178 ------FLRVDKNE------TYEDYLEFVVGKDLFRLSDDDDFINEELLRDEKINP---- 221
                 F ++DK+          +  + +VG+D+  L DD   +N        + P    
Sbjct: 180 EEMESFFQKMDKSHPNLRLCINMERFKILVGEDIPSLLDDPAKVNMH----NCVPPITRL 235

Query: 222 -SDFGDVW-SIFTSKDGENPFMDEDNAYYKSNFPIPREFYLGRIVPKLDDILWSLQLLAF 279
            +DF  +W      K  E+P  D           IPREF+LGR++PKLDDI WS+QLLAF
Sbjct: 236 DTDFQSLWEGTLGLKSDEHPLSD-------VVLSIPREFFLGRVIPKLDDITWSVQLLAF 288

Query: 280 LSKYSYTRRELQSSEFVERLSFRGMINRARSRLSGIYKGNIVGAHYTPSLLKEKSPSPEL 339
           L+K + T+  LQ    VE +SFR ++ RA+ R + +                  +  P L
Sbjct: 289 LTKCTATKPYLQKVSLVESISFRPILERAKERYTLL-----------------SNSLPPL 331

Query: 340 GFPDMYNFEGKNDIHESLSQPTTDKFLEE-LLDVKRKCAEISAKTDGENE----LLNRNP 394
            F D+ +    +D   S S+P     ++  L+++   C E + K   +      +L    
Sbjct: 332 NFTDL-SLVDDDDQRTSSSKPKVPIVIDPFLMEINAICEESNNKKQAKKSVNFSMLGLTD 390

Query: 395 YEQLNIQISTNN-SSDRHVQESQLIDNFNANWNYRDLCKDLDEDTWNHIQKKEPINLFPL 453
           + +L    +T+   + R   E Q+   F+  W+Y  + ++LDE+TWN I  +E +NLF L
Sbjct: 391 FTKLKKADTTDVWRAFRMYDEVQMKKRFSYKWDYDKVSRELDEETWNKIINRETLNLFAL 450

Query: 454 VENFTPGNSNPKDVVYWSSVIMRNSCRKDEEKGVRQCANFACGKWEEYPKQFAKCRRCKS 513
           VE +T    N  ++ YWSSV+MRNSCRK E  GVRQCANF CGKWE++PKQF KCRRCK 
Sbjct: 451 VERYTVKIENDANITYWSSVVMRNSCRKHEATGVRQCANFFCGKWEDHPKQFPKCRRCKR 510

Query: 514 TKYCSRACQLKSWKFHRYWCNETKLPSQGXXXXXXXXXXXXXXXXXXMASGAETISTHSA 573
           TKYCS  CQL+SW +HRYWC++      G                   +S A T  TH+ 
Sbjct: 511 TKYCSCECQLQSWAYHRYWCHDVGSVFTGT------------------SSTANTTGTHTP 552

Query: 574 TAV 576
            AV
Sbjct: 553 NAV 555

>Kwal_26.7647
          Length = 565

 Score =  416 bits (1068), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 243/539 (45%), Positives = 312/539 (57%), Gaps = 47/539 (8%)

Query: 1   MRDSNHRSVTSNKPVIVITSTSYDRRALDVNSDRPLVSSLNHLTYQVCNSVKIRETIAND 60
           MRD NHR V  N+P I ITS  YDRR LD NS+ PL++SLNHLTY   NS K+RET+AND
Sbjct: 1   MRDCNHRCVLLNRPSITITSAVYDRRGLDCNSEIPLINSLNHLTYLTSNSAKVRETVAND 60

Query: 61  GAMDRIVSILRSCHFSLYELLDLPLRHVSNH-KMAQDIWKKKKQALMGWKWLLGLQCLVL 119
           GA+ R+VSIL  C  S  EL   P   V+    + + I +++K A++ WKW L  QCLVL
Sbjct: 61  GALIRLVSILHDCCISASEL---PRMQVTGALTLVEKIERERKLAMIAWKWTLAFQCLVL 117

Query: 120 TGTRGPEDIRRKVFHAGIIPILATILDNYLLYHKNYDYMKGEPLSFDFKALDTEQMFHFL 179
           TGTRG E IR++V  +G+IPILAT+LDNYLL  KNYDY++  PL FDFK     ++ H  
Sbjct: 118 TGTRGTEQIRKQVVSSGVIPILATVLDNYLLLEKNYDYLRNTPLEFDFK-----KLLH-- 170

Query: 180 RVDKNETYEDYLEFVVGKDLFRLSDDDDFINEELLRDEKINPSDFGDVWS--IFTSKDGE 237
             +K+   E   E V  +    L D     +E  +   K   +DF  +W+  +      E
Sbjct: 171 --EKDMACE---ELVKSRFQGGLLDKCREFSEPSIMHLK---TDFCTLWNEKLVPDAGDE 222

Query: 238 NPFMDEDNAYYKSNFPIPREFYLGRIVPKLDDILWSLQLLAFLSKYSYTRRELQSSEFVE 297
           N   D+ +    S   +PR F  G+IVPK DD++WSLQLLAF+SKY++ +  LQ    VE
Sbjct: 223 NQVKDDFDNIVVS---VPRTFAQGKIVPKADDVIWSLQLLAFISKYTHMKPHLQRVHLVE 279

Query: 298 RLSFRGMINRARSRLSGIYKGNIVGAHYTPSLLKEKSPSPELGFPDMYNFEGKNDIHESL 357
            LS R       S LS   K    G   TP  LK  +   +    D      +N++    
Sbjct: 280 SLSLR-------SALSAASKHQERGLDITP--LKISATDVQEADLDEPVEPKENELDH-- 328

Query: 358 SQPTTDKFLEELLDVKRKCAEISAKTDGENELLNRNPYEQLNIQISTNNSSDRHVQESQL 417
               TD +L   LD++  C E+     GE  L   +       +    + S+R  Q    
Sbjct: 329 ----TDPYL---LDIESFCKEL-----GEPRLSFLSKRVNKLSERRMKSVSERIRQMESF 376

Query: 418 IDNFNANWNYRDLCKDLDEDTWNHIQKKEPINLFPLVENFTPGNSNPKDVVYWSSVIMRN 477
            D ++  WNY  + K LD+ TW HI     +NLFPLVE FT    N +D+ YWSSV+MRN
Sbjct: 377 RDEYHRRWNYHAVPKTLDDHTWEHITNIRYLNLFPLVERFTVKKENERDMTYWSSVVMRN 436

Query: 478 SCRKDEEKGVRQCANFACGKWEEYPKQFAKCRRCKSTKYCSRACQLKSWKFHRYWCNET 536
           SCRK+E  GVRQCANFACGKWE+YPK+FAKCRRCK TKYCSR CQL+SW FHRYWC E 
Sbjct: 437 SCRKNETTGVRQCANFACGKWEDYPKRFAKCRRCKRTKYCSRECQLQSWNFHRYWCQEV 495

>Sklu_2430.13 YMR100W, Contig c2430 23178-23793
          Length = 206

 Score =  196 bits (498), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 95/170 (55%), Positives = 125/170 (73%), Gaps = 2/170 (1%)

Query: 1   MRDSNHRSVTSNKPVIVITSTSYDRRALDVNSDRPLVSSLNHLTYQVCNSVKIRETIAND 60
           MR+ NHRSV  N+  I ITST YDRRALD +SD PL++SLNHLTY   NS K+RETIA D
Sbjct: 1   MRECNHRSVLLNRASITITSTIYDRRALDCHSDVPLINSLNHLTYLASNSAKVRETIATD 60

Query: 61  GAMDRIVSILRSCHFSLYELLDLPLRHVSNHKMAQDIWKKKKQALMGWKWLLGLQCLVLT 120
           GA++R+VSIL  C+  L++L  +  R   +  +  ++ KKK+ A++ WKW L  QCLVLT
Sbjct: 61  GALERLVSILHGCYLPLHDLAFIEDRQHDSALL--NVVKKKRLAVVAWKWTLAFQCLVLT 118

Query: 121 GTRGPEDIRRKVFHAGIIPILATILDNYLLYHKNYDYMKGEPLSFDFKAL 170
           GTRG E IR++V  +GIIPILAT+LDNYL+Y++NYDY K + L  DF ++
Sbjct: 119 GTRGTESIRKEVVKSGIIPILATVLDNYLIYNRNYDYFKDKKLDSDFASV 168

>KLLA0B12892g 1124666..1126543 weakly similar to sp|Q03162
           Saccharomyces cerevisiae YMR100w MUB1 involved in
           budding singleton, start by similarity
          Length = 625

 Score =  165 bits (418), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 89/127 (70%)

Query: 410 RHVQESQLIDNFNANWNYRDLCKDLDEDTWNHIQKKEPINLFPLVENFTPGNSNPKDVVY 469
           R  +E  L D F       +  K+L +D W+ I   + +NLF LVE FT   S  + V Y
Sbjct: 409 RLRKEESLHDKFKEYCQQHEFSKELTDDDWDKIFNSDTMNLFALVERFTVKGSLNEIVHY 468

Query: 470 WSSVIMRNSCRKDEEKGVRQCANFACGKWEEYPKQFAKCRRCKSTKYCSRACQLKSWKFH 529
           WSSV+MRNSCRK E  GVRQCANF+CGKWE++PKQF KCRRCK TKYCSR CQLKSW+FH
Sbjct: 469 WSSVVMRNSCRKHEATGVRQCANFSCGKWEDHPKQFPKCRRCKRTKYCSRLCQLKSWEFH 528

Query: 530 RYWCNET 536
           RYWC E+
Sbjct: 529 RYWCQES 535

>Sklu_2284.3 YKR069W, Contig c2284 2234-4012 reverse complement
          Length = 592

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 11/96 (11%)

Query: 371 DVKRKCAEISAKTDGEN---------ELLNRNPYEQLNIQISTNNSSDRHVQE--SQLID 419
           D  +   +I+  T+G+          E+++R P     + I+     DR + E  SQLI 
Sbjct: 139 DPAKSGLQIAVTTNGQGCLLANRIKREVISRLPSNISQVVINMGQLRDRIINEDHSQLIS 198

Query: 420 NFNANWNYRDLCKDLDEDTWNHIQKKEPINLFPLVE 455
            +  N + +DL   +DED W   +  + ++ F L E
Sbjct: 199 TYYLNKDLQDLGYGMDEDVWESHRLNKLVHEFNLTE 234

>Kwal_55.21660
          Length = 597

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 47/97 (48%), Gaps = 11/97 (11%)

Query: 371 DVKRKCAEISAKTDGENELL----NRNPYEQLNIQIS---TNNSS--DRHVQE--SQLID 419
           D KR   +IS  T+G+  LL     R    +L   IS   TN  S  DR + E  S L  
Sbjct: 139 DPKRSGLQISVTTNGQGCLLANRIKREIVSKLPSNISEAVTNMGSLRDRIINEDNSNLFS 198

Query: 420 NFNANWNYRDLCKDLDEDTWNHIQKKEPINLFPLVEN 456
            +  N + +DL   LDED+W+  +  + ++ F + E+
Sbjct: 199 TYYLNKDLQDLGYGLDEDSWDSHRLNKLVHEFAMTES 235

>Scas_588.11
          Length = 835

 Score = 33.1 bits (74), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 223 DFGDVWSIFTSKDGEN--PFMDEDNAYYKSNFPIPREFYLGRIVPKLDDIL 271
           DF  V+SIF  KD  N   F D+ NA + SNF + R+F+L +     + I+
Sbjct: 253 DFNQVFSIF-EKDPNNNCSFPDKPNAIFTSNFLVNRDFFLQQFYDVFNSIV 302

>Scas_669.20
          Length = 1397

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 93/386 (24%), Positives = 139/386 (36%), Gaps = 109/386 (28%)

Query: 141  LATILDNYLL--YHKNYDYMKGEPLSFDFKALDTEQMFHFLRVDKNETYEDYLEFVVGKD 198
            L  IL  ++L    KN     G+ +  D     T++     +V K+ +  D +E   G D
Sbjct: 863  LHMILKPFMLRRVKKNVQSELGDKIEIDVLCDLTQRQAKLYQVLKSTSNYDAIENAAGSD 922

Query: 199  LFRLSDDDDFINE-----------ELLRDEKINP----SDFGDVWSIFTSKDGENPFMDE 243
             F  S D + +N            +L     IN     + FG   SI  S D      ++
Sbjct: 923  EF--SSDQNLVNTVMQFRKVCNHPDLFERADINSPFAFTKFGKTSSILRSSD------ND 974

Query: 244  DNAYYKSNFPIPREFYLGRIVPKLDDILW-----SLQLLAFLSKYSY------------- 285
             + +Y S  PI  EF+L R++   DD++      S+  +A L  Y+              
Sbjct: 975  TDVFYSSKNPI--EFHLPRLI--YDDLILPNFENSVDTMAKLLNYTLSIFNPTTNFELCQ 1030

Query: 286  --TRRELQSSEFVERLSFRGMINRARSRLSGIYKGNIVGAHYTPSLLK------EKSPSP 337
              TR    S+  + +L  + +INRA            + A   P L K      EK+   
Sbjct: 1031 YLTRLTGSSTHSMSKLFHQDIINRAIE----------LSAEPQPLLEKLAIVFAEKNKIK 1080

Query: 338  ELGFPDMYNFEGKNDIHESLSQPTTDKFLEELLDVKRKCAE------------------- 378
            +    D+     K DI  + S+ TT   L+ LL++K    E                   
Sbjct: 1081 DNFHRDLI-LMDKADILINTSKVTTKGILDSLLNIKETVYENEYLNSLHPGYRPNASAVP 1139

Query: 379  ISAKTDGENELLNRNPYEQLNIQISTNNSSDRHVQESQLIDNFNANWNYRDLCKDLDEDT 438
            IS +  G + L N   YE  N  I+      + + E   I  +N                
Sbjct: 1140 ISLEISGCSHLTNEMNYELFNPVIT------QALSEIPPITQYNM--------------- 1178

Query: 439  WNHIQKKEPINLFPLVENF-TPGNSN 463
              HI KK PI  FP  E F  P N N
Sbjct: 1179 --HINKKIPIEEFPKTELFPAPLNKN 1202

>CAGL0H05049g complement(483870..486593) similar to sp|P11325
           Saccharomyces cerevisiae YLR382c NAM2, hypothetical
           start
          Length = 907

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 49/114 (42%), Gaps = 15/114 (13%)

Query: 202 LSDDDDFINEELLR--DEKINPSDFGDV-----WSIFTSKDGEN---PFMDEDNAYYKSN 251
           LS+  DF+N E  R  +     +D  D      W  F   D  N   PF  E     K+N
Sbjct: 506 LSNISDFVNTECPRCHNSAKRETDTMDTFIDSSWYFFRYIDAHNKVLPFSPE-----KAN 560

Query: 252 FPIPREFYLGRIVPKLDDILWSLQLLAFLSKYSYTRRELQSSEFVERLSFRGMI 305
             +P + Y+G +   +  +L+S  +  FLS      R +   E  ++L  +GM+
Sbjct: 561 KSMPVDIYIGGVEHAILHLLYSRFISKFLSSIGMWDRGISHGEPFKKLVTQGMV 614

>CAGL0I00880g 64400..66610 weakly similar to sp|P30620 Saccharomyces
           cerevisiae YMR137c PSO2 DNA repair protein, start by
           similarity
          Length = 736

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 57/143 (39%), Gaps = 17/143 (11%)

Query: 327 PSLLKEKSPSPELGFPDMYNFEGKNDIHESLSQPTTDKFLEELLDVKRKCAEISAKTDGE 386
           PS + +KS  P L     Y+  GK  +   +++    K   +   +KRK   I      +
Sbjct: 500 PSSIDKKSEIPMLYLVGTYSI-GKEKLAIKIAETLNTKIYVQSNSIKRKMVSIYWDQCFD 558

Query: 387 NELLNRNPYEQLNIQISTNNSSDRHVQESQLIDNFNANWNYRDLCKDLDEDTWNHIQKKE 446
           N LL  +P E           S  H+   +++ +FNA  NY    K+L   T N I+   
Sbjct: 559 NSLLTDDPSE-----------SQIHLVSLKVLRDFNAIDNYLKTIKEL---TGNKIKYDN 604

Query: 447 PINLFPLVENFTPGNSNPKDVVY 469
                P    +T GN   KD  Y
Sbjct: 605 VFGFIPT--GWTFGNRYKKDFQY 625

>CAGL0L00539g complement(59774..60445) similar to sp|Q03233
           Saccharomyces cerevisiae YMR184w, hypothetical start
          Length = 223

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 28/48 (58%)

Query: 257 EFYLGRIVPKLDDILWSLQLLAFLSKYSYTRRELQSSEFVERLSFRGM 304
           E+Y G+I   L++ L + ++  FLS++       ++ EF +++  RGM
Sbjct: 153 EYYKGKIDSNLEESLKNDKVRIFLSRFFSELESSKNKEFAQKILLRGM 200

>KLLA0C09570g complement(831137..832621) similar to sp|P09032
           Saccharomyces cerevisiae YOR260w GCD1 translation
           initiation factor eIF2bgamma subunit singleton, start by
           similarity
          Length = 494

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 29/57 (50%)

Query: 399 NIQISTNNSSDRHVQESQLIDNFNANWNYRDLCKDLDEDTWNHIQKKEPINLFPLVE 455
           ++  S  N+S    ++  + D  N N +   L +DL   +W H++ +E I +F L E
Sbjct: 264 SLATSFQNTSFLKGKKKLIKDPINCNKSLGKLFRDLSRRSWQHVKPRETIGIFVLPE 320

>YOR260W (GCD1) [5048] chr15 (813982..815718) Translation initiation
           factor eIF2B (guanine nucleotide exchange factor), 58
           kDa (gamma) subunit [1737 bp, 578 aa]
          Length = 578

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 21/37 (56%)

Query: 417 LIDNFNANWNYRDLCKDLDEDTWNHIQKKEPINLFPL 453
           ++D  N N +   + +DL   +W H + +EPI +F L
Sbjct: 350 ILDPINCNKSLSKVFRDLSRRSWQHSKPREPIGIFIL 386

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,155,421
Number of extensions: 1063270
Number of successful extensions: 3145
Number of sequences better than 10.0: 39
Number of HSP's gapped: 3235
Number of HSP's successfully gapped: 39
Length of query: 612
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 504
Effective length of database: 12,857,365
Effective search space: 6480111960
Effective search space used: 6480111960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)