Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_717.251781789501e-133
CAGL0K08800g1751766161e-82
Sklu_2248.31771776135e-82
KLLA0D14487g1761775762e-76
Kwal_55.208131751785571e-73
YMR009W1791775451e-71
ADR021W1761775328e-70
Kwal_26.895981745700.31
KLLA0C13035g522114670.79
Scas_652.551638661.2
CAGL0F07381g53438651.3
CAGL0F07249g53638651.4
YOR270C (VPH1)84051641.8
KLLA0F12804g58068642.1
Kwal_0.4086266632.4
CAGL0M09999g312448633.2
AAR180C76665614.3
CAGL0H05379g102343614.7
Sklu_1261.180345605.6
CAGL0G05247g94737606.0
Scas_692.2684145598.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_717.25
         (178 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_717.25                                                           370   e-133
CAGL0K08800g 883045..883572 similar to sp|Q03677 Saccharomyces c...   241   1e-82
Sklu_2248.3 YMR009W, Contig c2248 7331-7864                           240   5e-82
KLLA0D14487g 1229115..1229645 similar to sp|Q03677 Saccharomyces...   226   2e-76
Kwal_55.20813                                                         219   1e-73
YMR009W (YMR009W) [3973] chr13 (284101..284640) Member of the ac...   214   1e-71
ADR021W [1762] [Homologous to ScYMR009W - SH] complement(743305....   209   8e-70
Kwal_26.8959                                                           32   0.31 
KLLA0C13035g complement(1106439..1108007) weakly similar to ca|C...    30   0.79 
Scas_652.5                                                             30   1.2  
CAGL0F07381g complement(719330..720934) highly similar to sp|P53...    30   1.3  
CAGL0F07249g 705576..707186 highly similar to sp|P53040 Saccharo...    30   1.4  
YOR270C (VPH1) [5056] chr15 complement(828049..830571) Vacuolar ...    29   1.8  
KLLA0F12804g complement(1180909..1182651) similar to ca|CA0795|I...    29   2.1  
Kwal_0.40                                                              29   2.4  
CAGL0M09999g 987540..996914 similar to sp|P18963 Saccharomyces c...    29   3.2  
AAR180C [368] [Homologous to ScYGL120C (PRP43) - SH] (665711..66...    28   4.3  
CAGL0H05379g complement(517605..>520676) similar to sp|P07261 Sa...    28   4.7  
Sklu_1261.1 YOR270C, Contig c1261 283-2694 reverse complement          28   5.6  
CAGL0G05247g complement(491024..493867) similar to sp|P32571 Sac...    28   6.0  
Scas_692.26                                                            27   8.7  

>Scas_717.25
          Length = 178

 Score =  370 bits (950), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 178/178 (100%), Positives = 178/178 (100%)

Query: 1   MVEAYVHDNDNKIDFREPHNSGVAVSLERLAKLGIVAKYLEKIDDVELLAKERNYKNRDT 60
           MVEAYVHDNDNKIDFREPHNSGVAVSLERLAKLGIVAKYLEKIDDVELLAKERNYKNRDT
Sbjct: 1   MVEAYVHDNDNKIDFREPHNSGVAVSLERLAKLGIVAKYLEKIDDVELLAKERNYKNRDT 60

Query: 61  VKLSKKTFNNDETLLLNQLNIFYQEHLHEDEEIRYCIEGSGYFDIKDTFTNEWIRCKVSP 120
           VKLSKKTFNNDETLLLNQLNIFYQEHLHEDEEIRYCIEGSGYFDIKDTFTNEWIRCKVSP
Sbjct: 61  VKLSKKTFNNDETLLLNQLNIFYQEHLHEDEEIRYCIEGSGYFDIKDTFTNEWIRCKVSP 120

Query: 121 GDLLIVPAGIYHRFTLTTDNFIKALRLFKDEPKWQAHNKSGDTDQTSVRKQYLQSIGN 178
           GDLLIVPAGIYHRFTLTTDNFIKALRLFKDEPKWQAHNKSGDTDQTSVRKQYLQSIGN
Sbjct: 121 GDLLIVPAGIYHRFTLTTDNFIKALRLFKDEPKWQAHNKSGDTDQTSVRKQYLQSIGN 178

>CAGL0K08800g 883045..883572 similar to sp|Q03677 Saccharomyces
           cerevisiae YMR009w, start by similarity
          Length = 175

 Score =  241 bits (616), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 138/176 (78%), Gaps = 1/176 (0%)

Query: 1   MVEAYVHDNDNKIDFREPHNSGVAVSLERLAKLGIVAKYLEKIDDVELLAKERNYKNRDT 60
           MVE YVHD ++ +DFR+PHNSG  V+LE L K+G++ K++    DV++LAKERNYKNRD 
Sbjct: 1   MVEIYVHDENDSVDFRQPHNSGKTVALEDLGKIGVIYKHIADQADVDILAKERNYKNRDI 60

Query: 61  VKLSKKTFNNDETLLLNQLNIFYQEHLHEDEEIRYCIEGSGYFDIKDTFTNEWIRCKVSP 120
           V ++  TF  D+  L  QL IFY+EHLHEDEEIRYCIEGSGYFD+++   + W+RCKV P
Sbjct: 61  VTINVDTFKGDKNALEKQLGIFYKEHLHEDEEIRYCIEGSGYFDVRNGKDDVWVRCKVGP 120

Query: 121 GDLLIVPAGIYHRFTLTTDNFIKALRLFKDEPKWQAHNKSGDTDQTSVRKQYLQSI 176
           GDLLI+PAGIYHRFTLT  N IKALRLFKDEPKWQA+N+  D D   VR +YLQSI
Sbjct: 121 GDLLILPAGIYHRFTLTETNHIKALRLFKDEPKWQAYNRP-DADSLPVRHEYLQSI 175

>Sklu_2248.3 YMR009W, Contig c2248 7331-7864
          Length = 177

 Score =  240 bits (613), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 104/177 (58%), Positives = 142/177 (80%), Gaps = 1/177 (0%)

Query: 1   MVEAYVHDNDNKIDFREPHNSGVAVSLERLAKLGIVAKYLEKIDDVELLAKERNYKNRDT 60
           MV+ Y HDN++ +DFR+PHN+G  +SL+RL K+G+  ++ +   +V+ LA+ERNYKNRD 
Sbjct: 1   MVQVYYHDNNDAVDFRQPHNTGREISLQRLEKIGVFYRHFKTQQEVDELARERNYKNRDI 60

Query: 61  VKLSKKTFNNDETLLLNQLNIFYQEHLHEDEEIRYCIEGSGYFDIKDTFTNEWIRCKVSP 120
           V +SK++F NDE  ++ +L +FY EHLHEDEEIRYC++G+GYFD++D  ++EWIRCKV P
Sbjct: 61  VSISKESFGNDENAMIEKLKVFYSEHLHEDEEIRYCLDGTGYFDVRDAESDEWIRCKVEP 120

Query: 121 GDLLIVPAGIYHRFTLTTDNFIKALRLFKDEPKWQAHNKSGDTDQTSVRKQYLQSIG 177
           GDLLI+PAGIYHRFTLT DN+IKALRLFK+EPKW A+N+  D D    R++YL S+ 
Sbjct: 121 GDLLILPAGIYHRFTLTDDNYIKALRLFKEEPKWLAYNRP-DADSNPTREEYLSSLS 176

>KLLA0D14487g 1229115..1229645 similar to sp|Q03677 Saccharomyces
           cerevisiae YMR009w singleton, start by similarity
          Length = 176

 Score =  226 bits (576), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 143/177 (80%), Gaps = 2/177 (1%)

Query: 1   MVEAYVHDNDNKIDFREPHNSGVAVSLERLAKLGIVAKYLEKIDDVELLAKERNYKNRDT 60
           MV+AY+HDND+ +DFRE H++G  VSLE+L ++G++ +  +  ++V+  A++R+YKNRD 
Sbjct: 1   MVKAYIHDNDSSVDFREDHDTGKPVSLEKLEQIGLIYRKFDTQEEVDQFAQDRDYKNRDI 60

Query: 61  VKLSKKTFNNDETLLLNQLNIFYQEHLHEDEEIRYCIEGSGYFDIKDTFTNEWIRCKVSP 120
           V ++  +F ++ET++ ++LN+FY EHLHEDEEIRYC++G G+FD++D FT EWIRC+V  
Sbjct: 61  VNITVNSFPDEETMI-SKLNVFYAEHLHEDEEIRYCLDGEGFFDVRDPFTEEWIRCRVQK 119

Query: 121 GDLLIVPAGIYHRFTLTTDNFIKALRLFKDEPKWQAHNKSGDTDQTSVRKQYLQSIG 177
           GDLL++PAGIYHRFTLT+DN+IKALRLFK+EPKW A+N+  D D    R++YL  +G
Sbjct: 120 GDLLVLPAGIYHRFTLTSDNYIKALRLFKEEPKWLAYNRP-DADDNRYRQEYLTQVG 175

>Kwal_55.20813
          Length = 175

 Score =  219 bits (557), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 101/178 (56%), Positives = 135/178 (75%), Gaps = 4/178 (2%)

Query: 1   MVEAYVHDNDNKIDFREPHNSGVAVSLERLAKLGIVAKYLEKIDDVELLAKERNYKNRDT 60
           MVEAY HDND+ +DFREPH+SG  +SL++LAK+G+  KY      V+ +A ER+YKNRDT
Sbjct: 1   MVEAYYHDNDDTVDFREPHHSGETLSLDQLAKIGVFYKYCPSQAQVDEVATERDYKNRDT 60

Query: 61  VKLSKKTFNNDETLLLNQLNIFYQEHLHEDEEIRYCIEGSGYFDIKDTFTNEWIRCKVSP 120
           V++S++T  +    LL +L  FY EHLHEDEEIRY I+G G+FD+++   + W+RCK+ P
Sbjct: 61  VQISQETLGD---ALLPKLQTFYAEHLHEDEEIRYIIDGEGFFDVRNEPNDRWVRCKLVP 117

Query: 121 GDLLIVPAGIYHRFTLTTDNFIKALRLFKDEPKWQAHNKSGDTDQTSVRKQYLQSIGN 178
           GDLLI+PAGIYHRFTLT+ N++KALRLFKDEPKW AH +    D   +R++YL S+ N
Sbjct: 118 GDLLILPAGIYHRFTLTSKNYVKALRLFKDEPKWVAHGRPI-ADDLPIRREYLASVQN 174

>YMR009W (YMR009W) [3973] chr13 (284101..284640) Member of the
           acireductone dioxygenase family, has high similarity to
           uncharacterized C. albicans Orf6.5544p [540 bp, 179 aa]
          Length = 179

 Score =  214 bits (545), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 127/177 (71%), Gaps = 2/177 (1%)

Query: 1   MVEAYVHDNDNKIDFREPHNSGVAVSLERLAKLGIVAKYLEKIDDVELLAKERNYKNRDT 60
           MV+ Y+HDN    D+R PHNSG  +SL+ LAKLG++ KY    ++V  +A++R YKNRD 
Sbjct: 1   MVKVYIHDNKVDSDYRAPHNSGTELSLDELAKLGVIYKYCANEEEVNEIARQREYKNRDV 60

Query: 61  VKLSKKTFNNDETLLLNQLNIFYQEHLHEDEEIRYCIEGSGYFDIKDTFTNE-WIRCKVS 119
           V + + +F + E     +L  FYQEHLHEDEEIRYC+EG+GYFD++D  T E WIRC V 
Sbjct: 61  VNICEGSFKS-EAEFNEKLATFYQEHLHEDEEIRYCLEGAGYFDVRDASTPENWIRCLVE 119

Query: 120 PGDLLIVPAGIYHRFTLTTDNFIKALRLFKDEPKWQAHNKSGDTDQTSVRKQYLQSI 176
            GDLLI+P GIYHRFTLTT N IKALRLFKDEPKWQA N+S   D   VRK Y+  I
Sbjct: 120 SGDLLILPPGIYHRFTLTTSNHIKALRLFKDEPKWQAINRSNQADSLPVRKDYIALI 176

>ADR021W [1762] [Homologous to ScYMR009W - SH]
           complement(743305..743835) [531 bp, 176 aa]
          Length = 176

 Score =  209 bits (532), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 129/177 (72%), Gaps = 2/177 (1%)

Query: 1   MVEAYVHDNDNKIDFREPHNSGVAVSLERLAKLGIVAKYLEKIDDVELLAKERNYKNRDT 60
           MVEAYVHDN+  +D R PH+SG +VSLERLA LG+  ++    D+V+ +A  R+Y NRD 
Sbjct: 1   MVEAYVHDNNTHVDCRAPHHSGKSVSLERLASLGVFYRHCRSQDEVDAVACARHYSNRDE 60

Query: 61  VKLSKKTFNNDETLLLNQLNIFYQEHLHEDEEIRYCIEGSGYFDIKDTFTNEWIRCKVSP 120
           V +S  +F +++    ++L +FY EHLHEDEEIRY + G GYFD++D  T +WIR K++ 
Sbjct: 61  VTISPASFPSEDAFR-DKLAVFYTEHLHEDEEIRYALAGEGYFDLRDATTGDWIRVKLTT 119

Query: 121 GDLLIVPAGIYHRFTLTTDNFIKALRLFKDEPKWQAHNKSGDTDQTSVRKQYLQSIG 177
           GDLLIVPAGIYHRFT+T  NFI+A RLFKDEPKWQA N+  + D   V K+YL S+ 
Sbjct: 120 GDLLIVPAGIYHRFTVTESNFIRAQRLFKDEPKWQAFNRP-EGDARPVHKEYLASLA 175

>Kwal_26.8959
          Length = 817

 Score = 31.6 bits (70), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 2/45 (4%)

Query: 121 GDLLIVPAGIYHRFT--LTTDNFIKALRLFKDEPKWQAHNKSGDT 163
           G  +++  G++  +T  L  D F K+L LFK   +W +H K GD+
Sbjct: 451 GRYILLLMGLFSIYTGFLYNDMFSKSLTLFKSGWQWPSHWKEGDS 495

>KLLA0C13035g complement(1106439..1108007) weakly similar to
           ca|CA2949|IPF14506 Candida albicans unknown function,
           hypothetical start
          Length = 522

 Score = 30.4 bits (67), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 45/114 (39%), Gaps = 9/114 (7%)

Query: 31  AKLGIVAKYLE-KIDDVELLAKERNYKNRDTVKLS----KKTFNNDETLLLNQLNIFYQE 85
           A   I  +Y + K+DD  +   +R   N      S    KK  +N  TL     +     
Sbjct: 349 ADGAIETQYAQYKLDDPNIPEPDRKEYNMILTNESENDIKKPTDNQSTLDPPSFSTIPPT 408

Query: 86  HLH----EDEEIRYCIEGSGYFDIKDTFTNEWIRCKVSPGDLLIVPAGIYHRFT 135
            +H    ED+E+R  IE          FT       + PG++L +P G +H  T
Sbjct: 409 VVHLDKIEDQELRNNIEELARKKWPKFFTAHRTTIDLKPGEMLFLPTGWFHEVT 462

>Scas_652.5
          Length = 516

 Score = 30.0 bits (66), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (52%)

Query: 133 RFTLTTDNFIKALRLFKDEPKWQAHNKSGDTDQTSVRK 170
           R  LTTD+  KALR+   EP +  H+ S +    S  K
Sbjct: 61  REILTTDDVAKALRILNVEPLYGYHDGSAENKSVSFAK 98

>CAGL0F07381g complement(719330..720934) highly similar to sp|P53040
           Saccharomyces cerevisiae YGL112c TAF60 TFIID and SAGA
           subunit, hypothetical start
          Length = 534

 Score = 29.6 bits (65), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%)

Query: 133 RFTLTTDNFIKALRLFKDEPKWQAHNKSGDTDQTSVRK 170
           R TLTTD+  KALR+   EP +  H+ S    + S  K
Sbjct: 76  RDTLTTDDVAKALRVLNVEPLYGYHDGSHSNRELSFAK 113

>CAGL0F07249g 705576..707186 highly similar to sp|P53040
           Saccharomyces cerevisiae YGL112c TAF60 TFIID and SAGA
           subunit, hypothetical start
          Length = 536

 Score = 29.6 bits (65), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%)

Query: 133 RFTLTTDNFIKALRLFKDEPKWQAHNKSGDTDQTSVRK 170
           R TLTTD+  KALR+   EP +  H+ S    + S  K
Sbjct: 77  RDTLTTDDVAKALRVLNVEPLYGYHDGSHSNRELSFAK 114

>YOR270C (VPH1) [5056] chr15 complement(828049..830571) Vacuolar
           H(+)-ATPase (V-ATPase) 94 kDa subunit a isoform of
           membrane (V0) sector, essential for vacuolar
           acidification and vacuolar H(+)-ATPase (V-ATPase)
           activity, involved in vacuolar fusion [2523 bp, 840 aa]
          Length = 840

 Score = 29.3 bits (64), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 121 GDLLIVPAGIYHRFT--LTTDNFIKALRLFKDEPKWQAHNKSGDT-DQTSV 168
           G  +I+  G++  +T  L  D F K + +FK   KW  H K G++   TSV
Sbjct: 461 GRYIILLMGVFSMYTGFLYNDIFSKTMTIFKSGWKWPDHWKKGESITATSV 511

>KLLA0F12804g complement(1180909..1182651) similar to
           ca|CA0795|IPF15641 Candida albicans unknown function,
           start by similarity
          Length = 580

 Score = 29.3 bits (64), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 16/68 (23%)

Query: 100 SGYFDIKDTFTNEWIRCKVS---PGDLLIVPAGIYHRFTLTTD------NFI------KA 144
           SGY++       E  RC++    PG+ + VP+G +H     TD      NF+      K 
Sbjct: 383 SGYYNDAVKLAQE-GRCQICVTFPGECIYVPSGWWHSVINLTDSVALTENFVPEPIVPKV 441

Query: 145 LRLFKDEP 152
           +  FK++P
Sbjct: 442 MNFFKNKP 449

>Kwal_0.40
          Length = 862

 Score = 28.9 bits (63), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 27/66 (40%), Gaps = 6/66 (9%)

Query: 95  YCIEGSGYFDIKDTFTNEWIRCKVSPGDLLIVPAGIY--HRFTLTTDNFIKALRLFKDEP 152
           YC    GY  + D  TNE +    +P    IV   +Y  H F        K    +KDE 
Sbjct: 289 YCGLSGGYVKMWDLNTNELVSTFAAPSKCDIVSISVYEDHIFATHQKGITK---FYKDEV 345

Query: 153 -KWQAH 157
            +W AH
Sbjct: 346 YQWDAH 351

>CAGL0M09999g 987540..996914 similar to sp|P18963 Saccharomyces
            cerevisiae YBR140c IRA1 or sp|P19158 Saccharomyces
            cerevisiae YOL081w IRA2, hypothetical start
          Length = 3124

 Score = 28.9 bits (63), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 87   LHEDEEIRYCIEGSGYFDIKDTFTNEWIRCKVSPGDLLIVPAGIYHRF 134
            L  D  I  CI G+ YF++ + F N+W+   V  GD   + A + H F
Sbjct: 2152 LLPDIAIENCI-GAIYFNVSENFMNQWV--NVLRGDNPYLVAQVPHHF 2196

>AAR180C [368] [Homologous to ScYGL120C (PRP43) - SH]
           (665711..668011) [2301 bp, 766 aa]
          Length = 766

 Score = 28.1 bits (61), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 23/65 (35%)

Query: 99  GSGYFDIKDTFTNEWIRCKVSPGDLLIVPAG---------IYHRFTLTTDNFIKALRLFK 149
           G GY  IKD              D+LI P+          IY+ F LTT N+I+ +   +
Sbjct: 667 GKGYITIKDN------------QDVLIHPSTVIGHDAEWVIYNEFVLTTQNYIRTITSVR 714

Query: 150 DEPKW 154
             P+W
Sbjct: 715 --PEW 717

>CAGL0H05379g complement(517605..>520676) similar to sp|P07261
           Saccharomyces cerevisiae YPL075w GCR1, start by
           similarity
          Length = 1023

 Score = 28.1 bits (61), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 21/43 (48%)

Query: 70  NDETLLLNQLNIFYQEHLHEDEEIRYCIEGSGYFDIKDTFTNE 112
           N+E  +    N +    + E+E+IRYC    G  D   T TNE
Sbjct: 895 NNEICIFENFNNWQVRAMTEEEKIRYCKRQHGPADRNVTTTNE 937

>Sklu_1261.1 YOR270C, Contig c1261 283-2694 reverse complement
          Length = 803

 Score = 27.7 bits (60), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 2/45 (4%)

Query: 121 GDLLIVPAGIYHRFT--LTTDNFIKALRLFKDEPKWQAHNKSGDT 163
           G  +++  G++  +T  L  D F K+L LFK   KW  + ++G+T
Sbjct: 440 GRYILLLMGLFSIYTGFLYNDMFSKSLTLFKSGWKWPENFEAGET 484

>CAGL0G05247g complement(491024..493867) similar to sp|P32571
           Saccharomyces cerevisiae YDR069c DOA4 ubiquitin-specific
           protease, hypothetical start
          Length = 947

 Score = 27.7 bits (60), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 20/37 (54%)

Query: 46  VELLAKERNYKNRDTVKLSKKTFNNDETLLLNQLNIF 82
           +E +A   NY  RD VK S  T   DE LLL  L+ F
Sbjct: 245 LEPIAFSENYTYRDLVKRSMITAPKDEILLLGNLSNF 281

>Scas_692.26
          Length = 841

 Score = 27.3 bits (59), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 121 GDLLIVPAGIYHRFT--LTTDNFIKALRLFKDEPKWQAHNKSGDT 163
           G  +++  G+Y  +T  L  D F K++ +FK   +W    K G+T
Sbjct: 465 GRYIVLFMGLYSMYTGFLYNDIFSKSMTIFKSGWEWPEQWKEGET 509

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,647,719
Number of extensions: 300229
Number of successful extensions: 955
Number of sequences better than 10.0: 37
Number of HSP's gapped: 949
Number of HSP's successfully gapped: 37
Length of query: 178
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 83
Effective length of database: 13,307,399
Effective search space: 1104514117
Effective search space used: 1104514117
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 58 (26.9 bits)