Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_716.3250950926430.0
YGR093W50751412641e-170
KLLA0D14927g50750811061e-147
ADR034W40442110171e-135
CAGL0G03069g4865079611e-125
Kwal_23.39913573669131e-120
KLLA0D18172g29972682.8
KLLA0E24552g79366674.6
CAGL0C01463g70570657.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_716.32
         (509 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_716.32                                                          1022   0.0  
YGR093W (YGR093W) [2053] chr7 (670390..671913) Member of the pro...   491   e-170
KLLA0D14927g 1258177..1259700 similar to sp|P53255 Saccharomyces...   430   e-147
ADR034W [1775] [Homologous to ScYGR093W - SH] complement(767110....   396   e-135
CAGL0G03069g 284268..285728 similar to sp|P53255 Saccharomyces c...   374   e-125
Kwal_23.3991                                                          356   e-120
KLLA0D18172g complement(1532328..1533227) some similarities with...    31   2.8  
KLLA0E24552g 2178343..2180724 gi|28565054|gb|AAO32610.1 Kluyvero...    30   4.6  
CAGL0C01463g complement(160384..162501) similar to tr|Q08921 Sac...    30   7.1  

>Scas_716.32
          Length = 509

 Score = 1022 bits (2643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/509 (97%), Positives = 495/509 (97%)

Query: 1   MVQAKVLVIHLKNESAESVINKVKRLNEKSGPFECIFFLGDLLSKLDQVDISTLPPIYCF 60
           MVQAKVLVIHLKNESAESVINKVKRLNEKSGPFECIFFLGDLLSKLDQVDISTLPPIYCF
Sbjct: 1   MVQAKVLVIHLKNESAESVINKVKRLNEKSGPFECIFFLGDLLSKLDQVDISTLPPIYCF 60

Query: 61  TSLPDSPVNGSDEVQANLTRLNGYGVYQMTNKLRIGYIALEEAKCNELKDKILEKFKLVN 120
           TSLPDSPVNGSDEVQANLTRLNGYGVYQMTNKLRIGYIALEEAKCNELKDKILEKFKLVN
Sbjct: 61  TSLPDSPVNGSDEVQANLTRLNGYGVYQMTNKLRIGYIALEEAKCNELKDKILEKFKLVN 120

Query: 121 APIDILITREWSTHIAELKDRLSGSDTIDDVAKLLQPRYHFTYSDNDTFFELNPFLWNEK 180
           APIDILITREWSTHIAELKDRLSGSDTIDDVAKLLQPRYHFTYSDNDTFFELNPFLWNEK
Sbjct: 121 APIDILITREWSTHIAELKDRLSGSDTIDDVAKLLQPRYHFTYSDNDTFFELNPFLWNEK 180

Query: 181 ESVSRFINLATYGSGSKWAYAFNXXXXXXXXXXXXXXSNLPTNLISNPYSTTNIKKRPMD 240
           ESVSRFINLATYGSGSKWAYAFN              SNLPTNLISNPYSTTNIKKRPMD
Sbjct: 181 ESVSRFINLATYGSGSKWAYAFNIKIETDDDIEDEHESNLPTNLISNPYSTTNIKKRPMD 240

Query: 241 LIDTDGQQVTKSSISLKKPRKVLPIDCHFCFTNPNMEDHMIISIDDSAYMTTAKGPLTVP 300
           LIDTDGQQVTKSSISLKKPRKVLPIDCHFCFTNPNMEDHMIISIDDSAYMTTAKGPLTVP
Sbjct: 241 LIDTDGQQVTKSSISLKKPRKVLPIDCHFCFTNPNMEDHMIISIDDSAYMTTAKGPLTVP 300

Query: 301 KGDMNFPGHCLIIPIEHIPKFNNVDGQSPFETPLGKDLLAYERSVVNMNYQKFDMSTIVF 360
           KGDMNFPGHCLIIPIEHIPKFNNVDGQSPFETPLGKDLLAYERSVVNMNYQKFDMSTIVF
Sbjct: 301 KGDMNFPGHCLIIPIEHIPKFNNVDGQSPFETPLGKDLLAYERSVVNMNYQKFDMSTIVF 360

Query: 361 EINSERSIHFHKQVFPIPKYLIMKFNESLDRQLHFNNEKYSRNAKLNFEKFETTSDLRYE 420
           EINSERSIHFHKQVFPIPKYLIMKFNESLDRQLHFNNEKYSRNAKLNFEKFETTSDLRYE
Sbjct: 361 EINSERSIHFHKQVFPIPKYLIMKFNESLDRQLHFNNEKYSRNAKLNFEKFETTSDLRYE 420

Query: 421 AIVKNSNMNYLQFTVYETPITEPAIYVSKFELDDRLDLQFGRRVVAFLLHLPNRLNWDSP 480
           AIVKNSNMNYLQFTVYETPITEPAIYVSKFELDDRLDLQFGRRVVAFLLHLPNRLNWDSP
Sbjct: 421 AIVKNSNMNYLQFTVYETPITEPAIYVSKFELDDRLDLQFGRRVVAFLLHLPNRLNWDSP 480

Query: 481 TCQQTKEQEMIDVEKFQKSYKEYDIAKSK 509
           TCQQTKEQEMIDVEKFQKSYKEYDIAKSK
Sbjct: 481 TCQQTKEQEMIDVEKFQKSYKEYDIAKSK 509

>YGR093W (YGR093W) [2053] chr7 (670390..671913) Member of the
           protein similar to CwfJ N-terminus 1 containing family
           and of the CwfJ N-terminus 2 containing family, has low
           similarity to uncharacterized C. albicans Orf6.6477p
           [1524 bp, 507 aa]
          Length = 507

 Score =  491 bits (1264), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 249/514 (48%), Positives = 335/514 (65%), Gaps = 19/514 (3%)

Query: 1   MVQAKVLVIHLKNESAESVINKVKRLNEKSGPFECIFFLGDLLSKLDQVDISTLPPIYCF 60
           M  AK+LV H+    A+  I K+K++NEKSGPF+ I    +   +  +++   LP +   
Sbjct: 1   MTNAKILVAHISESDADEAIRKIKKVNEKSGPFDLIIIFSNSYDENFELNTDGLPQL-IL 59

Query: 61  TSLPDSPVNGSDEVQANLTRLNGYGVYQMTNKLRIGYIALEEAKCNELKDKILEKFKLVN 120
            S   +  + S ++  N+T L+  G Y++ N + + Y    +      K  IL++F    
Sbjct: 60  LSCDKANNSKSKKINENVTLLHNMGTYKLANGITLSYFIYPDDTLQGEKKSILDEFGKSE 119

Query: 121 APIDILITREWSTHIAELKDRLSGSDTIDDVAKLLQPRYHFTYSDNDTFFELNPFLWNEK 180
             +DIL+T+EW   I+E   RLSGS+ +D++AK LQ RYHF +SD   F+EL PF W E+
Sbjct: 120 DQVDILLTKEWGLSISERCGRLSGSEVVDELAKKLQARYHFAFSDEINFYELEPFQW-ER 178

Query: 181 ESVSRFINLATYGSGSKWAYAFNXXXXXXXXXXXXXXSNLPTNLISNPYST--TNIKKRP 238
           E +SRF+N+  YGSG KWAYAFN                 P NLI+NPY++  TN  KRP
Sbjct: 179 ERLSRFLNIPKYGSGKKWAYAFNMPIGDNELKDEPE----PPNLIANPYNSVVTNSNKRP 234

Query: 239 MDL-----IDTDGQQVT-KSSISLKKPRKVLPIDCHFCFTNPNMEDHMIISIDDSAYMTT 292
           ++       D D Q +  +     KK R +LP  CHFCF+NPN+EDHMIISI    Y+TT
Sbjct: 235 LETETENSFDGDKQVLANREKNENKKIRTILPSSCHFCFSNPNLEDHMIISIGKLVYLTT 294

Query: 293 AKGPLTVPKGDMNFPGHCLIIPIEHIPKFNNVDGQSPFETPLGKDLLAYERSVVNMNYQK 352
           AKGPL+VPKGDM+  GHCLIIPIEHIPK +           L + +LAYE S+V MNY K
Sbjct: 295 AKGPLSVPKGDMDISGHCLIIPIEHIPKLDPSKN-----AELTQSILAYEASLVKMNYIK 349

Query: 353 FDMSTIVFEINSERSIHFHKQVFPIPKYLIMKFNESLDRQLHFNNEKYSRNAKLNFEKFE 412
           FDM TIVFEI SERSIHFHKQV P+PKYL++KF  +LDRQ+HFNNEK++RNAKL F+ ++
Sbjct: 350 FDMCTIVFEIQSERSIHFHKQVIPVPKYLVLKFCSALDRQVHFNNEKFTRNAKLEFQCYD 409

Query: 413 TTSDLRYEAIVKNSNMNYLQFTVYETPITEPAIYVSKFELDDRLDLQFGRRVVAFLLHLP 472
           + S  +Y  ++ N + NYLQFTVYETP  +P IY++ F   + +DLQFGRRV+AFLL+LP
Sbjct: 410 SHSSKQYVDVINNQSNNYLQFTVYETPEADPKIYLATFNASETIDLQFGRRVLAFLLNLP 469

Query: 473 NRLNWDSPTCQQTKEQEMIDVEKFQKSYKEYDIA 506
            R+ W+S TC QTK+QE I+ EKFQK+Y+ YDI+
Sbjct: 470 RRVKWNSSTCLQTKQQETIEAEKFQKAYRTYDIS 503

>KLLA0D14927g 1258177..1259700 similar to sp|P53255 Saccharomyces
           cerevisiae YGR093w singleton, start by similarity
          Length = 507

 Score =  430 bits (1106), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 222/508 (43%), Positives = 315/508 (62%), Gaps = 17/508 (3%)

Query: 5   KVLVIHLKNESAESVINKVKRLNEKSGPFECIFFLGDLLSKLDQV-DISTLPPIYCF--T 61
           K+LV++  +ES   V+     L+ KSGPF C   LGD+    D + +     P Y    +
Sbjct: 5   KILVLNTNDESLLDVLAVANTLHNKSGPFACALILGDVKKCSDALTNFQMELPTYIGNGS 64

Query: 62  SLPDSPVNGSDEVQANLTRLNGYGVYQMTNKLRIGYIALEEAKCNELKDKILEKFKLVN- 120
            L D  ++ S ++  NLT LNG+G  ++ N L+IGY+A      +  + ++L+ F+ ++ 
Sbjct: 65  ELSDGNISHSRDLNENLTVLNGFGFIKLANGLKIGYLAETSKLSDSARAEVLKNFQELSE 124

Query: 121 -APIDILITREWSTHIAELKDRLSGSDTIDDVAKLLQPRYHFTYSDNDTFFELNPFLWNE 179
               DIL++ +WS  I+E ++ + G+  +D VA L++P+YHFT  +   FFEL+PF+W+ 
Sbjct: 125 QTSADILLSYDWSEAISERENLILGNSLVDQVASLMKPKYHFTGKNEKQFFELDPFVWDH 184

Query: 180 -KESVSRFINLATYGSGSKWAYAFNXXXXXXXXXXXXXXSNLPTNLISNPYSTTNIKKRP 238
             E + RFIN+A + SGSKWAYAF                 +P NLI NPY      KR 
Sbjct: 185 TNEHICRFINVAQFKSGSKWAYAFKINLLEGL-------ETIPDNLIDNPYLEKPSGKR- 236

Query: 239 MDLI-DTDGQQVTKSSISLKKPRKVLPIDCHFCFTNPNMEDHMIISIDDSAYMTTAKGPL 297
            DL+ D +    +  S   +KP++VLP +C FC +N  + DHMIISI   +Y+T AKGPL
Sbjct: 237 -DLVPDPETDNSSAVSKKQRKPKQVLPSECRFCLSNTKLNDHMIISISKFSYITIAKGPL 295

Query: 298 TVPKGDMNFPGHCLIIPIEHIPKFNNVDGQSPF-ETPLGKDLLAYERSVVNMNYQKFDMS 356
           T P  DM+F GHCLIIPIEHIPK N    ++   +T L KDL  +E S+  MN++++DMS
Sbjct: 296 TTPGNDMDFSGHCLIIPIEHIPKLNTAKQEAVITDTDLFKDLNKFEESIAEMNFKRYDMS 355

Query: 357 TIVFEINSERSIHFHKQVFPIPKYLIMKFNESLDRQLHFNNEKYSRNAKLNFEKFETTSD 416
           T++FEINS  +IHFHKQ+ P+PKYLI  F  +L+RQ+H NNEK+  NAKL F++FE   D
Sbjct: 356 TLIFEINSSNAIHFHKQLIPVPKYLIGNFISALNRQVHMNNEKFKSNAKLEFKEFEGFDD 415

Query: 417 LRYEAIVKNSNMNYLQFTVYETPITEPAIYVSKFELDDRLDLQFGRRVVAFLLHLPNRLN 476
             Y  +V +   NY QF + ET  ++P +Y+S F+ D+R+DLQFGRRV AFLL  P R  
Sbjct: 416 KEYLGLVNDHETNYFQFIIRETASSKPKVYISVFDKDERIDLQFGRRVAAFLLKQPKRTM 475

Query: 477 WDSPTCQQTKEQEMIDVEKFQKSYKEYD 504
           WDS  C QTK+QE  DV  FQ++YK +D
Sbjct: 476 WDSKVCFQTKQQEEKDVSNFQRAYKNFD 503

>ADR034W [1775] [Homologous to ScYGR093W - SH]
           complement(767110..768324) [1215 bp, 404 aa]
          Length = 404

 Score =  396 bits (1017), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 196/421 (46%), Positives = 274/421 (65%), Gaps = 23/421 (5%)

Query: 93  LRIGYIALEEAKCNELKDKILEKFKLVNAPIDILITREWSTHIAELKDRLSGSDTIDDVA 152
           ++IGY    E       D  LE FK V   +DIL+T+EW   +    + +SG+DT+D + 
Sbjct: 1   MKIGYFTPSERIEPSAVDAELEIFKKVGR-LDILLTKEWPKSVRSKLEEVSGTDTVDQLV 59

Query: 153 KLLQPRYHFTYSDNDTFFELNPFLWNEKE--SVSRFINLATYGSGSKWAYAFNXXXXXXX 210
              +P+YHF  +  D +FEL PF W+      ++RFINLAT+GSG KWAYAFN       
Sbjct: 60  ISSKPQYHFA-TLGDKYFELEPFGWDRSSMPDITRFINLATFGSGEKWAYAFNITVGTDQ 118

Query: 211 XXXXXXXSNLPTNLISNPYSTTNIKKRPMDLIDTDGQQVTKSSISLKKPRKVLPIDCHFC 270
                  +++PTNL +NP+ T +  KR +D         +      KK  KVLP  CHFC
Sbjct: 119 E------ASVPTNLTTNPFITMDRPKRDLD---------SDPLPPPKKRTKVLPAACHFC 163

Query: 271 FTNPNMEDHMIISIDDSAYMTTAKGPLTVPKGDMNFPGHCLIIPIEHIPKFNNVD----G 326
            +NP++EDHM+ISI   +Y+T AKGPL+VP+G+M F GHCLIIPI+H+PKFN+       
Sbjct: 164 LSNPSVEDHMVISIGKHSYLTIAKGPLSVPRGEMTFSGHCLIIPIDHVPKFNSASPDQTT 223

Query: 327 QSPFETPLGKDLLAYERSVVNMNYQKFDMSTIVFEINSERSIHFHKQVFPIPKYLIMKFN 386
            +  ET +GK+++ YE ++VNMNY+KFDMST+VFEINS  S+HFHKQV P+PKYLI  F 
Sbjct: 224 SAIMETEMGKEVMRYESALVNMNYKKFDMSTLVFEINSVNSVHFHKQVVPVPKYLIGSFT 283

Query: 387 ESLDRQLHFNNEKYSRNAKLNFEKFETTSDLRYEAIVKNSNMNYLQFTVYETPITEPAIY 446
            +LDRQLH NNEK+ +NA   F+ FE      + A+V +   NY+QFTVYET    P ++
Sbjct: 284 TALDRQLHINNEKFKKNANFTFQDFEGLQHPDFLALVNDPKTNYMQFTVYETHKASPKVF 343

Query: 447 VSKFELDDRLDLQFGRRVVAFLLHLPNRLNWDSPTCQQTKEQEMIDVEKFQKSYKEYDIA 506
           ++ F+ +D +DLQFGRRV AFLL LP R+ W+S  C Q+KE+E I+V+ FQ+S+++++  
Sbjct: 344 IATFKSEDSIDLQFGRRVAAFLLKLPKRVIWNSKACLQSKEEEEIEVKDFQRSFQDFEFT 403

Query: 507 K 507
           +
Sbjct: 404 E 404

>CAGL0G03069g 284268..285728 similar to sp|P53255 Saccharomyces
           cerevisiae YGR093w, hypothetical start
          Length = 486

 Score =  374 bits (961), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 202/507 (39%), Positives = 298/507 (58%), Gaps = 33/507 (6%)

Query: 5   KVLVIHLKNESAESVINKVKRLNEKSGPFECIFFLGDLLSKLD-QVDISTLPPIYCFTSL 63
           K++V +   E+ +  ++K++  NEK+GPFE +F LG   +K D   D+     I     L
Sbjct: 2   KIMVANPGLENTKEALDKIQIANEKNGPFETVFLLGQ--NKEDTSYDLKDTNTILVTNQL 59

Query: 64  PDSPVNGSDEVQANLTRLNGYGVYQMTNKLRIGYIALEEAKCNELKDKILEKFKLVNAPI 123
                NG    ++++  L+G+G+ ++ + L +GYI L +    + K  ILE FK     I
Sbjct: 60  K----NGRTTRKSSVIILHGFGIMKLASGLVVGYITLSKNSLQQEKKSILEYFKASKEFI 115

Query: 124 DILITREWSTHIA-ELKDRLSGSDTIDDVAKLLQPRYHFTYSDNDTFFELNPFLWNEKES 182
           D+L+T   S  +A  L+ + +G+  ID+V K  +P+YH TY  +  + ++ PF W E  S
Sbjct: 116 DVLVTNIGSKAVASHLQYKANGNSIIDEVMKHCKPQYHLTYDGDRGYHDMKPFCWGETSS 175

Query: 183 ---VSRFINLATYG--SGSKWAYAFNXXXXXXXXXXXXXXSNLPTNLISNPYSTTNIKKR 237
              ++R+ NL +Y   + SKW  AF+              + L TN    PY      KR
Sbjct: 176 DSQITRYYNLPSYSPITKSKWIVAFSIEPGKDFNEINDYKNELGTN----PYLLKPALKR 231

Query: 238 PMDLIDTDGQQVTKSSISLKKPRKVLPIDCHFCFTNPNMEDHMIISIDDSAYMTTAKGPL 297
               I+ +            K  K+    CHFCF+NPN+ED MI++I   +Y+T AKGPL
Sbjct: 232 DRSGIEQNAHT---------KKTKIDSTTCHFCFSNPNVEDQMIVAIAKHSYLTLAKGPL 282

Query: 298 TVPKGDMNFPGHCLIIPIEHIPKFNNVDGQSPFETPLGKDLLAYERSVVNMNYQKFDMST 357
           TVPKGDM+F GH LI PI H+ K +        +  L K++  +E  V  MNY+ FD ST
Sbjct: 283 TVPKGDMSFSGHALITPINHVAKID-----KSLDNELSKEIELFESRVAKMNYKLFDCST 337

Query: 358 IVFEINSERSIHFHKQVFPIPKYLIMKFNESLDRQLHFNNEKYSRNAKLNFEKFETTSDL 417
           +VFEI S+++IHFHKQV P+PKYLI KF  +LDRQ+H N+E+   N KL FEKF+   + 
Sbjct: 338 VVFEIQSDKAIHFHKQVIPVPKYLITKFERALDRQVHINSER--GNCKLEFEKFDGLDNE 395

Query: 418 RYEAIVKNSNMNYLQFTVYETPITEPAIYVSKFELDDRLDLQFGRRVVAFLLHLPNRLNW 477
            Y  IV   + NYLQFT+YET  ++  IY+S F++ +RLDLQ+GRR +AF+L+LP R+ W
Sbjct: 396 EYRKIVGRKDTNYLQFTIYETDTSKATIYISSFDITERLDLQYGRRTLAFVLNLPKRVQW 455

Query: 478 DSPTCQQTKEQEMIDVEKFQKSYKEYD 504
           +SP CQQ+KEQE+ + + +QKS+K +D
Sbjct: 456 NSPICQQSKEQELKEAQLYQKSFKNFD 482

>Kwal_23.3991
          Length = 357

 Score =  356 bits (913), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 173/366 (47%), Positives = 237/366 (64%), Gaps = 18/366 (4%)

Query: 143 SGSDTIDDVAKLLQPRYHFTYSDNDTFFELNPFLWNEKESVSRFINLATYGSGSKWAYAF 202
           S S  +D V     P+YHF+ + NDTF E+ PF W      +R +NLA + SG+KWAYAF
Sbjct: 6   SSSPIVDFVLTNTHPKYHFSATGNDTFQEIAPFKWASTNDTTRCLNLAQFDSGAKWAYAF 65

Query: 203 NXXXXXXXXXXXXXXSNLPTNLISNPYSTTNIKKRPMDLIDTDGQQVTKSSISLKKPRKV 262
                           ++P  L  NPY      KR  +  + D  +++K      KP++V
Sbjct: 66  -------TVATGVNNQDIPQTLGKNPYEVEITNKRTHESENADNSRISK------KPKQV 112

Query: 263 LPIDCHFCFTNPNMEDHMIISIDDSAYMTTAKGPLTVPKGDMNFPGHCLIIPIEHIPKF- 321
           LP +C FCF+N ++EDH+IISI + AY+TTAKGPLT+P  +MNFPGHCL+IPI+HIPK  
Sbjct: 113 LPEECRFCFSNSSIEDHLIISIGEHAYLTTAKGPLTLPTSNMNFPGHCLVIPIKHIPKMK 172

Query: 322 --NNVDGQSPFETPLGKDLLAYERSVVNMNYQKFDMSTIVFEINSERSIHFHKQVFPIPK 379
             +N      ++ P  ++   YE ++  MN+ KF+M T+ FEINSE SIH+HKQ+ P+PK
Sbjct: 173 ARHNSSADLSYD-PFWRESQKYEEAIAKMNFTKFEMGTVAFEINSENSIHYHKQIIPVPK 231

Query: 380 YLIMKFNESLDRQLHFNNEKYSRNAKLNFEKFETTSDLRYEAIVKNSNMNYLQFTVYET- 438
           YLI KF  +L+RQ+HFNN KY+ NA+L F++F   +D  Y +++ +   NYLQF+VYE  
Sbjct: 232 YLINKFKSALERQVHFNNTKYTNNAQLEFQEFNGPNDEGYRSLINDYEQNYLQFSVYEGI 291

Query: 439 PITEPAIYVSKFELDDRLDLQFGRRVVAFLLHLPNRLNWDSPTCQQTKEQEMIDVEKFQK 498
               P  YV+ F+ D+R+DLQFGRRVVAF+L LP R  WDSP C+QT EQE  DV +FQK
Sbjct: 292 DGAPPKTYVATFKPDERIDLQFGRRVVAFVLRLPKRAKWDSPACRQTLEQEKNDVREFQK 351

Query: 499 SYKEYD 504
            +KEY+
Sbjct: 352 HFKEYE 357

>KLLA0D18172g complement(1532328..1533227) some similarities with
           sp|Q06244 Saccharomyces cerevisiae YLR165c, hypothetical
           start
          Length = 299

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 327 QSPFETPLGKDLLAYERSVVNMNYQKFDMSTIVFEINSERSIHFHKQVFPIPKYLIMKFN 386
           Q   ++P+  DL    + V + ++Q    S     I ++   + H+Q+ P+P    M + 
Sbjct: 195 QQVLDSPIYNDLKYGGKKVFDSDFQIALHSAY---IRTKIGFNIHEQIIPVPDGFRMIWG 251

Query: 387 ESLDRQLHFNNE 398
           ES+D+  +FN +
Sbjct: 252 ESVDQNGNFNED 263

>KLLA0E24552g 2178343..2180724 gi|28565054|gb|AAO32610.1
           Kluyveromyces lactis SMY2, start by similarity
          Length = 793

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 7/66 (10%)

Query: 389 LDRQLHFNNEKYSRNAKLNFEKFETTSDLRYEAIV--KNSNMNYLQFTVYETPITEPAIY 446
           + + LHF+N  Y+ N   NF+    + DL +  I+  KN + +Y Q T    P ++    
Sbjct: 287 ISKGLHFDNNTYA-NIDRNFQ----SPDLSHSQILQLKNEDGSYYQNTTVSVPFSKHVQA 341

Query: 447 VSKFEL 452
           V  FEL
Sbjct: 342 VDSFEL 347

>CAGL0C01463g complement(160384..162501) similar to tr|Q08921
           Saccharomyces cerevisiae YPL180w, start by similarity
          Length = 705

 Score = 29.6 bits (65), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 4/70 (5%)

Query: 291 TTAKGPLTVPKGDMNFPGHCLIIPIEHIPKFNNVDGQSPFETPLGKDLLAYERSVVNMNY 350
           TT KGP ++ K D +      I       K  N+DG S  +  +   LL  E S++++N 
Sbjct: 475 TTEKGPTSLLKTDRDSNSTTKINNFSQFLKSENIDGNSRTQRKM---LLQRESSILDLNS 531

Query: 351 QKFDMSTIVF 360
           Q  D +  +F
Sbjct: 532 Q-TDSAEAIF 540

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,523,506
Number of extensions: 807344
Number of successful extensions: 2175
Number of sequences better than 10.0: 16
Number of HSP's gapped: 2198
Number of HSP's successfully gapped: 16
Length of query: 509
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 403
Effective length of database: 12,926,601
Effective search space: 5209420203
Effective search space used: 5209420203
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)