Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_716.31*1019101951090.0
KLLA0D14971g109198132390.0
Scas_705.21106198432030.0
YGR094W (VAS1)110498431960.0
CAGL0G03091g110598431960.0
AAR034W109898631780.0
Sklu_1989.2110498431680.0
Kwal_23.3972110098031210.0
Scas_97.1*2612467902e-97
YBL076C (ILS1)10728503673e-35
CAGL0G03311g10728393611e-34
KLLA0E20625g10739043574e-34
Scas_599.1310718563476e-33
Kwal_27.1081110999303211e-29
CAGL0L12606g9829163102e-28
YPL040C (ISM1)10028712904e-26
KLLA0D11858g9908462842e-25
Scas_568.310018262833e-25
AGL247C9888762823e-25
Kwal_27.118279858242386e-20
KLLA0E05269g8754122323e-19
AER043C8738332233e-18
CAGL0H05049g9078232225e-18
YLR382C (NAM2)8944651983e-15
AER394W10723901966e-15
Kwal_26.93748845461869e-14
Scas_719.59391571715e-12
AAL088W11042801000.001
Scas_650.7111951880.034
KLLA0D06105g109551860.053
CAGL0J03652g109351860.055
Sklu_2298.2109651850.076
YPL160W (CDC60)109051840.086
Kwal_33.1531558323820.16
AAL133W56771790.35
YGR171C (MSM1)57549790.37
KLLA0F14971g56819741.4
Sklu_2399.657423741.5
YKR020W (VPS51)16444701.7
CAGL0I08723g58451722.5
Scas_620.757649712.7
Sklu_2208.435698703.6
Sklu_2194.559796695.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_716.31*
         (1019 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_716.31*                                                         1972   0.0  
KLLA0D14971g 1263323..1266598 highly similar to sp|P07806 Saccha...  1252   0.0  
Scas_705.21                                                          1238   0.0  
YGR094W (VAS1) [2054] chr7 (672188..675502) Valyl-tRNA synthetas...  1235   0.0  
CAGL0G03091g 286259..289576 highly similar to sp|P07806 Saccharo...  1235   0.0  
AAR034W [220] [Homologous to ScYGR094W (VAS1) - SH] complement(4...  1228   0.0  
Sklu_1989.2 YGR094W, Contig c1989 1283-4597 reverse complement       1224   0.0  
Kwal_23.3972                                                         1206   0.0  
Scas_97.1*                                                            308   2e-97
YBL076C (ILS1) [123] chr2 complement(81041..84259) Isoleucyl-tRN...   145   3e-35
CAGL0G03311g 315470..318688 highly similar to sp|P09436 Saccharo...   143   1e-34
KLLA0E20625g 1825036..1828257 highly similar to sp|P09436 Saccha...   142   4e-34
Scas_599.13                                                           138   6e-33
Kwal_27.10811                                                         128   1e-29
CAGL0L12606g 1353211..1356159 similar to sp|P48526 Saccharomyces...   124   2e-28
YPL040C (ISM1) [5399] chr16 complement(475988..478996) Isoleucyl...   116   4e-26
KLLA0D11858g complement(1010259..1013231) similar to sp|P48526 S...   114   2e-25
Scas_568.3                                                            113   3e-25
AGL247C [4065] [Homologous to ScYPL040C (ISM1) - SH] (237045..24...   113   3e-25
Kwal_27.11827                                                          96   6e-20
KLLA0E05269g 476546..479173 similar to sp|P11325 Saccharomyces c...    94   3e-19
AER043C [2548] [Homologous to ScYLR382C (NAM2) - SH] (711416..71...    91   3e-18
CAGL0H05049g complement(483870..486593) similar to sp|P11325 Sac...    90   5e-18
YLR382C (NAM2) [3761] chr12 complement(882067..884751) Leucyl-tR...    81   3e-15
AER394W [2894] [Homologous to ScYBL076C (ILS1) - SH] complement(...    80   6e-15
Kwal_26.9374                                                           76   9e-14
Scas_719.5                                                             70   5e-12
AAL088W [99] [Homologous to ScYPL160W (CDC60) - SH] complement(1...    43   0.001
Scas_650.7                                                             39   0.034
KLLA0D06105g complement(522480..525767) highly similar to sp|P26...    38   0.053
CAGL0J03652g 346614..349895 highly similar to sp|P26637 Saccharo...    38   0.055
Sklu_2298.2 YPL160W, Contig c2298 4548-7838                            37   0.076
YPL160W (CDC60) [5287] chr16 (246989..250261) Leucyl-tRNA synthe...    37   0.086
Kwal_33.15315                                                          36   0.16 
AAL133W [54] [Homologous to ScYGR171C (MSM1) - SH] complement(11...    35   0.35 
YGR171C (MSM1) [2124] chr7 complement(840827..842554) Methionyl-...    35   0.37 
KLLA0F14971g complement(1386169..1387875) similar to sp|P22438 S...    33   1.4  
Sklu_2399.6 YGR171C, Contig c2399 15064-16788                          33   1.5  
YKR020W (VPS51) [3275] chr11 (477981..478475) Class B vacuolar s...    32   1.7  
CAGL0I08723g 849045..850799 similar to sp|P22438 Saccharomyces c...    32   2.5  
Scas_620.7                                                             32   2.7  
Sklu_2208.4 YDR322W, Contig c2208 7462-8532                            32   3.6  
Sklu_2194.5 YOR308C, Contig c2194 9459-11252 reverse complement        31   5.4  

>Scas_716.31*
          Length = 1019

 Score = 1972 bits (5109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 955/1019 (93%), Positives = 955/1019 (93%)

Query: 1    MLSIQLRHMGLATRSPRGSLISAXXXXXXXXXXXXXSHPIVKKVLPPLNSIELKAYDPEI 60
            MLSIQLRHMGLATRSPRGSLISA             SHPIVKKVLPPLNSIELKAYDPEI
Sbjct: 1    MLSIQLRHMGLATRSPRGSLISALTITRPTRRLLTTSHPIVKKVLPPLNSIELKAYDPEI 60

Query: 61   CEKNWYWWDQIGAFKPEFTKDGKIKAEGLFCIPAPPPNVTGALHLGHALTIAIQDSLIRY 120
            CEKNWYWWDQIGAFKPEFTKDGKIKAEGLFCIPAPPPNVTGALHLGHALTIAIQDSLIRY
Sbjct: 61   CEKNWYWWDQIGAFKPEFTKDGKIKAEGLFCIPAPPPNVTGALHLGHALTIAIQDSLIRY 120

Query: 121  YRMKGKTVLFLPGFDHAGIATQSVVEKQLWKQEKKTRYDYGRDGFIKKAWEWKEKYHKRI 180
            YRMKGKTVLFLPGFDHAGIATQSVVEKQLWKQEKKTRYDYGRDGFIKKAWEWKEKYHKRI
Sbjct: 121  YRMKGKTVLFLPGFDHAGIATQSVVEKQLWKQEKKTRYDYGRDGFIKKAWEWKEKYHKRI 180

Query: 181  KNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRLHDAGIIYRASRLVNWSVKLKTTISN 240
            KNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRLHDAGIIYRASRLVNWSVKLKTTISN
Sbjct: 181  KNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRLHDAGIIYRASRLVNWSVKLKTTISN 240

Query: 241  LEVDNKIINGRTLLTVPDYKDKIEFGVLIYIAYPVIDSNTNERIIVATTRPETLFGDVAI 300
            LEVDNKIINGRTLLTVPDYKDKIEFGVLIYIAYPVIDSNTNERIIVATTRPETLFGDVAI
Sbjct: 241  LEVDNKIINGRTLLTVPDYKDKIEFGVLIYIAYPVIDSNTNERIIVATTRPETLFGDVAI 300

Query: 301  AIHPEDSRYKHLHGKFVQHXXXXXXXXXXXDATAVDMTFGTGAVKITPAHDQNDYNVGKR 360
            AIHPEDSRYKHLHGKFVQH           DATAVDMTFGTGAVKITPAHDQNDYNVGKR
Sbjct: 301  AIHPEDSRYKHLHGKFVQHPLIPKKIPIILDATAVDMTFGTGAVKITPAHDQNDYNVGKR 360

Query: 361  HSLQFVNIFTDDGLLNENCGSSWEGLKRFDARQLVIDELKRKGFFMKQEDNPMIIPLCSR 420
            HSLQFVNIFTDDGLLNENCGSSWEGLKRFDARQLVIDELKRKGFFMKQEDNPMIIPLCSR
Sbjct: 361  HSLQFVNIFTDDGLLNENCGSSWEGLKRFDARQLVIDELKRKGFFMKQEDNPMIIPLCSR 420

Query: 421  SGDVIEPLLKHNGGSHKINGQDSDRYCGKREIRFSSSNTKNDYFRWLENIQDWCISRQLW 480
            SGDVIEPLLKHNGGSHKINGQDSDRYCGKREIRFSSSNTKNDYFRWLENIQDWCISRQLW
Sbjct: 421  SGDVIEPLLKHNGGSHKINGQDSDRYCGKREIRFSSSNTKNDYFRWLENIQDWCISRQLW 480

Query: 481  WGHRCPVYFINVEGSEDSAAINRNDGKYWVAGRNLEEAVHKAAKKFPNKKFSLEQDQDVL 540
            WGHRCPVYFINVEGSEDSAAINRNDGKYWVAGRNLEEAVHKAAKKFPNKKFSLEQDQDVL
Sbjct: 481  WGHRCPVYFINVEGSEDSAAINRNDGKYWVAGRNLEEAVHKAAKKFPNKKFSLEQDQDVL 540

Query: 541  DTWFSSALWPFSTLGWPNKTNDMNLFYPFSMLETGWDILFFWVTRMIMLGVKLTGSIPFK 600
            DTWFSSALWPFSTLGWPNKTNDMNLFYPFSMLETGWDILFFWVTRMIMLGVKLTGSIPFK
Sbjct: 541  DTWFSSALWPFSTLGWPNKTNDMNLFYPFSMLETGWDILFFWVTRMIMLGVKLTGSIPFK 600

Query: 601  EVYCHSLVRDFEGRKMSKSLGNVIDPLDIINGCTLKELHEKLQQGNLDPXXXXXXXXXXX 660
            EVYCHSLVRDFEGRKMSKSLGNVIDPLDIINGCTLKELHEKLQQGNLDP           
Sbjct: 601  EVYCHSLVRDFEGRKMSKSLGNVIDPLDIINGCTLKELHEKLQQGNLDPKKIDKMKIEQK 660

Query: 661  XXYPRGIPQCGSDALRFALCAYTTGGRDINLDISRVEGYRKFCNKIYQATKFSIQRLGDD 720
              YPRGIPQCGSDALRFALCAYTTGGRDINLDISRVEGYRKFCNKIYQATKFSIQRLGDD
Sbjct: 661  KMYPRGIPQCGSDALRFALCAYTTGGRDINLDISRVEGYRKFCNKIYQATKFSIQRLGDD 720

Query: 721  YQPPSSTHTPASKSLVEKWILYQMNNTIAIVNDSFEKRDFLTCTSKIYELWYMICDVYIE 780
            YQPPSSTHTPASKSLVEKWILYQMNNTIAIVNDSFEKRDFLTCTSKIYELWYMICDVYIE
Sbjct: 721  YQPPSSTHTPASKSLVEKWILYQMNNTIAIVNDSFEKRDFLTCTSKIYELWYMICDVYIE 780

Query: 781  NFKWLANDTIMEKAAKDTLHTLIENGLKMIHPFMPYLSEELWQRLPDGIGKDESSSIMKT 840
            NFKWLANDTIMEKAAKDTLHTLIENGLKMIHPFMPYLSEELWQRLPDGIGKDESSSIMKT
Sbjct: 781  NFKWLANDTIMEKAAKDTLHTLIENGLKMIHPFMPYLSEELWQRLPDGIGKDESSSIMKT 840

Query: 841  LYPTPSEDFNYGKEAKQYDEILKIIKSMRSLLSEYNITANARXXXXXXXXXXXXXVRAEK 900
            LYPTPSEDFNYGKEAKQYDEILKIIKSMRSLLSEYNITANAR             VRAEK
Sbjct: 841  LYPTPSEDFNYGKEAKQYDEILKIIKSMRSLLSEYNITANARFFFEILDDELFDIVRAEK 900

Query: 901  DAILSVMKGVENISFLAVAPDRQPIKNDCVSCSISSQVNVYLLVKGQYKDIXXXXXXXXX 960
            DAILSVMKGVENISFLAVAPDRQPIKNDCVSCSISSQVNVYLLVKGQYKDI         
Sbjct: 901  DAILSVMKGVENISFLAVAPDRQPIKNDCVSCSISSQVNVYLLVKGQYKDISKELSKQLK 960

Query: 961  XXXXXNNIYAATQRMLTNKDFIKKASEEIREMNEKKLINIHNKILGMQNTVNNLKRFQE 1019
                 NNIYAATQRMLTNKDFIKKASEEIREMNEKKLINIHNKILGMQNTVNNLKRFQE
Sbjct: 961  QLEKLNNIYAATQRMLTNKDFIKKASEEIREMNEKKLINIHNKILGMQNTVNNLKRFQE 1019

>KLLA0D14971g 1263323..1266598 highly similar to sp|P07806
            Saccharomyces cerevisiae YGR094w VAS1 valyl-tRNA
            synthetase, start by similarity
          Length = 1091

 Score = 1252 bits (3239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/981 (60%), Positives = 750/981 (76%), Gaps = 15/981 (1%)

Query: 42   KKVLPPLNSIELKAYDPEICEKNWY-WWDQIGAFKPEFTKDGKIKAEGLFCIPAPPPNVT 100
            KK+L  L+   LKAY+P   E +WY WW++ G F+PEFTKDGKIK EG+F IPAPPPNVT
Sbjct: 121  KKILVSLDDPALKAYNPANVESSWYEWWNKSGFFEPEFTKDGKIKPEGVFTIPAPPPNVT 180

Query: 101  GALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVEKQLWKQEKKTRYDY 160
            G+LH+GHALTIAIQDSL RYYRMKGKTVLFLPGFDHAGIATQSVVEKQ+W  EKKTR+DY
Sbjct: 181  GSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEKQIWASEKKTRHDY 240

Query: 161  GRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRLHDAGI 220
            GR+ F+ K WEWKE+YHK+IKNQ+K+LGASYDWSREAFTLDPKLS AV EAFV+LH+ GI
Sbjct: 241  GREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSREAFTLDPKLSKAVVEAFVKLHEEGI 300

Query: 221  IYRASRLVNWSVKLKTTISNLEVDNKIINGRTLLTVPDYKDKIEFGVLIYIAYPVIDSNT 280
            IYRA+RLVNWSVKL T ISNLEV+NK I G+TLL+VP Y +K+EFGVL   +YPV+ S+ 
Sbjct: 301  IYRAARLVNWSVKLNTAISNLEVENKDIKGKTLLSVPGYDEKVEFGVLTSFSYPVVGSD- 359

Query: 281  NERIIVATTRPETLFGDVAIAIHPEDSRYKHLHGKFVQHXXXXXXXXXXXDATAVDMTFG 340
             E++IVATTRPET+FGD A+AIHP+D RYKHLHG FVQH           DA AVDM FG
Sbjct: 360  -EKLIVATTRPETMFGDTAVAIHPDDERYKHLHGHFVQHPFLNRKMPIVCDAEAVDMEFG 418

Query: 341  TGAVKITPAHDQNDYNVGKRHSLQFVNIFTDDGLLNENCGSSWEGLKRFDARQLVIDELK 400
            TGAVKITPAHDQNDYN G RH+L+ +N FTDDGLLNENCG  WEG +RFDAR+LVI++LK
Sbjct: 419  TGAVKITPAHDQNDYNTGLRHNLEVINTFTDDGLLNENCGPEWEGTRRFDARKLVIEKLK 478

Query: 401  RKGFFMKQEDNPMIIPLCSRSGDVIEPLLKHNG-GSHKINGQDSDRYCGKREIRFSSSNT 459
             KG F+ Q+DN M IP CSRSGD+IEPLLK     S K   +++ +     EI  +  ++
Sbjct: 479  EKGLFVGQKDNEMTIPTCSRSGDIIEPLLKPQWWVSQKQMAEEAIKVVRNGEITITPKSS 538

Query: 460  KNDYFRWLENIQDWCISRQLWWGHRCPVYFINVEGSEDSAAINRNDGKYWVAGRNLEEAV 519
            +++YF WLENIQDWCISRQLWWGHRCPVYF+N+EG E+    +RND  +WV+GRNLEEA 
Sbjct: 539  ESEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGEEN----DRNDNSFWVSGRNLEEAE 594

Query: 520  HKAAKKFPNKKFSLEQDQDVLDTWFSSALWPFSTLGWPNKTNDMNLFYPFSMLETGWDIL 579
             KAA KF +KK++LEQD+DVLDTWFSS L+PFSTLGWP+KT DM+ FYP SMLETGWDIL
Sbjct: 595  AKAATKFADKKYTLEQDEDVLDTWFSSGLYPFSTLGWPDKTPDMSQFYPASMLETGWDIL 654

Query: 580  FFWVTRMIMLGVKLTGSIPFKEVYCHSLVRDFEGRKMSKSLGNVIDPLDIINGCTLKELH 639
            FFWV+RMI+LG+KLTGSIPFKEV+CHSLVRD +GRKMSKSLGNV+DPLD+I+G  L++LH
Sbjct: 655  FFWVSRMILLGLKLTGSIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVISGIKLEDLH 714

Query: 640  EKLQQGNLDPXXXXXXXXXXXXXYPRGIPQCGSDALRFALCAYTTGGRDINLDISRVEGY 699
             KL QGNLDP             YP GIP+CG+DALRFALCAYTTGGRDINLDI RVEGY
Sbjct: 715  AKLLQGNLDPREVEKAKNGQKESYPHGIPECGTDALRFALCAYTTGGRDINLDILRVEGY 774

Query: 700  RKFCNKIYQATKFSIQRLGDDYQPPSSTHTPASKSLVEKWILYQMNNTIAIVNDSFEKRD 759
            RKFCNKIYQATKF++ RLGDDY+PP+S     ++SLVEKWIL+++  T   VN++FEKRD
Sbjct: 775  RKFCNKIYQATKFALLRLGDDYKPPASEALSGNESLVEKWILHELTETAKNVNEAFEKRD 834

Query: 760  FLTCTSKIYELWYMICDVYIENFKWLAND--TIMEKAAKDTLHTLIENGLKMIHPFMPYL 817
            FL  TS IYE WY++CDVYIEN K+L  +   + +K+AKDTL+ LI+N LKMIHPFMP++
Sbjct: 835  FLNSTSAIYEFWYLVCDVYIENSKYLIQEGTEVQQKSAKDTLYILIDNALKMIHPFMPFI 894

Query: 818  SEELWQRLPDGIGKDESSSIMKTLYPTPSEDFNYGKEAKQYDEILKIIKSMRSLLSEYNI 877
            SEE+WQ LP     + S +I+K+ YPT  E+F+    AK+Y+ IL + K  RSLL++YNI
Sbjct: 895  SEEMWQHLPR-YASETSPTIVKSSYPTFKEEFHNPSAAKEYELILNVTKDARSLLAQYNI 953

Query: 878  TANARXXXXXXXXXXXXXVRAEKDAILSVMKGVENISFLAVAPDRQPIKNDCVSCSISSQ 937
              N +             V+++KD+I+S++K ++ +S +  A D   I   CV  S++ +
Sbjct: 954  LKNGKVFVESANESYYSTVQSQKDSIVSLIKAIDEVSVVKSAAD---IPQGCVLQSVNPE 1010

Query: 938  VNVYLLVKGQYKDIXXXXXXXXXXXXXXNNIYAATQRMLTNKDFIKKASEEIREMNEKKL 997
            VNV++LVKG + DI                  +A  +++ + D+ +KA++++++ N+++ 
Sbjct: 1011 VNVHVLVKG-HVDIDAEISKVQKKLDKTLKSKSAIDKIVNSSDYEQKANDQVKQFNKERS 1069

Query: 998  INIHNKILGMQNTVNNLKRFQ 1018
             +   +I  ++ T+ NL+  +
Sbjct: 1070 EHAAAEIETLEATIANLEALK 1090

>Scas_705.21
          Length = 1061

 Score = 1238 bits (3203), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/984 (60%), Positives = 734/984 (74%), Gaps = 13/984 (1%)

Query: 39   PIVKKVLPPLNSIELKAYDPEICEKNWY-WWDQIGAFKPEFTKDGKIKAEGLFCIPAPPP 97
            P  KKVL  L+   LK+Y+P   E +WY WW + G F+PEFT+DG+IK EGLFCIP PPP
Sbjct: 86   PGEKKVLVSLDDPSLKSYNPANVESSWYDWWVKSGFFEPEFTEDGEIKPEGLFCIPCPPP 145

Query: 98   NVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVEKQLWKQEKKTR 157
            NVTGALH+GHALTI+IQDSLIRY RMKGKTVLFLPGFDHAGIATQSVVEKQ+W +EKKTR
Sbjct: 146  NVTGALHIGHALTISIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQMWAKEKKTR 205

Query: 158  YDYGRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRLHD 217
            +DYGR  F+ K WEWK++YH RIKNQ+K LGASYDW+REAFTLDPKL+ AV EAFVRLHD
Sbjct: 206  HDYGRTEFVNKVWEWKDEYHNRIKNQIKNLGASYDWTREAFTLDPKLTNAVVEAFVRLHD 265

Query: 218  AGIIYRASRLVNWSVKLKTTISNLEVDNKIINGRTLLTVPDYKDKIEFGVLIYIAYPVID 277
             G IYRASRLVNWSVKL T ISNLEV+NK + GRTLL+VP+Y +K+EFGVL   AYPV D
Sbjct: 266  DGTIYRASRLVNWSVKLNTAISNLEVENKDVKGRTLLSVPNYDEKVEFGVLTSFAYPVAD 325

Query: 278  SNTNERIIVATTRPETLFGDVAIAIHPEDSRYKHLHGKFVQHXXXXXXXXXXXDATAVDM 337
            S T E++I+ATTRPETLFGD AIA+HP+D RY HLHGKFVQH           D  AVDM
Sbjct: 326  SETGEKLIIATTRPETLFGDTAIAVHPDDPRYTHLHGKFVQHPFLPRKLPIVLDKEAVDM 385

Query: 338  TFGTGAVKITPAHDQNDYNVGKRHSLQFVNIFTDDGLLNENCGSSWEGLKRFDARQLVID 397
             FGTGAVKITPAHDQNDY  GKRH+L+F+NI TD+GLLNENCG  WEG++RFDAR+ VI+
Sbjct: 386  EFGTGAVKITPAHDQNDYQTGKRHNLEFINILTDNGLLNENCGPEWEGMRRFDARKAVIE 445

Query: 398  ELKRKGFFMKQEDNPMIIPLCSRSGDVIEPLLKHNGGSHKIN-GQDSDRYCGKREIRFSS 456
            +LK  G ++ QEDN M IP CSRSGD+IEPLLK      + +  +++ +     E+  + 
Sbjct: 446  KLKEMGLYIGQEDNEMTIPTCSRSGDIIEPLLKPQWWVAQGDMAKEAIKVVKNGEVTITP 505

Query: 457  SNTKNDYFRWLENIQDWCISRQLWWGHRCPVYFINVEGSEDSAAINRNDGKYWVAGRNLE 516
             +++ +YF WLENIQDWCISRQLWWGHRCPVYFI +EG ED    +RNDG +WVAGRNL 
Sbjct: 506  KSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFIKIEGRED----DRNDGTFWVAGRNLA 561

Query: 517  EAVHKAAKKFPNKKFSLEQDQDVLDTWFSSALWPFSTLGWPNKTNDMNLFYPFSMLETGW 576
            EA  KA  K+PN+KF+LEQD+DVLDTWFSS LWPFSTLGWP KT D+  FYPFSMLETGW
Sbjct: 562  EAEEKAKAKYPNEKFTLEQDEDVLDTWFSSGLWPFSTLGWPEKTADLEHFYPFSMLETGW 621

Query: 577  DILFFWVTRMIMLGVKLTGSIPFKEVYCHSLVRDFEGRKMSKSLGNVIDPLDIINGCTLK 636
            DILFFWV+RMI+LG+KLTGS+PFKEV+CHSLVRD +GRKMSKSLGNV+DPLD+I+G  L+
Sbjct: 622  DILFFWVSRMILLGLKLTGSVPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVISGIKLE 681

Query: 637  ELHEKLQQGNLDPXXXXXXXXXXXXXYPRGIPQCGSDALRFALCAYTTGGRDINLDISRV 696
            +LH KL  GNLDP             YP GIPQCG+DA+RFALCAYTTGGRDINLDI RV
Sbjct: 682  DLHAKLLLGNLDPREVEKAKLGQKESYPNGIPQCGTDAMRFALCAYTTGGRDINLDILRV 741

Query: 697  EGYRKFCNKIYQATKFSIQRLGDDYQPPSSTHTPASKSLVEKWILYQMNNTIAIVNDSFE 756
            EGYRKFCNKIYQATKF++ RLGDDYQPP+  H    +SLVEKWIL+++  T  +VN++ E
Sbjct: 742  EGYRKFCNKIYQATKFALMRLGDDYQPPAEKHLSGKESLVEKWILHKLTTTSKVVNEALE 801

Query: 757  KRDFLTCTSKIYELWYMICDVYIENFKWLANDTIME--KAAKDTLHTLIENGLKMIHPFM 814
            KRDFL  TS IYE WY++CDVYIEN K+L  +   E  K+AKDTL+TLIE+ LK+IHPFM
Sbjct: 802  KRDFLNSTSAIYEFWYLVCDVYIENSKYLIQEGSPEEQKSAKDTLYTLIEDALKLIHPFM 861

Query: 815  PYLSEELWQRLPDGIGKDESSSIMKTLYPTPSEDFNYGKEAKQYDEILKIIKSMRSLLSE 874
            P++SEELWQRLP     + S++I+K  YP   ++F+    A  Y+ +L + K  RSLL+E
Sbjct: 862  PFISEELWQRLPKR-ATETSNTIVKASYPVYEQEFDNESAANAYELVLDVTKEARSLLAE 920

Query: 875  YNITANARXXXXXXXXXXXXXVRAEKDAILSVMKGVENISFLAVAPDRQPIKNDCVSCSI 934
            YNI  N +               ++KD+I+S++K ++ ++ +  + +   I   CV  ++
Sbjct: 921  YNILKNGKVYVESNHDESFETTTSQKDSIVSMIKAIDEVTVVRKSSE---IPEGCVLKAV 977

Query: 935  SSQVNVYLLVKGQYKDIXXXXXXXXXXXXXXNNIYAATQRMLTNKDFIKKASEEIREMNE 994
            +  VNV+LLVKG   DI              N      ++ +  KD+  KA+++ +E N+
Sbjct: 978  NPDVNVHLLVKGHI-DIEAEIAKVQKKLEKANKSKQNIEQTIGRKDYESKANDQAKEANK 1036

Query: 995  KKLINIHNKILGMQNTVNNLKRFQ 1018
             KL N   +I G++ T+ NL R +
Sbjct: 1037 VKLENSVAEIEGLEATIENLNRLK 1060

>YGR094W (VAS1) [2054] chr7 (672188..675502) Valyl-tRNA synthetase
            (mitochondrial and cytoplasmic forms are coded from the
            same gene), member of class I family of aminoacyl-tRNA
            synthetases [3315 bp, 1104 aa]
          Length = 1104

 Score = 1235 bits (3196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/984 (60%), Positives = 736/984 (74%), Gaps = 15/984 (1%)

Query: 39   PIVKKVLPPLNSIELKAYDPEICEKNWY-WWDQIGAFKPEFTKDGKIKAEGLFCIPAPPP 97
            P  KK+L  L+   LKAY+P   E +WY WW + G F+PEFT DGK+K EG+FCIPAPPP
Sbjct: 131  PGEKKILVSLDDPALKAYNPANVESSWYDWWIKTGVFEPEFTADGKVKPEGVFCIPAPPP 190

Query: 98   NVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVEKQLWKQEKKTR 157
            NVTGALH+GHALTIAIQDSLIRY RMKGKTVLFLPGFDHAGIATQSVVEKQ+W +++KTR
Sbjct: 191  NVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWAKDRKTR 250

Query: 158  YDYGRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRLHD 217
            +DYGR+ F+ K WEWKE+YH RIKNQ+++LGASYDWSREAFTL P+L+ +V+EAFVRLHD
Sbjct: 251  HDYGREAFVGKVWEWKEEYHSRIKNQIQKLGASYDWSREAFTLSPELTKSVEEAFVRLHD 310

Query: 218  AGIIYRASRLVNWSVKLKTTISNLEVDNKIINGRTLLTVPDYKDKIEFGVLIYIAYPVID 277
             G+IYRASRLVNWSVKL T ISNLEV+NK +  RTLL+VP Y +K+EFGVL   AYPVI 
Sbjct: 311  EGVIYRASRLVNWSVKLNTAISNLEVENKDVKSRTLLSVPGYDEKVEFGVLTSFAYPVIG 370

Query: 278  SNTNERIIVATTRPETLFGDVAIAIHPEDSRYKHLHGKFVQHXXXXXXXXXXXDATAVDM 337
            S+  E++I+ATTRPET+FGD A+A+HP+D RYKHLHGKF+QH           D  AVDM
Sbjct: 371  SD--EKLIIATTRPETIFGDTAVAVHPDDDRYKHLHGKFIQHPFLPRKIPIITDKEAVDM 428

Query: 338  TFGTGAVKITPAHDQNDYNVGKRHSLQFVNIFTDDGLLNENCGSSWEGLKRFDARQLVID 397
             FGTGAVKITPAHDQNDYN GKRH+L+F+NI TDDGLLNE CG  W+G+KRFDAR+ VI+
Sbjct: 429  EFGTGAVKITPAHDQNDYNTGKRHNLEFINILTDDGLLNEECGPEWQGMKRFDARKKVIE 488

Query: 398  ELKRKGFFMKQEDNPMIIPLCSRSGDVIEPLLKHNG-GSHKINGQDSDRYCGKREIRFSS 456
            +LK K  ++ QEDN M IP CSRSGD+IEPLLK     S     +D+ +     +I  + 
Sbjct: 489  QLKEKNLYVGQEDNEMTIPTCSRSGDIIEPLLKPQWWVSQSEMAKDAIKVVRDGQITITP 548

Query: 457  SNTKNDYFRWLENIQDWCISRQLWWGHRCPVYFINVEGSEDSAAINRNDGKYWVAGRNLE 516
             +++ +YF WL NIQDWCISRQLWWGHRCPVYFIN+EG E     +R DG YWVAGR++E
Sbjct: 549  KSSEAEYFHWLGNIQDWCISRQLWWGHRCPVYFINIEGEEH----DRIDGDYWVAGRSME 604

Query: 517  EAVHKAAKKFPNKKFSLEQDQDVLDTWFSSALWPFSTLGWPNKTNDMNLFYPFSMLETGW 576
            EA  KAA K+PN KF+LEQD+DVLDTWFSS LWPFSTLGWP KT DM  FYPFSMLETGW
Sbjct: 605  EAEKKAAAKYPNSKFTLEQDEDVLDTWFSSGLWPFSTLGWPEKTKDMETFYPFSMLETGW 664

Query: 577  DILFFWVTRMIMLGVKLTGSIPFKEVYCHSLVRDFEGRKMSKSLGNVIDPLDIINGCTLK 636
            DILFFWVTRMI+LG+KLTGS+PFKEV+CHSLVRD +GRKMSKSLGNVIDPLD+I G  L 
Sbjct: 665  DILFFWVTRMILLGLKLTGSVPFKEVFCHSLVRDAQGRKMSKSLGNVIDPLDVITGIKLD 724

Query: 637  ELHEKLQQGNLDPXXXXXXXXXXXXXYPRGIPQCGSDALRFALCAYTTGGRDINLDISRV 696
            +LH KL QGNLDP             YP GIPQCG+DA+RFALCAYTTGGRDINLDI RV
Sbjct: 725  DLHAKLLQGNLDPREVEKAKIGQKESYPNGIPQCGTDAMRFALCAYTTGGRDINLDILRV 784

Query: 697  EGYRKFCNKIYQATKFSIQRLGDDYQPPSSTHTPASKSLVEKWILYQMNNTIAIVNDSFE 756
            EGYRKFCNKIYQATKF++ RLGDDYQPP++     ++SLVEKWIL+++  T  IVN++ +
Sbjct: 785  EGYRKFCNKIYQATKFALMRLGDDYQPPATEGLSGNESLVEKWILHKLTETSKIVNEALD 844

Query: 757  KRDFLTCTSKIYELWYMICDVYIENFKWLAND--TIMEKAAKDTLHTLIENGLKMIHPFM 814
            KRDFLT TS IYE WY+ICDVYIEN K+L  +   I +K+AKDTL+ L++N LK+IHPFM
Sbjct: 845  KRDFLTSTSSIYEFWYLICDVYIENSKYLIQEGSAIEKKSAKDTLYILLDNALKLIHPFM 904

Query: 815  PYLSEELWQRLPDGIGKDESSSIMKTLYPTPSEDFNYGKEAKQYDEILKIIKSMRSLLSE 874
            P++SEE+WQRLP     ++++SI+K  YP    +++  K A  YD +L I K  RSLLSE
Sbjct: 905  PFISEEMWQRLPKR-STEKAASIVKASYPVYVSEYDDVKSANAYDLVLNITKEARSLLSE 963

Query: 875  YNITANARXXXXXXXXXXXXXVRAEKDAILSVMKGVENISFLAVAPDRQPIKNDCVSCSI 934
            YNI  N +                +KD+I+S++K ++ ++   V  D   I   CV  S+
Sbjct: 964  YNILKNGKVFVESNHEEYFKTAEDQKDSIVSLIKAIDEVT---VVRDASEIPEGCVLQSV 1020

Query: 935  SSQVNVYLLVKGQYKDIXXXXXXXXXXXXXXNNIYAATQRMLTNKDFIKKASEEIREMNE 994
            + +VNV+LLVKG + DI                     ++ + +KD+  KA+ + +E N+
Sbjct: 1021 NPEVNVHLLVKG-HVDIDAEIAKVQKKLEKAKKSKNGIEQTINSKDYETKANTQAKEANK 1079

Query: 995  KKLINIHNKILGMQNTVNNLKRFQ 1018
             KL N   +I G++ T+ NLKR +
Sbjct: 1080 SKLDNTVAEIEGLEATIENLKRLK 1103

>CAGL0G03091g 286259..289576 highly similar to sp|P07806 Saccharomyces
            cerevisiae YGR094w VAS1 valyl-tRNA synthetase,
            hypothetical start
          Length = 1105

 Score = 1235 bits (3196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/984 (60%), Positives = 733/984 (74%), Gaps = 15/984 (1%)

Query: 39   PIVKKVLPPLNSIELKAYDPEICEKNWY-WWDQIGAFKPEFTKDGKIKAEGLFCIPAPPP 97
            P  KK+L  L+   LKAY+P   E +WY WW + GAF PEFT DGK+K EGLFCIPAPPP
Sbjct: 132  PGEKKILVSLDDPALKAYNPANVESSWYDWWVKSGAFDPEFTADGKVKPEGLFCIPAPPP 191

Query: 98   NVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVEKQLWKQEKKTR 157
            NVTGALH+GHALTIAIQDSLIRY RMKGKTVLFLPGFDHAGIATQSVVEKQLW +EKKTR
Sbjct: 192  NVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQLWAKEKKTR 251

Query: 158  YDYGRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRLHD 217
            +D+GR  F++K WEWKE+YH+RIKNQ+K LGASYDW+REAFTLDP+LS +V EAFVRLHD
Sbjct: 252  HDFGRTKFVEKVWEWKEEYHQRIKNQIKFLGASYDWNREAFTLDPQLSKSVVEAFVRLHD 311

Query: 218  AGIIYRASRLVNWSVKLKTTISNLEVDNKIINGRTLLTVPDYKDKIEFGVLIYIAYPVID 277
             G IYRA+RLVNWSVKL T ISNLEV+NK + GRTLL+VP+Y +K+EFGVL   AYPV D
Sbjct: 312  DGTIYRAARLVNWSVKLNTAISNLEVENKDVKGRTLLSVPNYDEKVEFGVLTSFAYPVAD 371

Query: 278  SNTNERIIVATTRPETLFGDVAIAIHPEDSRYKHLHGKFVQHXXXXXXXXXXXDATAVDM 337
            S+  E++++ATTRPET+FGD AIA+HP+D+RYKHLHGKFVQH           D+ AVDM
Sbjct: 372  SD--EKLVIATTRPETIFGDTAIAVHPDDARYKHLHGKFVQHPFLPRKLPIICDSEAVDM 429

Query: 338  TFGTGAVKITPAHDQNDYNVGKRHSLQFVNIFTDDGLLNENCGSSWEGLKRFDARQLVID 397
             FGTGAVKITPAHDQNDYN GKRH+L+F+NI TDDGLLNENCG  W+G+KRFDAR+ VI+
Sbjct: 430  EFGTGAVKITPAHDQNDYNTGKRHNLEFINILTDDGLLNENCGPEWQGMKRFDARKKVIE 489

Query: 398  ELKRKGFFMKQEDNPMIIPLCSRSGDVIEPLLKHNG-GSHKINGQDSDRYCGKREIRFSS 456
            ++K+   ++ QEDN M IP CSRSGD+IEPLLK     +     +D+ +     EI+ + 
Sbjct: 490  DMKKLNLYIGQEDNEMTIPTCSRSGDIIEPLLKPQWWVAQGEMAKDAIKAVKNGEIKIAP 549

Query: 457  SNTKNDYFRWLENIQDWCISRQLWWGHRCPVYFINVEGSEDSAAINRNDGKYWVAGRNLE 516
             +++ +YF WLENIQDWCISRQLWWGHRCPVYFI++EG E+    +RNDG YWVAGR+L 
Sbjct: 550  KSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFIDIEGQEN----DRNDGNYWVAGRDLA 605

Query: 517  EAVHKAAKKFPNKKFSLEQDQDVLDTWFSSALWPFSTLGWPNKTNDMNLFYPFSMLETGW 576
            EA  KA  KFP+ KF+L QD+DVLDTWFSS LWPFSTLGWP+KT DM  FYPFSMLETGW
Sbjct: 606  EAETKAKAKFPDAKFTLHQDEDVLDTWFSSGLWPFSTLGWPDKTKDMEDFYPFSMLETGW 665

Query: 577  DILFFWVTRMIMLGVKLTGSIPFKEVYCHSLVRDFEGRKMSKSLGNVIDPLDIINGCTLK 636
            DILFFWVTRMI+LG+KLTGS+PF EV+CHSLVRD +GRKMSKSLGNV+DPLD+I G  L+
Sbjct: 666  DILFFWVTRMILLGIKLTGSVPFNEVFCHSLVRDAQGRKMSKSLGNVVDPLDVITGIKLE 725

Query: 637  ELHEKLQQGNLDPXXXXXXXXXXXXXYPRGIPQCGSDALRFALCAYTTGGRDINLDISRV 696
            +LH KL  GNLDP             YP GIPQCG+DA+RFALCAYTTGGRDINLDI RV
Sbjct: 726  DLHAKLLMGNLDPREVEKAKLGQKESYPNGIPQCGTDAMRFALCAYTTGGRDINLDILRV 785

Query: 697  EGYRKFCNKIYQATKFSIQRLGDDYQPPSSTHTPASKSLVEKWILYQMNNTIAIVNDSFE 756
            EGYRKFCNKIYQATKF++ RLGDDY PP+      ++SLVEKWIL+++  T   VND+ E
Sbjct: 786  EGYRKFCNKIYQATKFALMRLGDDYVPPAKEGLSGNESLVEKWILHKLTKTSQTVNDALE 845

Query: 757  KRDFLTCTSKIYELWYMICDVYIENFKWLAND--TIMEKAAKDTLHTLIENGLKMIHPFM 814
            KRDFLT TS IYE WY+ICDVYIEN K L  +   + +K+A+DTL+ L++N LK+IHPFM
Sbjct: 846  KRDFLTSTSAIYEFWYLICDVYIENSKHLIQEGSDLEKKSARDTLYILLDNALKLIHPFM 905

Query: 815  PYLSEELWQRLPDGIGKDESSSIMKTLYPTPSEDFNYGKEAKQYDEILKIIKSMRSLLSE 874
            P++SEE+WQR+P     +  ++I++  YP   + ++  K A  Y+ +L I K  RSLL+E
Sbjct: 906  PFISEEMWQRIPKR-STETVNTIVRASYPVYQKVYDDEKSAASYELVLDITKEARSLLAE 964

Query: 875  YNITANARXXXXXXXXXXXXXVRAEKDAILSVMKGVENISFLAVAPDRQPIKNDCVSCSI 934
            YNI    +              +++KD+I+S++K +  +  +  A +   I   CV  ++
Sbjct: 965  YNILKEGKVFVESDHTESFETAQSQKDSIVSLIKAINEVDVVRSASE---IPEGCVLKAV 1021

Query: 935  SSQVNVYLLVKGQYKDIXXXXXXXXXXXXXXNNIYAATQRMLTNKDFIKKASEEIREMNE 994
            + QVNV+LLVKG   DI                     ++++  KD+  KA+E+ +E N+
Sbjct: 1022 NPQVNVHLLVKGHI-DIDAEIAKVEKKIEKARKTKQGIEQIINGKDYDTKANEQAKEANK 1080

Query: 995  KKLINIHNKILGMQNTVNNLKRFQ 1018
             +L N    I G + T+ NLKR +
Sbjct: 1081 VRLENSIADIEGFETTIENLKRLK 1104

>AAR034W [220] [Homologous to ScYGR094W (VAS1) - SH]
            complement(402706..406002) [3297 bp, 1098 aa]
          Length = 1098

 Score = 1228 bits (3178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 586/986 (59%), Positives = 736/986 (74%), Gaps = 17/986 (1%)

Query: 39   PIVKKVLPPLNSIELKAYDPEICEKNWY-WWDQIGAFKPEFTKDGKIKAEGLFCIPAPPP 97
            P  KK+L  L+   LKAY+P   E +WY WW + G F+PE TKDGKIK EG+FCIPAPPP
Sbjct: 123  PGEKKILKSLDDPALKAYNPANVESSWYDWWVKSGFFEPELTKDGKIKPEGIFCIPAPPP 182

Query: 98   NVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVEKQLWKQEKKTR 157
            NVTGALH+GHALTIAIQDSLIRY RMKGKTVLFLPGFDHAGIATQSVVEKQ+W  EKKTR
Sbjct: 183  NVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWANEKKTR 242

Query: 158  YDYGRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRLHD 217
            +DYGR+ F+KK W+WKE YH +IK+Q++RLGASYDWSREAFTLDP+LS +V EAFVRLH+
Sbjct: 243  HDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEAFVRLHE 302

Query: 218  AGIIYRASRLVNWSVKLKTTISNLEVDNKIINGRTLLTVPDYKDKIEFGVLIYIAYPVID 277
             G+IYRASRLVNWSVKL T ISNLEV+NK I G+TLL+VP Y +K+EFGVL   AYPV+D
Sbjct: 303  EGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYDEKVEFGVLTSFAYPVVD 362

Query: 278  SNTNERIIVATTRPETLFGDVAIAIHPEDSRYKHLHGKFVQHXXXXXXXXXXXDATAVDM 337
            S+  E++I+ATTRPET+FGD AIAIHP+D RYKHLHGKFVQH           DA AVDM
Sbjct: 363  SD--EKLIIATTRPETMFGDTAIAIHPDDPRYKHLHGKFVQHPFLPRKMPIVCDAEAVDM 420

Query: 338  TFGTGAVKITPAHDQNDYNVGKRHSLQFVNIFTDDGLLNENCGSSWEGLKRFDARQLVID 397
             FGTGAVKITP HDQNDYN GKRH L+ +NI TDDGLLNENCG  W+G+KRFDAR+ VI+
Sbjct: 421  EFGTGAVKITPGHDQNDYNTGKRHDLEIINILTDDGLLNENCGPEWQGMKRFDARKRVIE 480

Query: 398  ELKRKGFFMKQEDNPMIIPLCSRSGDVIEPLLKHNG-GSHKINGQDSDRYCGKREIRFSS 456
            +L+  G F+ Q+DN M+IP CSRSGDVIEP+LK     S     +++        I  + 
Sbjct: 481  KLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKEAINAVKDGRITITP 540

Query: 457  SNTKNDYFRWLENIQDWCISRQLWWGHRCPVYFINVEGSEDSAAINRNDGKYWVAGRNLE 516
             ++ ++YF WLENIQDWCISRQLWWGHRCPVYF+N+EG E S    RN+G YWV+GRNLE
Sbjct: 541  KSSASEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGKEQS----RNEGTYWVSGRNLE 596

Query: 517  EAVHKAAKKFPNKKFSLEQDQDVLDTWFSSALWPFSTLGWPNKTNDMNLFYPFSMLETGW 576
            EA  KAA+KFPN+ ++LEQD+DVLDTWFSS LWPFSTLGWP+KT DM+ FYPFSMLETGW
Sbjct: 597  EAQKKAAEKFPNEVYTLEQDEDVLDTWFSSGLWPFSTLGWPDKTPDMSTFYPFSMLETGW 656

Query: 577  DILFFWVTRMIMLGVKLTGSIPFKEVYCHSLVRDFEGRKMSKSLGNVIDPLDIINGCTLK 636
            DIL+FWV RMI+LG+KLTG++PF EV+CHSLVRD +GRKMSKSLGNV+DPL +I G +L+
Sbjct: 657  DILYFWVARMILLGIKLTGNVPFNEVFCHSLVRDAQGRKMSKSLGNVVDPLYVITGSSLE 716

Query: 637  ELHEKLQQGNLDPXXXXXXXXXXXXXYPRGIPQCGSDALRFALCAYTTGGRDINLDISRV 696
            ELH  L +GNLDP             YP GIPQCG+DALRFALCAYTTGGRDINLDI RV
Sbjct: 717  ELHATLSKGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRV 776

Query: 697  EGYRKFCNKIYQATKFSIQRLGDDYQPPSSTHTPASKSLVEKWILYQMNNTIAIVNDSFE 756
            EGYRKFCNKIYQATKF++ RLGDDY PP+      ++SLVEKWIL+++++T   VN++F+
Sbjct: 777  EGYRKFCNKIYQATKFALMRLGDDYVPPAEEQLSGNESLVEKWILHELSSTAKTVNEAFD 836

Query: 757  KRDFLTCTSKIYELWYMICDVYIENFKWLAND--TIMEKAAKDTLHTLIENGLKMIHPFM 814
            KRDFLT TS IY+ WY+ICDVYIEN K+L  +   + +K+A+DTL+TL++N L++IHPFM
Sbjct: 837  KRDFLTSTSAIYDFWYLICDVYIENSKYLIQEGTDLEKKSARDTLYTLVDNALRLIHPFM 896

Query: 815  PYLSEELWQRLPDGIGKDESSSIMKTLYPTPSEDFNYGKEAKQYDEILKIIKSMRSLLSE 874
            P++SEE+WQ LP     + S SI+K  YP   +DF   + A  Y+ +L   K  RSLL+E
Sbjct: 897  PFISEEMWQHLPKR-ASETSESIVKAKYPVFRQDFFDEESAADYNLVLSATKEARSLLAE 955

Query: 875  YNITANARX--XXXXXXXXXXXXVRAEKDAILSVMKGVENISFLAVAPDRQPIKNDCVSC 932
            YNI  N +               + ++  +I+S++K ++ ++ +  A +   I   CV  
Sbjct: 956  YNIVKNGKVFIEVQGNNDKVFTCLNSQSASIVSLIKAIDQVTVVRSATE---IPEGCVLS 1012

Query: 933  SISSQVNVYLLVKGQYKDIXXXXXXXXXXXXXXNNIYAATQRMLTNKDFIKKASEEIREM 992
            S++  VNV+ LVKGQ  DI                   A ++++ + D+  KA+E+ ++ 
Sbjct: 1013 SVTPDVNVHALVKGQV-DIDTEIQKFNKKLDKAQKSKEAIEKVVGSSDYETKANEQAKKA 1071

Query: 993  NEKKLINIHNKILGMQNTVNNLKRFQ 1018
            N+ +L +I  +I  ++ T+ NL++ +
Sbjct: 1072 NKDRLDSIAAEIESLEATIANLEKLK 1097

>Sklu_1989.2 YGR094W, Contig c1989 1283-4597 reverse complement
          Length = 1104

 Score = 1224 bits (3168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/984 (60%), Positives = 735/984 (74%), Gaps = 15/984 (1%)

Query: 39   PIVKKVLPPLNSIELKAYDPEICEKNWY-WWDQIGAFKPEFTKDGKIKAEGLFCIPAPPP 97
            P  KK+L  L+   LKAY+P   E +WY WW + G F+PEFTKDGK+K EGLFCIPAPPP
Sbjct: 131  PGEKKILVSLDDPALKAYNPANVESSWYEWWVKSGLFEPEFTKDGKVKPEGLFCIPAPPP 190

Query: 98   NVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVEKQLWKQEKKTR 157
            NVTGALH+GHALTIAIQDSLIRY RMKGKTVLFLPGFDHAGIATQSVVEKQ+W +EKKTR
Sbjct: 191  NVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWAKEKKTR 250

Query: 158  YDYGRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRLHD 217
            +DYGR+ F+ K WEWKE+YH RIK Q+K+LGASYDW REAFTLDPKLSTAV EAFVRLH+
Sbjct: 251  HDYGREEFVGKVWEWKEEYHGRIKGQIKKLGASYDWKREAFTLDPKLSTAVTEAFVRLHE 310

Query: 218  AGIIYRASRLVNWSVKLKTTISNLEVDNKIINGRTLLTVPDYKDKIEFGVLIYIAYPVID 277
             GIIYRASRL+NWSVKL T ISNLEV+NK +  RTLL+VP Y +K+EFGVL   AY V+D
Sbjct: 311  EGIIYRASRLINWSVKLNTAISNLEVENKDVKARTLLSVPGYDEKVEFGVLTSFAYQVVD 370

Query: 278  SNTNERIIVATTRPETLFGDVAIAIHPEDSRYKHLHGKFVQHXXXXXXXXXXXDATAVDM 337
            S+  E++I+ATTRPET+FGD AIA+HPED RYKHLHGKFVQH           D+ AVDM
Sbjct: 371  SD--EKLIIATTRPETMFGDTAIAVHPEDPRYKHLHGKFVQHPFLPRKLPIVCDSEAVDM 428

Query: 338  TFGTGAVKITPAHDQNDYNVGKRHSLQFVNIFTDDGLLNENCGSSWEGLKRFDARQLVID 397
             FGTGAVKITPAHDQNDYN GKRH+L+F+NI TDDGLLNENCG  W G+KRFDAR+ V++
Sbjct: 429  EFGTGAVKITPAHDQNDYNTGKRHNLEFINILTDDGLLNENCGPEWCGMKRFDARKKVVE 488

Query: 398  ELKRKGFFMKQEDNPMIIPLCSRSGDVIEPLLKHNG-GSHKINGQDSDRYCGKREIRFSS 456
            ELK  G ++ QEDN M IP+CSRSGD+IEPLLK     S     +++ +     +I  + 
Sbjct: 489  ELKNAGLYIGQEDNEMTIPICSRSGDIIEPLLKPQWWVSQTEMAKEAIKAVRNGDITITP 548

Query: 457  SNTKNDYFRWLENIQDWCISRQLWWGHRCPVYFINVEGSEDSAAINRNDGKYWVAGRNLE 516
             +++++YF WLENIQDWCISRQLWWGHRCPVYF+ +EG ++    ++NDGKYWV+GR  E
Sbjct: 549  KSSESEYFHWLENIQDWCISRQLWWGHRCPVYFVKIEGEDN----DKNDGKYWVSGRTTE 604

Query: 517  EAVHKAAKKFPNKKFSLEQDQDVLDTWFSSALWPFSTLGWPNKTNDMNLFYPFSMLETGW 576
            EA  KAAK F  KK++LEQD+DVLDTWFSS LWPFSTLGWP KT DM  FYPFSMLETGW
Sbjct: 605  EAEEKAAKAFSGKKYTLEQDEDVLDTWFSSGLWPFSTLGWPEKTPDMENFYPFSMLETGW 664

Query: 577  DILFFWVTRMIMLGVKLTGSIPFKEVYCHSLVRDFEGRKMSKSLGNVIDPLDIINGCTLK 636
            DILFFWV+RMI+LG+KLTGSIPFKEV+CHSLVRD +GRKMSKSLGNV+DPLD+I G  L+
Sbjct: 665  DILFFWVSRMILLGLKLTGSIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVIGGIKLE 724

Query: 637  ELHEKLQQGNLDPXXXXXXXXXXXXXYPRGIPQCGSDALRFALCAYTTGGRDINLDISRV 696
            +LH KL  GNLDP             YP GIPQCG+DALRFALCAYTTGGRDINLDI RV
Sbjct: 725  DLHAKLLLGNLDPREVEKAKTGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRV 784

Query: 697  EGYRKFCNKIYQATKFSIQRLGDDYQPPSSTHTPASKSLVEKWILYQMNNTIAIVNDSFE 756
            EGYRKFCNKIYQATKF++ RLGDDYQPP+       +SLVE+WIL+++ N    VN++ +
Sbjct: 785  EGYRKFCNKIYQATKFALMRLGDDYQPPAEEKLSGKESLVEQWILHKLTNYSKTVNEALD 844

Query: 757  KRDFLTCTSKIYELWYMICDVYIENFKWLAND--TIMEKAAKDTLHTLIENGLKMIHPFM 814
            KRDFL  TS IYE WY+ICD+YIEN K L N+   + +K+A+DTL+ L++N LKMIHPFM
Sbjct: 845  KRDFLNSTSAIYEFWYLICDIYIENSKHLINEGSEVEKKSARDTLYILLDNALKMIHPFM 904

Query: 815  PYLSEELWQRLPDGIGKDESSSIMKTLYPTPSEDFNYGKEAKQYDEILKIIKSMRSLLSE 874
            P++SEE+WQ LP  +  + S SI+K  YP    +F+  K A  Y+ +L + K  RSLL++
Sbjct: 905  PFISEEMWQHLPKRVS-EVSPSIVKASYPVYKAEFDNEKAATDYEFVLDVTKEARSLLAQ 963

Query: 875  YNITANARXXXXXXXXXXXXXVRAEKDAILSVMKGVENISFLAVAPDRQPIKNDCVSCSI 934
            Y+I  N +               ++KD+++S++K ++ ++ +  A D   +    V  ++
Sbjct: 964  YSILKNGKVFIETNNDSLFKTAASQKDSVVSLIKAIDEVTVVRSASD---VPEGAVLQAV 1020

Query: 935  SSQVNVYLLVKGQYKDIXXXXXXXXXXXXXXNNIYAATQRMLTNKDFIKKASEEIREMNE 994
            + +VNV++LVKG   DI                     ++++ +KD+  KA+E+ +E N+
Sbjct: 1021 TPEVNVHVLVKGHV-DIDAEISKTQKKLEKAQKSKQGIEKIINSKDYEAKANEQAKESNK 1079

Query: 995  KKLINIHNKILGMQNTVNNLKRFQ 1018
             KL N   +I G++ T+ NL+R +
Sbjct: 1080 IKLENTAAEIEGLEATIANLERLK 1103

>Kwal_23.3972
          Length = 1100

 Score = 1206 bits (3121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/980 (59%), Positives = 731/980 (74%), Gaps = 15/980 (1%)

Query: 42   KKVLPPLNSIELKAYDPEICEKNWY-WWDQIGAFKPEFTKDGKIKAEGLFCIPAPPPNVT 100
            KK+L  L    LKAY+P   E +WY WW + G F+PEFTK+G+IK EGLFCIPAPPPNVT
Sbjct: 130  KKILVSLEDPALKAYNPANVESSWYDWWVKSGFFEPEFTKEGEIKPEGLFCIPAPPPNVT 189

Query: 101  GALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVEKQLWKQEKKTRYDY 160
            GALH+GH LTIAIQDSLIRY RMKGKTVLFLPGFDHAGIATQSVVEKQ+W +EKKTR+DY
Sbjct: 190  GALHIGHGLTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQVWAKEKKTRHDY 249

Query: 161  GRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRLHDAGI 220
            GR+ F++K WEWKE YHKRIKNQ+ +LGASYDWSREAFTL P+L+ +V EAFVRLH+ G+
Sbjct: 250  GREAFVEKIWEWKEDYHKRIKNQINKLGASYDWSREAFTLSPELTKSVTEAFVRLHEKGV 309

Query: 221  IYRASRLVNWSVKLKTTISNLEVDNKIINGRTLLTVPDYKDKIEFGVLIYIAYPVIDSNT 280
            IYRA+RLVNWSVKL T ISNLEV+NK I  RTLL+VP Y +K+EFGVL   AYPV+DS+ 
Sbjct: 310  IYRANRLVNWSVKLNTAISNLEVENKDIKARTLLSVPGYDEKVEFGVLTSFAYPVVDSD- 368

Query: 281  NERIIVATTRPETLFGDVAIAIHPEDSRYKHLHGKFVQHXXXXXXXXXXXDATAVDMTFG 340
             E++IVATTRPET+FGD  +A+HP+D RYKHLHGKFVQH           D+ AVDM FG
Sbjct: 369  -EKLIVATTRPETMFGDTGVAVHPDDPRYKHLHGKFVQHPFLPRKIPIFCDSEAVDMNFG 427

Query: 341  TGAVKITPAHDQNDYNVGKRHSLQFVNIFTDDGLLNENCGSSWEGLKRFDARQLVIDELK 400
            TGAVK+TPAHDQNDYN GKRH+L+F+N+ TD GLLNENCG  W G+KRFDAR+ VI+ LK
Sbjct: 428  TGAVKMTPAHDQNDYNTGKRHNLEFINVLTDTGLLNENCGPEWAGMKRFDARKNVIEALK 487

Query: 401  RKGFFMKQEDNPMIIPLCSRSGDVIEPLLKHNG-GSHKINGQDSDRYCGKREIRFSSSNT 459
            +KG ++ QEDN M IP CSRSGDVIEPLLK     S     + + +      I  +  ++
Sbjct: 488  QKGLYIGQEDNEMTIPTCSRSGDVIEPLLKPQWWVSQSQMAEKAIKAVKDGRITITPKSS 547

Query: 460  KNDYFRWLENIQDWCISRQLWWGHRCPVYFINVEGSEDSAAINRNDGKYWVAGRNLEEAV 519
            + +YF WLENIQDWCISRQLWWGHRCPVYF+++EG ++    ++ DG+YWV+GRNLEEA 
Sbjct: 548  EAEYFHWLENIQDWCISRQLWWGHRCPVYFVDIEGQDN----DQIDGEYWVSGRNLEEAE 603

Query: 520  HKAAKKFPNKKFSLEQDQDVLDTWFSSALWPFSTLGWPNKTNDMNLFYPFSMLETGWDIL 579
             KAAKKFPN K++L+QD+DVLDTWFSS LWPFSTLGWP+KT D++ FYPFSMLETGWDIL
Sbjct: 604  AKAAKKFPNAKYTLKQDEDVLDTWFSSGLWPFSTLGWPDKTKDLSQFYPFSMLETGWDIL 663

Query: 580  FFWVTRMIMLGVKLTGSIPFKEVYCHSLVRDFEGRKMSKSLGNVIDPLDIINGCTLKELH 639
            FFWV+RMI+LG++LTG IPFKEV+CHSLVRD +GRKMSKSLGNV+DPLD++ G  L++LH
Sbjct: 664  FFWVSRMILLGLELTGEIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVVCGIKLEDLH 723

Query: 640  EKLQQGNLDPXXXXXXXXXXXXXYPRGIPQCGSDALRFALCAYTTGGRDINLDISRVEGY 699
             KL  GNLDP             YP GIPQCG+DALRFALCAYTTGGRDINLDI RVEGY
Sbjct: 724  AKLLSGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGY 783

Query: 700  RKFCNKIYQATKFSIQRLGDDYQPPSSTHTPASKSLVEKWILYQMNNTIAIVNDSFEKRD 759
            RKFCNKIYQATKF++ RLG+DYQPPS      ++SLVEKWIL +M N    +N++ +KRD
Sbjct: 784  RKFCNKIYQATKFALIRLGEDYQPPSMEKLSGNESLVEKWILNKMTNYAKSINEALDKRD 843

Query: 760  FLTCTSKIYELWYMICDVYIENFKWLANDTI--MEKAAKDTLHTLIENGLKMIHPFMPYL 817
            FLT TS IYE WY++CDVYIEN K+L  +     +K+AKDTL+ LI+N L++IHPFMP++
Sbjct: 844  FLTSTSGIYEFWYLVCDVYIENSKYLITEGTDAEKKSAKDTLYILIDNALRLIHPFMPFI 903

Query: 818  SEELWQRLPDGIGKDESSSIMKTLYPTPSEDFNYGKEAKQYDEILKIIKSMRSLLSEYNI 877
            SEE+WQRLP     ++S +I+K  YP   +DF+  K  ++Y+ IL  IK  RSLL++Y I
Sbjct: 904  SEEMWQRLPKRTS-EQSPTIVKASYPVYRKDFDNQKAGEEYELILDTIKEARSLLAQYGI 962

Query: 878  TANARXXXXXXXXXXXXXVRAEKDAILSVMKGVENISFLAVAPDRQPIKNDCVSCSISSQ 937
              N +                +KD+I+S++K ++ ++   V  +   I    V  +++ +
Sbjct: 963  LKNGKVFIESSSDAFFDTAVTQKDSIVSLIKAIDEVT---VVKNVSEIPEGAVLQAVTPE 1019

Query: 938  VNVYLLVKGQYKDIXXXXXXXXXXXXXXNNIYAATQRMLTNKDFIKKASEEIREMNEKKL 997
            VNV++LVKG + DI                      +++ +KD+ +KA+E+ +  N  +L
Sbjct: 1020 VNVHVLVKG-HVDIESEISKTEGKLEKAQKTKEGIDKIMNSKDYEEKANEQAKASNLARL 1078

Query: 998  INIHNKILGMQNTVNNLKRF 1017
             N   +I G++ T+ NLKR 
Sbjct: 1079 QNTLAEIEGLEATIANLKRL 1098

>Scas_97.1*
          Length = 261

 Score =  308 bits (790), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 144/246 (58%), Positives = 182/246 (73%), Gaps = 6/246 (2%)

Query: 274 PVIDSNTNERIIVATTRPETLFGDVAIAIHPEDSRYKHLHGKFVQHXXXXXXXXXXXDAT 333
           P++ S ++E++I+ATTRPET+F       HPED RYKHLHGKFVQH           D+ 
Sbjct: 11  PLLSSRSDEKLIIATTRPETMFVH-CYCCHPEDPRYKHLHGKFVQHPFLPRKLPIVCDSE 69

Query: 334 AVDMTFGTGAVKITPAHDQNDYNVGKRHSLQFVNIFTDDGLLNENCGSSWEGLKRFDARQ 393
           AVDM FGTGAVKITPAHDQNDYN GKRH+L+F+NI TDDGLLNENCG  W G+KRFDAR+
Sbjct: 70  AVDMEFGTGAVKITPAHDQNDYNTGKRHNLEFINILTDDGLLNENCGPEWCGMKRFDARK 129

Query: 394 LVIDELKRKGFFMKQEDNPMIIPLCSRSGDVIEPLLKHNGG-SHKINGQDSDRYCGKREI 452
            V++ELK  G ++ QEDN M IP+CSRSGD+IEPLLK     S     +++ +     +I
Sbjct: 130 KVVEELKNAGLYIGQEDNEMTIPICSRSGDIIEPLLKPQWWVSQTEMAKEAIKAVRNGDI 189

Query: 453 RFSSSNTKNDYFRWLENIQDWCISRQLWWGHRCPVYFINVEGSEDSAAINRNDGKYWVAG 512
             +  +++++YF WLENIQDWCISRQLWWGHRCPVYF+ +EG ++    ++NDGKYWV+G
Sbjct: 190 TITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYFVKIEGEDN----DKNDGKYWVSG 245

Query: 513 RNLEEA 518
           R  EEA
Sbjct: 246 RTTEEA 251

>YBL076C (ILS1) [123] chr2 complement(81041..84259) Isoleucyl-tRNA
           synthetase, cytoplasmic, member of the class I aminoacyl
           tRNA synthetase family [3219 bp, 1072 aa]
          Length = 1072

 Score =  145 bits (367), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 192/850 (22%), Positives = 333/850 (39%), Gaps = 150/850 (17%)

Query: 58  PEICEKNWYWWDQIGAFKP--EFTKDGKIKAEGLFCIPAPPPNVTGALHLGHALTIAIQD 115
           P+  EK    WD+I AF    E TKD   K E  F     PP  TG  H GH L   I+D
Sbjct: 11  PKEEEKVLSLWDEIDAFHTSLELTKD---KPE--FSFFDGPPFATGTPHYGHILASTIKD 65

Query: 116 SLIRYYRMKGKTVLFLPGFDHAGIATQSVVEKQLWKQEKKTRYDYGRDGFIKKAWEWKEK 175
            + RY  M G  V    G+D  G+  + +++K+L    K   + YG + +  +       
Sbjct: 66  IVPRYATMTGHHVERRFGWDTHGVPIEHIIDKKLGITGKDDVFKYGLENYNNECRSIVMT 125

Query: 176 YHKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRLHDAGIIYRASRLVNWSVKLK 235
           Y    +  + RLG   D+  +  T+ P    +   AF +LH+ G +YR  +++ +S  L 
Sbjct: 126 YASDWRKTIGRLGRWIDFDNDYKTMYPSFMESTWWAFKQLHEKGQVYRGFKVMPYSTGLT 185

Query: 236 TTISNLEVDNKIINGRTLLTVPDYKDKIEFGVLIYIAYPVIDSNTNERIIVATTRPETLF 295
           T +SN E               +YKD  +  V   I + VI     + ++  TT P TL 
Sbjct: 186 TPLSNFEAQQ------------NYKDVNDPAVT--IGFNVIGQEKTQ-LVAWTTTPWTLP 230

Query: 296 GDVAIAIH------------------------------PEDSRYK--------------- 310
            ++++ ++                              P++ +YK               
Sbjct: 231 SNLSLCVNADFEYVKIYDETRDRYFILLESLIKTLYKKPKNEKYKIVEKIKGSDLVGLKY 290

Query: 311 -HLHGKFVQHXXXXXXXXXXXDATAVDMTFGTGAVKITPAHDQNDYNVGKRHSL-----Q 364
             L   F +            D    D   GTG V   PA  + D     ++ +      
Sbjct: 291 EPLFPYFAEQFHETAFRVISDDYVTSDS--GTGIVHNAPAFGEEDNAACLKNGVISEDSV 348

Query: 365 FVNIFTDDGLLNENCGSSWEGLKRFDARQLVIDELKRKGFFMKQEDNPMIIPLCSRSGDV 424
             N   D G   ++    +EG+   DA +L+I  L   G  +         P C RS   
Sbjct: 349 LPNAIDDLGRFTKDV-PDFEGVYVKDADKLIIKYLTNTGNLLLASQIRHSYPFCWRSD-- 405

Query: 425 IEPLLKHNGGS-----HKINGQDSDRYCGKREIRFSSSNTKNDYFRWLENIQDWCISRQL 479
             PLL  +  +       I  Q  D       +   ++  +  +  W+ N +DW +SR  
Sbjct: 406 -TPLLYRSVPAWFVRVKNIVPQMLDSVMKSHWV--PNTIKEKRFANWIANARDWNVSRNR 462

Query: 480 WWGHRCPVYFINVEGSEDSAAINRNDGKYWVAGRNLEEAVHKAAKKF--PNK--KFSLEQ 535
           +WG   P++ ++ +  E     +  + +     RN+ +       K   P+K  K  L++
Sbjct: 463 YWGTPIPLW-VSDDFEEVVCVGSIKELEELTGVRNITDLHRDVIDKLTIPSKQGKGDLKR 521

Query: 536 DQDVLDTWFSSALWPFSTLGWP-NKTNDMNLFYPFSMLETGWDILFFWVTRMIMLGVKLT 594
            ++V D WF S   P+++  +P   T   +   P + +  G D    W   + +LG  L 
Sbjct: 522 IEEVFDCWFESGSMPYASQHYPFENTEKFDERVPANFISEGLDQTRGWFYTLAVLGTHLF 581

Query: 595 GSIPFKEVYCHSLVRDFEGRKMSKSLGNVIDPLDIINGCTLKELHEKLQQGNLDPXXXXX 654
           GS+P+K V    +V   +GRKMSKSL N  DP  ++N                       
Sbjct: 582 GSVPYKNVIVSGIVLAADGRKMSKSLKNYPDPSIVLN----------------------- 618

Query: 655 XXXXXXXXYPRGIPQCGSDALRFALC-AYTTGGRDINLDISRVEGYRKFCNKI----YQA 709
                         + G+DALR  L  +       +     + EG ++  +K+    + +
Sbjct: 619 --------------KYGADALRLYLINSPVLKAESLKF---KEEGVKEVVSKVLLPWWNS 661

Query: 710 TKF------SIQRLGD-DYQPPSSTHTPASKSLVEKWILYQMNNTIAIVNDSFEKRDFLT 762
            KF       ++++ + D+Q   S     S +++++WIL  M + +  +++   +    T
Sbjct: 662 FKFLDGQIALLKKMSNIDFQYDDSVK---SDNVMDRWILASMQSLVQFIHEEMGQYKLYT 718

Query: 763 CTSKIYELWYMICDVYIE-NFKWLANDTIMEKAAK--DTLHTLIENGLKMIHPFMPYLSE 819
              K+      + + YI  N + L  +  +E   K  ++L   +   ++ + PF P+LSE
Sbjct: 719 VVPKLLNFIDELTNWYIRFNRRRLKGENGVEDCLKALNSLFDALFTFVRAMAPFTPFLSE 778

Query: 820 ELWQRLPDGI 829
            ++ RL + I
Sbjct: 779 SIYLRLKEYI 788

>CAGL0G03311g 315470..318688 highly similar to sp|P09436
           Saccharomyces cerevisiae YBL076c ILS1 isoleucyl-tRNA
           synthetase, start by similarity
          Length = 1072

 Score =  143 bits (361), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 190/839 (22%), Positives = 327/839 (38%), Gaps = 156/839 (18%)

Query: 68  WDQIGAF--KPEFTKDGKIKAEGLFCIPAPPPNVTGALHLGHALTIAIQDSLIRYYRMKG 125
           W++I AF    E TKD   K E  F     PP  TG  H GH L   I+D + RY  M G
Sbjct: 21  WNEIDAFHRSMELTKD---KPE--FSFFDGPPFATGTPHYGHILASTIKDIVPRYATMTG 75

Query: 126 KTVLFLPGFDHAGIATQSVVEKQLWKQEKKTRYDYGRDGFIKKAWEWKEKYHKRIKNQLK 185
             V    G+D  G+  + +++K+L  + K+  + YG D +  +       Y    +  + 
Sbjct: 76  HHVERRFGWDTHGVPIEHIIDKKLGIKGKEDVFKYGLDNYNNECRAIVMTYADEWRKTIG 135

Query: 186 RLGASYDWSREAFTLDPKLSTAVKEAFVRLHDAGIIYRASRLVNWSVKLKTTISNLEVDN 245
           RLG   D+  +  T+ P    +V  AF +LH+ G +YR  R++ +S  L T +SN E   
Sbjct: 136 RLGRWIDFDNDYKTMYPSFMESVWWAFKQLHEKGQVYRGFRVMPYSTGLTTPLSNFEAQQ 195

Query: 246 KIINGRTLLTVPDYKDKIEFGVLIYIAYPVIDSNTNERIIVATTRPETLFGDVAIAIHPE 305
                       +YKD  +  V   I + VI      +++  TT P TL  ++A+ ++PE
Sbjct: 196 ------------NYKDVNDPAVT--IGFNVI-GQEKTKLVAWTTTPWTLPSNLALCVNPE 240

Query: 306 ------------------DSRYKHLHGK----------------------------FVQH 319
                             +S  K L+ K                            F + 
Sbjct: 241 FEYVKIYDENKDCYFILLESLIKTLYKKPAAEKYKIVEKIKGSELVGLKYEPIFPYFYEQ 300

Query: 320 XXXXXXXXXXXDATAVDMTFGTGAVKITPAHDQNDYNVGKRHSL-----QFVNIFTDDGL 374
                      D    D   GTG V   P+  + DY V   + +        N   D+G 
Sbjct: 301 MKETAFRVIAGDYVTADS--GTGIVHNAPSFGEEDYAVCLENGVISEDTVAPNPVDDNGK 358

Query: 375 LNENCGSSWEGLKRFDARQLVIDELKRKGFFMKQEDNPMIIPLCSRSGDVIEPLLKHNGG 434
              +  + + G+   DA +L+I  L   G  +         P C RS     PLL  +  
Sbjct: 359 FTSDV-TDFAGIYVKDADKLIIKHLTETGNLLLASQIRHSYPFCWRSD---TPLLYRSVP 414

Query: 435 S-----HKINGQDSDRYCGKREIRFSSSNTKNDYFRWLENIQDWCISRQLWWGHRCPVYF 489
           +      +I  +  D       +   ++  +  +  W+ N +DW +SR  +WG   P++ 
Sbjct: 415 AWFVRVKEIAPKMLDSVMNSHWV--PNTIKEKRFANWIANARDWNVSRNRYWGTPIPLWV 472

Query: 490 INVEGSEDSAAINRNDGKYWVAGRNLEEAVHKAA---KKFPNK--KFSLEQDQDVLDTWF 544
              +  E+   +   +    ++G      +H+        P+K  K  L++ ++V D WF
Sbjct: 473 --SDDFEEIVCVGSIEELEQLSGVKNITDLHRDKIDHITIPSKMGKGDLKRIEEVFDCWF 530

Query: 545 SSALWPFSTLGWP-NKTNDMNLFYPFSMLETGWDILFFWVTRMIMLGVKLTGSIPFKEVY 603
            S   P+++  +P   T   +   P + +  G D    W   + +LG  L G +P+K V 
Sbjct: 531 ESGSMPYASQHYPFENTEKFSDRVPANFISEGLDQTRGWFYTLSVLGTHLFGEVPYKNVI 590

Query: 604 CHSLVRDFEGRKMSKSLGNVIDPLDIINGCTLKELHEKLQQGNLDPXXXXXXXXXXXXXY 663
              +V   +GRKMSKSL N  DP +I+                                 
Sbjct: 591 VSGIVLASDGRKMSKSLKNYPDP-NIV--------------------------------- 616

Query: 664 PRGIPQCGSDALRFALC-AYTTGGRDINLDISRVEGYRKFCNKI----YQATKF------ 712
              + + G+DALR  L  +       +     + EG ++   K+    + + KF      
Sbjct: 617 ---LEKYGADALRLYLINSPVLKAESLKF---KEEGVKEVVTKVLLPWWNSYKFLEGQLA 670

Query: 713 SIQRLGD---DYQPPSSTHTPASKSLVEKWILYQMNNTIAIVNDSFEKRDFLTCTSKIYE 769
            +++  D    Y P  S     S +++++WIL  M + +  ++         T   K+  
Sbjct: 671 LLKKTSDVDFKYDPKLS-----SDNVMDRWILASMQSLVQFIHQEMAVYKLYTVVPKLLH 725

Query: 770 LWYMICDVYIE-NFKWLANDTIMEKAAK--DTLHTLIENGLKMIHPFMPYLSEELWQRL 825
               + + YI  N + L  +  ++   K  +TL   +    + + PF P+L++ ++QRL
Sbjct: 726 FIDELTNWYIRFNRRRLKGENGVDDCLKALNTLFDALFTFARAMAPFTPFLADGIYQRL 784

>KLLA0E20625g 1825036..1828257 highly similar to sp|P09436
           Saccharomyces cerevisiae YBL076c ILS1 isoleucyl-tRNA
           synthetase, start by similarity
          Length = 1073

 Score =  142 bits (357), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 203/904 (22%), Positives = 353/904 (39%), Gaps = 172/904 (19%)

Query: 58  PEICEKNWYWWDQIGAF---------KPEFTK-DGKIKAEGLFCIPAPPPNVTGALHLGH 107
           PE  EK   +W++I AF         KPEF+  DG             PP  TG  H GH
Sbjct: 12  PEEEEKVLAFWNEIDAFHTSLKLTEDKPEFSFFDG-------------PPFATGTPHYGH 58

Query: 108 ALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVEKQLWKQEKKTRYDYGRDGFIK 167
            L   ++D + RY  M G  V    G+D  G+  + +++K+L    K+  Y +G D +  
Sbjct: 59  LLASTVKDIVPRYATMTGHHVERRFGWDTHGLPIEHIIDKKLNITCKEDVYAFGIDNYNN 118

Query: 168 KAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRLHDAGIIYRASRL 227
           +       Y +  +  + RLG   D+  +  T+ P    ++  AF  L D   +YR  ++
Sbjct: 119 ECRAIVSTYAEEWRKTIGRLGRWIDFDDDYKTMYPTFMESIWWAFKELFDKDQVYRGYKV 178

Query: 228 VNWSVKLKTTISNLEVDNKIINGRTLLTVPDYKDKIEFGVLIYIAYPVIDSNTNERIIVA 287
           + +S    T +SN E               +YKD  +    I IA+ VI      +++  
Sbjct: 179 MPYSTGCTTPLSNFEAQQ------------NYKDVNDPA--ITIAFNVI-GQEKTKLVAW 223

Query: 288 TTRPETLFGDVAIAIHPE------------------DSRYKHLHGKFVQHXXXXXXXXXX 329
           TT P TL  ++A+ ++PE                  +S  K L+ K  Q           
Sbjct: 224 TTTPWTLPSNLALCVNPEFEYVKIYDENKDTYFILLESLIKTLYKKPAQEKYKVVEKIKG 283

Query: 330 XDATAV--------------DMTF------------GTGAVKITPAHDQNDYNVGKRHSL 363
            D   +              D  F            GTG V   PA  ++D  V   H +
Sbjct: 284 KDLVGLKYEPLFPYFVDEYKDTGFRVLGDSYVSNDSGTGIVHQAPAFGEDDNRVCLEHGV 343

Query: 364 -----QFVNIFTDDGLLNENCGSSWEGLKRFDARQLVIDELKRKGFFMKQEDNPMIIPLC 418
                   N   D G   +   S + G+   DA + +I +L   G  +         P C
Sbjct: 344 IREDTPAPNPIDDVGKFTKEV-SDFTGMYVKDADKEIIKKLLASGHILLNSQIRHSYPFC 402

Query: 419 SRSGDVIEPLLKHNGGS--HKINGQDSDRYCGKREIRFSSSNTKNDYF-RWLENIQDWCI 475
            RS     PL+     +   ++           ++  +  +  K   F  W+ N +DW +
Sbjct: 403 WRSD---TPLIYRTVPAWFVRVKTIIPQFLESVKKSNWVPTVIKEKRFSNWIANARDWNV 459

Query: 476 SRQLWWGHRCPVYFINVEGSEDSAAINRNDGKYWVAGRNLEEAVHKAA---KKFPNKKFS 532
           SR  +WG   P++    E  E+   I   +    ++G      +H+ +      P+KK  
Sbjct: 460 SRNRYWGTPIPLWV--SEDYEEMVCIGSVEELRELSGVQDITDLHRDSIDNITIPSKKGK 517

Query: 533 --LEQDQDVLDTWFSSALWPFSTLGWP-NKTNDMNLFYPFSMLETGWDILFFWVTRMIML 589
             L + ++V D WF S   P+++  +P   T   +   P + +  G D    W   + +L
Sbjct: 518 GVLRRIEEVFDCWFESGSMPYASQHYPFENTEKFSQRVPANFISEGLDQTRGWFYTLGVL 577

Query: 590 GVKLTGSIPFKEVYCHSLVRDFEGRKMSKSLGNVIDPLDIINGCTLKELHEKLQQGNLDP 649
           G  L G +P++ V    +V   +G+KMSKSL N  DP +I+                   
Sbjct: 578 GTHLFGEVPYRNVIVSGIVLAADGKKMSKSLKNFPDP-NIV------------------- 617

Query: 650 XXXXXXXXXXXXXYPRGIPQCGSDALRFALC-AYTTGGRDINLDISRVEGYRKFCNKI-- 706
                            + + GSDALR  L  +       +     + EG ++  +K+  
Sbjct: 618 -----------------LEKYGSDALRLYLINSPVLKAESLKF---KEEGVKEVVSKVLL 657

Query: 707 --YQATKF-----SIQRLGDDYQPPSSTHTPASKSLVEKWILYQMNNTIAIVNDSFEKRD 759
             + + KF     ++ +   D     + H   S +++++WIL  + + +A ++       
Sbjct: 658 PWWNSFKFLDGQIALLKKNSDVDFKYNPHL-KSDNVMDRWILASLQSLVAYIHQEMSTYK 716

Query: 760 FLTCTSKIYELWYMICDVYIE-NFKWLANDTIMEKAAK--DTLHTLIENGLKMIHPFMPY 816
             T   ++ +    + + YI  N + L  +  +E   K  +TL   +   ++ + PF P+
Sbjct: 717 LYTVVPRLLDFIDELTNWYIRFNRRRLKGEGGVEDCLKALNTLFDALFTFVRAMAPFTPF 776

Query: 817 LSEELWQRLPDGIGKD-------ESSSIMKTLYPTPSEDFNYGKEAKQYDE-ILKIIKSM 868
           LS+ ++ +L   I ++       +S S+    YP  +ED         YDE I K +K M
Sbjct: 777 LSDNIYSKLRPFIPEEVLAQYSKDSRSVHFLSYPEVNEDL--------YDEDIEKAVKRM 828

Query: 869 RSLL 872
           +S++
Sbjct: 829 QSVI 832

>Scas_599.13
          Length = 1071

 Score =  138 bits (347), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 190/856 (22%), Positives = 333/856 (38%), Gaps = 174/856 (20%)

Query: 67  WWDQIGAFKP--EFTKDGKIKAEGLFCIPAPPPNVTGALHLGHALTIAIQDSLIRYYRMK 124
           +W++I AF    E TKD   K E  F     PP  TG  H GH L   I+D + RY  M 
Sbjct: 20  YWNEIDAFHTSLELTKD---KPE--FSFFDGPPFATGTPHYGHILASTIKDIVPRYATMT 74

Query: 125 GKTVLFLPGFDHAGIATQSVVEKQLWKQEKKTRYDYGRDGFIKKAWEWKEKYHKRIKNQL 184
           G  V    G+D  G+  + +++K+L  + K+  + YG D +  +       Y +  +  +
Sbjct: 75  GHHVERRFGWDTHGVPIEHIIDKKLGIKGKEDVFKYGIDNYNNECRSIVMTYAEDWRKTI 134

Query: 185 KRLGASYDWSREAFTLDPKLSTAVKEAFVRLHDAGIIYRASRLVNWSVKLKTTISNLEVD 244
            RLG   D+  +  T+ P    +   AF +L +   +YR  R++ +S  L T +SN E  
Sbjct: 135 GRLGRWIDFDNDYKTMYPSYMESTWWAFKQLFEKQQVYRGYRVMPYSTGLTTPLSNFEAQ 194

Query: 245 NKIINGRTLLTVPDYKDKIEFGVLIYIAYPVIDSNTNERIIVATTRPETLFGDVAIAIHP 304
                        +YKD  +  V   I + VI     + ++  TT P TL  ++A+ ++P
Sbjct: 195 Q------------NYKDVNDPAVT--IGFNVIGQEKTQ-LVAWTTTPWTLPSNMALCVNP 239

Query: 305 E------------------DSRYKHLHGKFVQHXXXXXXXXXXXDATAV----------- 335
           +                  +S  K L+ K               D   +           
Sbjct: 240 DFEYVKIYDEKKDRYYILLESLIKSLYKKPKDEKYKVVEKIKGSDLVGLKYEPLFPYFAE 299

Query: 336 ---DMTF------------GTGAVKITPAHDQNDYNVGKRHSL-----QFVNIFTDDGLL 375
              D  F            GTG V   PA  + DY +  R  +      F N   D G  
Sbjct: 300 EFKDTAFRVISDGYVTSESGTGIVHNAPAFGEEDYTICTREGIVSEGANFPNPLDDLGRF 359

Query: 376 NENCGSSWEGLKRFDARQLVIDELKRKGFFMKQEDNPMIIPLCSRSG------------- 422
                + + G+   DA +L+I  L   G  +         P C RS              
Sbjct: 360 TSEV-TDFAGVYVKDADKLIIKHLTATGNMLYHTQIRHSYPFCWRSDTPLLYRAVPAWFV 418

Query: 423 ---DVIEPLLKHNGGSHKINGQDSDRYCGKREIRFSSSNTKNDYFRWLENIQDWCISRQL 479
              +++  +L+    SH +           +E RF++         W+ N +DW +SR  
Sbjct: 419 RVRNIVPQMLESVEKSHWVPNV-------IKEKRFAN---------WIANARDWNVSRNR 462

Query: 480 WWGHRCPVYFINVEGSEDSAAINRNDGKYWVAGRNLEEAVHKAA---KKFPNK--KFSLE 534
           +WG   P++    +  ++   I   +    ++G    + +H+        P+K  K  L+
Sbjct: 463 YWGTPIPLWV--SDDFKEIVCIGSVEELEKLSGVTGIKDLHRDTIDKLTIPSKQGKGELK 520

Query: 535 QDQDVLDTWFSSALWPFSTLGWP-NKTNDMNLFYPFSMLETGWDILFFWVTRMIMLGVKL 593
           + ++V D WF S   P+++  +P   T   +   P + +  G D    W   + +LG  L
Sbjct: 521 RIEEVFDCWFESGSMPYASQHYPFENTEKFSQRVPANFISEGLDQTRGWFYTLSVLGTHL 580

Query: 594 TGSIPFKEVYCHSLVRDFEGRKMSKSLGNVIDPLDIINGCTLKELHEKLQQGNLDPXXXX 653
            GS+P+K V    +V   +GRKMSKSL N  DP    N   +K   + L+          
Sbjct: 581 FGSVPYKNVIVSGIVLAADGRKMSKSLKNYPDP----NIVLVKYGADALR---------- 626

Query: 654 XXXXXXXXXYPRGIPQCGSDALRFALCAYTTGGRDINLDISRVEGYRKFCNKI----YQA 709
                    Y    P   +++L+F                 + EG ++  +K+    + +
Sbjct: 627 --------LYLINSPVLKAESLKF-----------------KEEGVKEVVSKVLLPWWNS 661

Query: 710 TKF------SIQRLGD---DYQPPSSTHTPASKSLVEKWILYQMNNTIAIVNDSFEKRDF 760
            KF       +++  D    Y P     +  S +++++WIL  M + +  ++        
Sbjct: 662 FKFLDGQIALLKKTSDIDFKYDP-----SLMSDNVMDRWILASMQSLVQFIHQEMGLYKL 716

Query: 761 LTCTSKIYELWYMICDVYIE-NFKWLANDTIMEKAAKDTLHTLIE---NGLKMIHPFMPY 816
            T   ++      + + YI  N + L  +  +E   K  L++L E     ++ + PF P+
Sbjct: 717 YTVVPRLLNFIDELTNWYIRFNRRRLKGENGVEDCLK-ALNSLFEALFTFVRAMAPFTPF 775

Query: 817 LSEELWQRLPDGIGKD 832
           L++ ++ +L + I  D
Sbjct: 776 LADTIYLKLKEYIPAD 791

>Kwal_27.10811
          Length = 1099

 Score =  128 bits (321), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 201/930 (21%), Positives = 353/930 (37%), Gaps = 207/930 (22%)

Query: 58  PEICEKNWYWWDQIGAFKPEFT-KDGKIKAEGLFCIPAPPPNVTGALHLGHALTIAIQDS 116
           P+  EK    W++I AF+      +GK +    F     PP  TG  H GH LT  ++D 
Sbjct: 38  PKEEEKILDLWNEIDAFQTSLKLTEGKPE----FSFFDGPPFATGTPHYGHILTSTVKDV 93

Query: 117 LIRYYRMKGKTVLFLPGFDHAGIATQSVVEKQLWKQEKKTRYDYGRDGFIKKAWEWKEKY 176
           + RY  M G  V    G+D  G+  + +++K+L    K+  Y  G D +  +       Y
Sbjct: 94  VPRYASMNGFHVERRFGWDTHGLPIEHIIDKKLGITCKEDVYKMGIDKYNDECRAIVMMY 153

Query: 177 HKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRLHDAGIIYRASRLVNWSVKLKT 236
            +  +  + R+G   D+  +  T+ P    +   AF +L + G +YR  +++ +S    T
Sbjct: 154 AEEWRKTIGRMGRWIDFDNDYKTMYPSFMESTWWAFKQLFEKGQVYRGYKVMPYSTGCTT 213

Query: 237 TISNLEVDNKIINGRTLLTVPDYKDKIEFGVLIYIAYPVIDSNTNERIIVATTRPETLFG 296
            +SN E               +YKD  +  V     + VI  + N  ++V TT P T+  
Sbjct: 214 PLSNFEAQQ------------NYKDVSDPAVT--WGFRVIGMD-NTYLVVWTTTPWTIPS 258

Query: 297 DVAIAIHPE--------DSRYKH-------------------------LHGKFVQHXXXX 323
           ++A+ ++ E        ++R KH                         + GK +      
Sbjct: 259 NLAVCVNAEFEYVKIYDETRDKHFIILESLIKTLYKKPEKEKYKVVEKIMGKDLVGLKYE 318

Query: 324 XXXXXXXDA-----------TAVDMTFGTGAVKITPAHDQNDYNVGKRHSLQFVNIFTDD 372
                  +A           + V    GTG V   PA  + DY V  +H +    I  DD
Sbjct: 319 PVYPYYKEAYKDKAFRVIEDSYVTSDSGTGLVSNAPAFGEEDYKVCLQHGI----ISEDD 374

Query: 373 GLLN--ENCG------SSWEGLKRFDARQLVIDELKRKGFFMKQEDNPMIIPLCSRSGD- 423
            L N  ++ G      + + G    DA + +I +L   G  +         P C RS   
Sbjct: 375 ELPNPVDDAGKFTLPVTDYLGQYVKDADKQIIKDLTANGTMLANTQFRHSYPFCWRSDTP 434

Query: 424 ---------------VIEPLLKHNGGSHKINGQDSDRYCGKREIRFSSSNTKNDYFRWLE 468
                          +I   L     SH +           +E RFS+         W+ 
Sbjct: 435 LLYRSVPAWFVRVKPIIPKFLDSVQKSHWVPNV-------IKEKRFSN---------WIA 478

Query: 469 NIQDWCISRQLWWGHRCPVYFINVEGSEDSAAINRNDGKYWVAGRNLEEAVHKAA---KK 525
           N +DW +SR  +WG   P++    +  E+   +        ++G    E +H+ +     
Sbjct: 479 NARDWNVSRNRYWGTPIPIWV--SDDYEEVVCVGSVQELKDLSGVQTIEDLHRDSIDGIT 536

Query: 526 FPNKKFS--LEQDQDVLDTWFSSALWPFSTLGWPNKTND-MNLFYPFSMLETGWDILFFW 582
            P+KK    L++ ++V D WF S   P+S+  +P +  D      P + +  G D    W
Sbjct: 537 IPSKKGKGVLKRIEEVFDCWFESGSMPYSSQHYPFENQDKFKERVPANFISEGLDQTRGW 596

Query: 583 VTRMIMLGVKLTGSIPFKEVYCHSLVRDFEGRKMSKSLGNVIDPLDIINGCTLKELHEKL 642
              + +LG +L G +P++ V    +V   +G+KMSKSL N  DP  +++           
Sbjct: 597 FYTLGVLGSQLFGQVPYQNVIVCGIVLAADGKKMSKSLKNYPDPNLVLD----------- 645

Query: 643 QQGNLDPXXXXXXXXXXXXXYPRGIPQCGSDALRFALCAYTTGGRDINLDISRVE----- 697
                                     + G+DALR  L         IN  + + E     
Sbjct: 646 --------------------------KYGADALRLYL---------INSPVLKAESLKFK 670

Query: 698 --GYRKFCNKI----YQATKF---------SIQRLGDDYQPPSSTHTPASKSLVEKWILY 742
             G ++  +K+    + + KF             +   Y P     T  S +++++WIL 
Sbjct: 671 EDGVKEVVSKVLLPWWNSFKFLDGQISLLKKTSNIDFKYDP-----TIKSDNVMDRWILA 725

Query: 743 QMNNTIAIVNDSFEKRDFLTCTSKIYELWYMICDVYIENFKWLANDTIMEKAAKDTLHTL 802
            +   +  ++   +         ++ +    + + YI   +        E+   + L++L
Sbjct: 726 SLQTLVKNIHAEMKSYKLYAVVPRLLDFIDQLTNWYIRLNRRRLKGENGEQDCLNALNSL 785

Query: 803 IENGLKMI---HPFMPYLSEELWQRLPDGIGKD-------ESSSIMKTLYPTPSEDFNYG 852
            +     +    PF P+LS+ ++QR+ + I ++       +S S+    YP   E     
Sbjct: 786 FDALFTFVCAMAPFTPFLSDNIYQRMKEYIPENVLSTFGPDSRSVHFLSYPVVDE----- 840

Query: 853 KEAKQYDEILKIIKSMRSLLSEYNITANAR 882
              K +DE  KI  SM  + S  ++  N R
Sbjct: 841 ---KLFDE--KIEGSMARMQSVIDLGRNIR 865

>CAGL0L12606g 1353211..1356159 similar to sp|P48526 Saccharomyces
           cerevisiae YPL040c isoleucine--tRNA ligase,
           mitochondrial, hypothetical start
          Length = 982

 Score =  124 bits (310), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 205/916 (22%), Positives = 353/916 (38%), Gaps = 160/916 (17%)

Query: 49  NSIELKAYDPEICEKNWYWWDQIGAFKPEFT----KDGKIKA--EGLFCIPAPPPNVTGA 102
           NS+EL      +C    Y  +Q+  FK E      +D K+ A  E LF +   PP   G 
Sbjct: 33  NSLELLP----LCSDRVYT-EQLERFKRELGAVEGEDEKLAAVRERLFVLHDGPPYANGD 87

Query: 103 LHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVEKQLWKQEK----KTRY 158
           LHLGHAL   ++D + R+   +GKTV + PG+D  G+  +    K L   +K    K R 
Sbjct: 88  LHLGHALNKILKDFVNRFQLSQGKTVYYRPGWDCHGLPIEMKALKDLRDADKMDSVKVR- 146

Query: 159 DYGRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRLHDA 218
           +  R   ++           + ++Q K+ G   DWS    T+D        + F ++ + 
Sbjct: 147 ELARQHALRSL--------DKQRDQFKKYGILTDWSDPYVTMDKSFEVNQLKVFQKMFNM 198

Query: 219 GIIYRASRLVNWSVKLKTTI--SNLEVDNKIINGRTLLTVPDYKDKIEFGVLIYIAYPVI 276
           G+I R ++ V W    KT +  S LE + K ++    +  P   D       +     + 
Sbjct: 199 GLIKRQNKPVYWGTVTKTALAESELEYNEKHVSTAAYVKFPLTADS---RAHLQDKLKLE 255

Query: 277 DSNTNERI--IVATTRPETLFGDVAIAIHPEDSRYK--HLHGKFVQHXXXXXXXXXXXDA 332
           +   N++I  ++ T+ P TLF + AI  + E+  Y    L G +V               
Sbjct: 256 NELQNDQISCLIWTSTPWTLFSNRAICFN-ENFSYSLLQLDGSYVIVENNLINQLGSDHK 314

Query: 333 TAVDMTF---------------------------------GTGAVKITPAHDQNDYNVGK 359
             +  TF                                 GTG V   P H  +DY +G 
Sbjct: 315 GEILKTFEGKLLKGLFYYNPLVSDIVARPLIHGDHVTDNAGTGLVHTAPGHGHDDYFLGI 374

Query: 360 RHSLQFVNIFTDDG--LLNE---NC------GSSWEGLKRFDAR--QLVIDELKRKGFFM 406
            + L+  +    +G  +LNE   NC      G +  G K  D+    +++D L +K   +
Sbjct: 375 ENDLEIYSPVDHEGRYILNELPDNCKELLMEGGTGLGRKVLDSETTTVILDLLSKKQALL 434

Query: 407 KQEDNPMIIPLCSRSGDVIEPLLKHNGGSHKINGQDSDRYCGK--REIRFSSSNTKNDYF 464
           K        P   R+     P++         +  D      K   ++ F     +N   
Sbjct: 435 KAHKYTHSYPYDWRAK---TPVIIRATPQWFADLHDVKDLAIKSLEKVEFYPKRGENRLS 491

Query: 465 RWLENIQDWCISRQLWWGHRCPVYFINVEGSEDSAAINRNDGKYWVA-----GRNL---- 515
            ++++  +WCISRQ  WG   PV+  + + + D   IN    +Y +      G +L    
Sbjct: 492 SFIKSRNEWCISRQRSWGVPIPVF--HNKSNPDKVLINDELLEYIITRISKHGSDLWFSP 549

Query: 516 EEAVHKAAKKFPNKKFSLEQD----QDVLDTWF-SSALWPF------STLGWPNKTNDM- 563
           E+ +   +  FP    ++ +D     D +D WF S + W          LG       + 
Sbjct: 550 EDDI---SDWFPENYRTMAKDFIKGTDTMDVWFDSGSTWNIIREFYQKELGLSTVPQPLA 606

Query: 564 NLFYPFSMLETGWDILFFWVTRMIMLGVKLTGSIPFKEVYCHSLVRDFEGRKMSKSLGNV 623
           N++   S    GW    F  + +  +   ++   P+ EV  H    D +G KMSKS+GN 
Sbjct: 607 NVYLEGSDQHRGW----FQSSLLTKVACSMSEIAPYNEVITHGFTLDEKGIKMSKSIGNT 662

Query: 624 IDPLDIINGCTLKELHEKLQQGNLDPXXXXXXXXXXXXXYPRGIPQCGSDALRF--ALCA 681
           I P  II G                                R +P  G D LR+  A   
Sbjct: 663 ISPESIIEG-----------------------------DKKRNLPALGIDGLRYFVAQAD 693

Query: 682 YTTGGRDINLDISRVEGYRKFCNKIYQATKFSIQRLGDDYQPPSSTHTPASKSLVEKWIL 741
           +TT   D+ +  + ++   +   K     +F I  L  +     S    +    V+K++L
Sbjct: 694 FTT---DVTVGPTVLKHVAEALKKCRLTMRFLISNL--EISKRYSLLNTSELRPVDKYVL 748

Query: 742 YQMNNTIAIVNDSFEKRDFLTCTSKIY-----ELWYMICDVYIENFKWLANDTIMEKAAK 796
             +N  +    + ++  +F      +      EL     D+  ++    + +++  +  +
Sbjct: 749 ASVNKLLEETKELYKVHNFSKALVALQFHMNNELSSFYFDISKDSLYSDSIESLKRRQIQ 808

Query: 797 DTLHTLIENGLKMIHPFMPYLSEELWQRLPDG-IGKDESSSIMKTLYPTPSE-DFNYGKE 854
            TL  + +    M+ P +P L +E W  LP   +  D  +  +   +P+ +E +     E
Sbjct: 809 TTLFHIYDAYRAMLAPILPILVQESWNFLPKQWLNGDNEAEAVTRKWPSLTEINPEVVNE 868

Query: 855 AKQYDEILKIIKSMRS 870
            KQ   IL ++K  +S
Sbjct: 869 FKQV--ILPLVKEYKS 882

>YPL040C (ISM1) [5399] chr16 complement(475988..478996)
           Isoleucyl-tRNA synthetase, mitochondrial [3009 bp, 1002
           aa]
          Length = 1002

 Score =  116 bits (290), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 188/871 (21%), Positives = 318/871 (36%), Gaps = 187/871 (21%)

Query: 69  DQIGAFKPEFTK----DGKIK--AEGLFCIPAPPPNVTGALHLGHALTIAIQDSLIRYYR 122
           +Q+  F  EF+K    D K++   E LF +   PP   G LHLGHAL   ++D + RY  
Sbjct: 60  EQLRDFFEEFSKLNTTDEKLEFIKEKLFILHDGPPYANGELHLGHALNKILKDIINRYQL 119

Query: 123 MKGKTVLFLPGFDHAGIATQSVVEKQLWKQEKKTRYDYG-RDGFIKKAWEWKEKYHKRIK 181
            +GK + + PG+D  G+  +    K L  Q+ ++      R   +K A    +K  KR +
Sbjct: 120 SQGKYIFYKPGWDCHGLPIEIKALKDLSAQQIESISPLKIRSMALKHA----QKAIKRQR 175

Query: 182 NQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRLHDAGIIYRASRLVNWSVKLKTTISNL 241
              +      DW     T+D          F  +++ G+I R ++ V W  + +T ++  
Sbjct: 176 ETFQHFAILTDWETPYLTMDKDYEINQLNIFKEMYERGLIKRQNKPVYWGTETRTALAEG 235

Query: 242 EVDNKIINGRTLLTVPDYKDKIEFGVLIYIAYPV-------------IDSNTNERIIVAT 288
           E+              +Y +  +  +  Y+ +P+             I +N     ++ T
Sbjct: 236 EL--------------EYNENHK-SIAAYVKFPLEKKSQMDLCKKLGITNNLPIYCLIWT 280

Query: 289 TRPETLFGDVAIAIHPEDSRYK-----------------------------------HLH 313
           + P TL  + AI  + +D  Y                                    HL+
Sbjct: 281 STPWTLLSNRAICFN-QDFSYSLLRLNSELILVETGSIDKLGLTTNSFETIKQFQGTHLN 339

Query: 314 GKFVQHXXXXXXXXX-XXDATAVDMTFGTGAVKITPAHDQNDYNVGKRHSLQFVNIFTDD 372
           G + Q+                V    GTG V   P H Q+DY +G ++ L+  +     
Sbjct: 340 GLYYQNLLVDDKVGRPLLHGAHVTSGTGTGLVHTAPGHGQDDYLIGIQNGLEIYSPVDHQ 399

Query: 373 G--LLNE----------NCGSSWEGLKRFDAR--QLVIDELKRKGFFMKQEDNPMIIPLC 418
           G   LNE          + G   +G +  DA   ++++ +L       K  +     P  
Sbjct: 400 GRYQLNELPQSVRSIVRDEGDLTKGRQVLDAETAKIILCKLSDLNLLYKSHEYTHSYPYD 459

Query: 419 SRSGD--VIEPLLK-----HNGGSHKINGQDSDRYCGKREIRFSSSNTKNDYFRWLENIQ 471
            RS    +I    +     H+  +  +      ++C KR     SS        ++++  
Sbjct: 460 WRSKKPVIIRATPQWFADLHDVKNLALESISRVKFCPKRGYSRLSS--------FMKSRN 511

Query: 472 DWCISRQLWWGHRCPVYFINVEGSEDSAAINR-----------------------NDGKY 508
           +WCISRQ  WG   P+     +   DS  +N                        ND K 
Sbjct: 512 EWCISRQRSWG--IPILSFYKKSEPDSVLMNSEILAHAIEKIKQKGINAWFNDKDNDMKE 569

Query: 509 WVAGRNLEEAVHKAAKKFPNKKFSLEQDQDVLDTWF-SSALWPFSTLGWPNKTNDMNLFY 567
           W     L E  H  A ++        + QD +D WF S + W      +        L  
Sbjct: 570 W-----LPEKYHDVAHEYC-------RSQDTMDVWFDSGSSWSVIKDFYEKSLKLSKLPS 617

Query: 568 P-FSMLETGWDILFFWVTRMIMLGVKLTG--SIPFKEVYCHSLVRDFEGRKMSKSLGNVI 624
           P + +   G D    W    ++  V  +     P++EV  H    D  G KMSKS+GN I
Sbjct: 618 PLYQVCLEGSDQHRGWFQSSLLTKVASSNVPVAPYEEVITHGFTLDENGLKMSKSVGNTI 677

Query: 625 DPLDIINGCTLKELHEKLQQGNLDPXXXXXXXXXXXXXYPRGIPQCGSDALRFALCAYTT 684
            P  II G             NL                  G+P  G D LR     Y  
Sbjct: 678 SPEAIIRG-----------DENL------------------GLPALGVDGLR-----YLI 703

Query: 685 GGRDINLDISRVEGYRKFCNKIYQATKFSIQRLGDDYQPPSSTHTPASKSL--VEKWILY 742
              +   DI       K   +  +  + + + L  + Q     +    + L  V+++ LY
Sbjct: 704 AQSNFTTDIVAGPTVMKHVGEALKKVRLTFRYLLSNLQKSQDFNLLPIEQLRRVDQYTLY 763

Query: 743 QMNNTIAIVNDSFEKRDFLTCTSKI-YELWYMICDVYIENFK-WLANDTIMEKAAKDTLH 800
           ++N  +    + ++K +F      + Y L   +   Y +  K  L ++ I   A +    
Sbjct: 764 KINELLETTREHYQKYNFSKVLITLQYHLNNELSAFYFDISKDILYSNQISSLARRQVQT 823

Query: 801 TLIE--NGLKMI-HPFMPYLSEELWQRLPDG 828
           TL+   N  + I  P +P + +E+W+ +P+G
Sbjct: 824 TLVHILNAYRAILAPILPVMVQEVWKYIPEG 854

>KLLA0D11858g complement(1010259..1013231) similar to sp|P48526
           Saccharomyces cerevisiae YPL040c ISM1 isoleucine--tRNA
           ligase, mitochondrial, start by similarity
          Length = 990

 Score =  114 bits (284), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 173/846 (20%), Positives = 307/846 (36%), Gaps = 155/846 (18%)

Query: 87  EGLFCIPAPPPNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVE 146
           E +F +   PP   G LHLGHAL   ++D + R+  + GK V+++PG+D  G+  +    
Sbjct: 77  ENVFILHDGPPYANGDLHLGHALNKILKDIINRFQLLNGKHVVYIPGWDCHGLPIELKAL 136

Query: 147 KQLWKQEKKTRYDYGRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLST 206
            +L   ++  R    +   I +A    +K  K  + Q ++ G   +W     T+DPK   
Sbjct: 137 NKL--NDQLDRISPTKIRSIARAH--AQKTIKSQRQQFEQFGILTNWDTNYVTMDPKFEI 192

Query: 207 AVKEAFVRLHDAGIIYRASRLVNWSVKLKTTISNLEVDNKIINGRTLLTVPDYKDKIEFG 266
                F  L    +I R  + V W  + KT ++  E++ K             +D I   
Sbjct: 193 NQLSVFQELFRKKLIKRQRKPVYWGTETKTALAEGELEYK-------------EDHISIA 239

Query: 267 VLIYIAYPVIDSNTNE--------RIIVATTRPETLFGDVAIAIH--------PEDSRY- 309
              Y+ +P+ + + +           ++ T+ P TL  + AI  +          +  Y 
Sbjct: 240 A--YVKFPLTEESKSVLGFPEAPVSFLIWTSTPWTLLSNRAICFNQSLDYVLIKHNGEYM 297

Query: 310 -------------------KHLHGKFVQHXXXXX------XXXXXXDATAVDMTFGTGAV 344
                              K L G F+ H                     V    GTG V
Sbjct: 298 IVEKNLADKLDFLSGFELVKDLDGNFLSHLKYTNPILKDNVTRPLFHGDHVTSVTGTGLV 357

Query: 345 KITPAHDQNDYNVGKRHSLQFVNIFTDDG-------------LLNENCGSSWEGLKRFDA 391
              P H   DY +G ++ L+  +    +G             LL E  G   + L R   
Sbjct: 358 HTAPGHGHEDYIIGIQNFLEIFSPVDHEGRYNVEELPAHLRDLLKEESGKGRKVLDRTTT 417

Query: 392 RQLVIDELKRKGFFMKQEDNPMIIPLCSRSGDVIEPLL----------KHNGGSHKINGQ 441
            + ++  LK +   M   +     P   RS    +P++           H+  +  +   
Sbjct: 418 EK-ILSVLKGENMLMHHHEYVHSYPYDWRSK---KPIIIRATPQWFADLHDVKTLALRAL 473

Query: 442 DSDRYCGKREIRFSSSNTKNDYFRWLENIQDWCISRQLWWGHRCPVYFINVEGSEDSAAI 501
           ++ ++  +R I   SS        +++   +WCISRQ +WG   P+  ++     DS  +
Sbjct: 474 ETVKFVPERGINRLSS--------FIKTRNEWCISRQRYWG--VPIPSLHKRDDPDSVLM 523

Query: 502 NRNDGKY------------WVAGRNLEEAVHKAAKKFPNKKFSLEQDQDVLDTWFSSALW 549
           N     +            W A   ++       KK+ +      +  D +D WF S   
Sbjct: 524 NEETISHIIKTIESKGVNSWFAESTVDSMYQWLPKKYHDIAHEYYRGTDTVDVWFDSGSS 583

Query: 550 PFSTLGWPNKTNDMNLFYPFSMLET---GWDILFFWVTRMIMLGVKLTG--SIPFKEVYC 604
                 W      +    P  + +    G D    W    ++  V  +G    P+K V  
Sbjct: 584 WNVIADWYKNVAGLQSQLPVPLADIYLEGSDQHRGWFQSSLLTKVASSGMPDAPYKNVIT 643

Query: 605 HSLVRDFEGRKMSKSLGNVIDPLDIINGCTLKELHEKLQQGNLDPXXXXXXXXXXXXXYP 664
           H    D  G KMSKS+GN I P  II G               DP               
Sbjct: 644 HGFTLDENGIKMSKSIGNTISPGAIIKG---------------DPKA------------- 675

Query: 665 RGIPQCGSDALRFALCAYTTGGRDINLDISRVEGYRKFCNKIYQATKFSIQRLGDDYQPP 724
             +P  G D LR  L A +    D+    + ++       K     KF    LG+  +  
Sbjct: 676 -NLPALGVDGLRL-LVAQSNFTSDVVAGPTVMKHVADALKKFRLTFKFI---LGNLQETQ 730

Query: 725 SSTHTPASK-SLVEKWILYQMNNTIAIVNDSFEKRDFLTCTSKI-YELWYMICDVYIENF 782
           S    P S+   V+++ L  +          +++ +F    +++ Y +   +  +Y    
Sbjct: 731 SHGLIPFSELRRVDQYTLLNLKALSQETKKLYQQYNFSNVLTQVQYHMNNDLSALYFSVT 790

Query: 783 K-WLANDTIMEK---AAKDTLHTLIENGLKMIHPFMPYLSEELWQRLP-DGIGKDESSSI 837
           K  L +D++  K   + + TL  +++    ++ P +P + +E+W   P + I ++ S  +
Sbjct: 791 KDSLYSDSLNNKKRLSIQTTLFHILDTYRSIMSPIIPIMVQEVWNYTPKEWINENSSEGV 850

Query: 838 MKTLYP 843
            +   P
Sbjct: 851 AEIETP 856

>Scas_568.3
          Length = 1001

 Score =  113 bits (283), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 178/826 (21%), Positives = 315/826 (38%), Gaps = 127/826 (15%)

Query: 83  KIKAEGLFCIPAPPPNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQ 142
           K   E LF +   PP   G LHLGHAL   ++D ++RY    GK V + PG+D  G+  +
Sbjct: 75  KFIRENLFILHDGPPYANGDLHLGHALNKILKDIIVRYQYSSGKYVFYKPGWDCHGLPIE 134

Query: 143 SVVEKQLWKQEKKTRYDYGRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDP 202
             V K L K++ +T          +K       + ++   Q  +     DW+    T+D 
Sbjct: 135 LKVLKSLPKKDIETISPEKIRSMARKHALTAIDHQRK---QFHQFAIFTDWNDPYITMDK 191

Query: 203 KLSTAVKEAFVRLHDAGIIYRASRLVNWSVKLKTTISNLEVDNKIINGRTLLTVPDYKDK 262
           K      + F +++  G+I R ++ V W  + KT ++  E++    +  T   V     K
Sbjct: 192 KFEIDQLKIFQKMYHEGLILRQNKPVFWGTETKTALAESELEYNKSHESTSAYVKFPLTK 251

Query: 263 IEFGVLIYIAYPVIDSNTNERIIVATTRPETLFGDVAIAIH------------------- 303
                LI     V D+      ++ T+ P TLF + AI  +                   
Sbjct: 252 QSSLQLIENLNIVQDTPVTISCLIWTSTPWTLFSNRAICFNQNFSYSLVKLVDNNNEFIL 311

Query: 304 -----------PEDSRYKHLHGKFVQHXXXXXXXXXXXD------ATAVDMTFGTGAVKI 346
                      P     K   G+ + +           +       T V    GTG V  
Sbjct: 312 VESNLLIQLNIPNYDIVKTFSGELLTNLKYENPLFSEEEPLPLLHGTHVTNDTGTGLVHT 371

Query: 347 TPAHDQNDYNVGKRHSLQFVNIFTDDGL--LNENCGSSWEGLKRFDA------------- 391
            P H  +DY VG R++L   +    +G   L+E   S+ + L   DA             
Sbjct: 372 APGHGPDDYLVGIRNNLPIYSPVDHEGRYNLSELPSSTHKLLTDPDAPGNTGRYVLDPKT 431

Query: 392 RQLVIDELKRKGFFMKQEDNPMIIPLCSRSGDVIEPLLKHNGGSHKINGQDSDRYCGKR- 450
             ++I++LK      + +      P   RS    +P++        +N     +   +  
Sbjct: 432 TLIIIEKLKELNMLFRSKKYTHSYPYDWRSK---KPVIIRATPQWFLNLAKMKQLAVESL 488

Query: 451 --EIRFSSSNTKNDYFRWLENIQDWCISRQLWWGHRCPVYFINVEGSEDS---------- 498
             ++ F     K     +++N  +WCISRQ  WG   P ++  +E S++           
Sbjct: 489 NDKVNFFPERGKTRLLSFIKNRNEWCISRQRAWGVPIPAFY-RIENSDEVLMNEEIINHV 547

Query: 499 -AAINRNDGKYWV--AGRNLEEAVHKAAKKFPNKKFSLEQDQDVLDTWF-SSALWPFSTL 554
              I  N    W        EE + ++ K   N      +  D +D WF S + W     
Sbjct: 548 IKTIESNGIDKWFDQYSSPTEEWLPESYK---NVAHEYRRGTDTMDVWFDSGSSWKVIES 604

Query: 555 GWPNKTNDMN---LFYP-FSMLETGWDILFFWVTRMIMLGVKLT--GSIPFKEVYCHSLV 608
            + +     N   L  P F +   G D    W   +++  V  +     P++ +  H   
Sbjct: 605 FYHDTLKIRNGSVLPSPLFDVALEGSDQHRGWFQSLLLTKVAYSKVAEAPYRNIITHGFT 664

Query: 609 RDFEGRKMSKSLGNVIDPLDIINGCTLKELHEKLQQGNLDPXXXXXXXXXXXXXYPRGIP 668
            D +G KMSKS+GN I P D+I G               +P               RG+ 
Sbjct: 665 LDEKGIKMSKSIGNTISPTDVIQG---------------NPA--------------RGLI 695

Query: 669 QCGSDALRFALCAYTTGGRDINLDISRVEGYRKFCNKIYQATKFSIQRLGDDYQPPSSTH 728
             G D LR+ + A++   +D+ +  + ++   +   KI    +F +  L       S T 
Sbjct: 696 PLGIDGLRYYV-AHSNFTKDLVVGANIMKRVSESLKKIRITFRFLLSNLEK-----SGTF 749

Query: 729 TP-ASKSL--VEKWILYQMNNTIAIVNDSFEKRDFLTCTSKI-YELWYMICDVYIENFK- 783
            P A + L  V+++I+  +   +A   +S++  +F    + + + L   +   Y ++ K 
Sbjct: 750 EPLAVEELRPVDQYIISTLQKLLAESKESYQSYNFSKILTTLQHHLSSELSAFYFDSSKD 809

Query: 784 WLANDTIME---KAAKDTLHTLIENGLKMIHPFMPYLSEELWQRLP 826
            L +D+I     K  +  L  +++    +++P +P L +E+   +P
Sbjct: 810 SLYSDSITSEKRKQIQTVLLYVLQTYSTILNPILPTLIQEVRNYIP 855

>AGL247C [4065] [Homologous to ScYPL040C (ISM1) - SH]
           (237045..240011) [2967 bp, 988 aa]
          Length = 988

 Score =  113 bits (282), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 181/876 (20%), Positives = 312/876 (35%), Gaps = 178/876 (20%)

Query: 76  PEFTKDGKIKAEGLFCIPAPPPNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFD 135
           P+ T       + +F +   PP   G LH+GHA+   ++D + RY   KG+ V + PG+D
Sbjct: 61  PDDTDKANFVRDRVFVLHDGPPYANGDLHVGHAMNKILKDIMSRYQLTKGRYVFYRPGWD 120

Query: 136 HAGIATQSVVEKQLWKQEKKTRYDYGRDGFIKK-----AWEWKEKYHKRIKNQLKRLGAS 190
             G+  +    + L         DY       +     A +  E      + Q ++ G  
Sbjct: 121 CHGLPIELKALRSL---------DYDTAAISPQQVRAMAAQHAEGAIAAQRKQFQQFGIL 171

Query: 191 YDWSREAFTLDPKLSTAVKEAFVRLHDAGIIYRASRLVNWSVKLKTTISNLEVDNKIING 250
            DW     T+DP            +   G+I R  + V W  + +T ++  E++      
Sbjct: 172 TDWQDTYRTMDPGYEIQQLRLLQGIFARGLIRRQRKPVYWGTETRTALAEGELE------ 225

Query: 251 RTLLTVPDYKDKIEFGVLIYIAYPVID---SNTNERI-----------IVATTRPETLFG 296
                   Y+D        Y+ +P+ +   +   ER+           ++ T+ P TL  
Sbjct: 226 --------YRDD-HISKAAYVYFPLTEGASATLRERLGTSLPEQPIVCLIWTSTPWTLLS 276

Query: 297 DVAIAIHPEDSRYKHLHGK---FVQHXXXXXXXXXXXDATAVDMTF-------------- 339
           + AI  H +D  Y  L  K    V             D   V  +F              
Sbjct: 277 NRAICFH-DDHAYLLLQWKGMLVVAERTELADFKWSGDTPVVVTSFRGSDLRGLYYTNPL 335

Query: 340 -------------------GTGAVKITPAHDQNDYNVGKRHSLQFVNIFTDDG--LLNEN 378
                              GTG V   P H Q DY VG+ H ++  +    +G  +L++ 
Sbjct: 336 LGDAVSRPLLHGDHVTADTGTGLVHTAPGHGQEDYLVGQAHGIEVYSPVDHEGRYILDDI 395

Query: 379 CGSSWEGLKRFDARQLVIDELKRKGFFMKQ-EDNPMII---------PLCSRSGDVIEPL 428
                + L+    + L + + K  G  +K  E++ M++         P   RS    +P+
Sbjct: 396 PPHLRDMLREESGKPLKVTDQKTAGVIIKLLEEHKMLLHSHEYTHSYPYDWRSK---KPV 452

Query: 429 LKHNGGSHKINGQDSDRYCGK--REIRFSSSNTKNDYFRWLENIQDWCISRQLWWGHRCP 486
           +         +  D   +  +    + F  +  K     ++++  +WCISRQ  WG   P
Sbjct: 453 ILRATPQWFADLSDMKHHAVESLENVEFFPARGKKRLEAFIKSRNEWCISRQRSWG--VP 510

Query: 487 VYFINVEGSEDSAAINRNDGKY------------WVAGRNLEEAVHKAAKKFPNKKFSLE 534
           +  +++  + D   +N     +            W    N E       +K+ +      
Sbjct: 511 IPALHLRSNPDEVLLNNETLAHIIETISKVGINSWFEESNAENMKQWLPEKYHDVAHLYY 570

Query: 535 QDQDVLDTWFSSAL-------WPFSTLGWPNKTNDMNLFYPFSMLETGWDILFFWVTRMI 587
           + +D +D WF S         W   TLG       +   Y    LE G D    W    +
Sbjct: 571 RGRDTIDVWFDSGSSWNLLEKWYTETLGLKKPLQPLADVY----LE-GSDQHRGWFQSSL 625

Query: 588 MLGVKLTGSI--PFKEVYCHSLVRDFEGRKMSKSLGNVIDPLDIINGCTLKELHEKLQQG 645
           +  V  +G++  PF ++  H    D  G KMSKSLGN I P  II G       +KLQ  
Sbjct: 626 LTKVAASGTVGAPFGKIVTHGFTLDEAGLKMSKSLGNTIAPSSIIEG------DQKLQ-- 677

Query: 646 NLDPXXXXXXXXXXXXXYPRGIPQCGSDALRFALCAYTTGGRDINLDISRVEGYRKFCNK 705
                                +P+ G D LR  L A     +D+               K
Sbjct: 678 ---------------------LPRLGVDGLRL-LVAQADFTKDVAFGPLIARHVADSLKK 715

Query: 706 IYQATKFSIQRLGDDYQPPSSTHTPASKSL----------VEKWILYQMNNTIAIVNDSF 755
           +    +F +  L D    PS        SL          ++ +IL +     A     +
Sbjct: 716 VRLTFRFILGNLQD---CPSVASAGEQASLAPGDCAQLRRIDWYILDKTQKLTAKCQGLY 772

Query: 756 EKRDFLTCTSKIYELWYMICDVYIENFKWLANDTIMEK-------AAKDTLHTLIENGLK 808
           E +++    S +  L++M  D+ +  F    +   ME        A + TL  +++    
Sbjct: 773 ESQNYSNVISLV--LYHMSNDLSL-YFDASKDTLYMEPPHNKRRLAIQTTLFHILDAYRS 829

Query: 809 MIHPFMPYLSEELWQRLPDGIGKDESSSIMKTLYPT 844
           ++ P MP L +E W  LP    + +++  ++  +P 
Sbjct: 830 ILGPIMPALVQEAWNCLPREWLRGDTTPALRRPWPA 865

>Kwal_27.11827
          Length = 985

 Score = 96.3 bits (238), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 163/824 (19%), Positives = 299/824 (36%), Gaps = 149/824 (18%)

Query: 89  LFCIPAPPPNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVEKQ 148
           LF +   PP   G LHLGHA+   ++D + RY  ++GK + + PG+D  G+  +    ++
Sbjct: 74  LFVLHDGPPYANGDLHLGHAMNKMLKDIINRYQLLQGKFIFYKPGWDCHGLPIELKALQK 133

Query: 149 LWKQEKKTRYDYGRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLSTAV 208
           L K E +      R    K A +  +K  K   +Q K+   + DW     T+  +     
Sbjct: 134 LNKDESELFPTRIR----KLASQHAQKTIKSQASQFKQFAIATDWDDCYETMQQQFEFDQ 189

Query: 209 KEAFVRLHDAGIIYRASRLVNWSVKLKTTISNLEVDNKIINGRTLLTVPDYKDKIEFGVL 268
            +    +   G+I R ++ V W  + KT ++  E+              +Y+D  E  + 
Sbjct: 190 LDNLKIMIQKGLIKRQNKPVYWGTETKTALAEGEL--------------EYRDDHE-SMS 234

Query: 269 IYIAYPVIDSNTNE-------------RIIVATTRPETLFGDVAIAIHPE-DSRYKHLHG 314
            +I +P+ + ++                + + T+ P T+F + A+  +   D     L+ 
Sbjct: 235 AFIKFPLTEESSRVVAEWNKLRLDSPISLAIWTSTPWTIFANQAVCFNESFDYGLYELNN 294

Query: 315 KFVQHXXXXXXXXXXXDATAV---------DMTF----------------------GTGA 343
           ++V              A  +         D+ +                      GTG 
Sbjct: 295 EYVVLESGLGSKVLPDIARLIATIPGTKLKDLKYYIPFLNKSPKPLIHGDHVTNISGTGL 354

Query: 344 VKITPAHDQNDYNVGKRHSLQFVNIFTDDG--------------LLNENCGSSWEGLKRF 389
           V   P H  +DY +G ++ L   +   D+G              L+    G + + L   
Sbjct: 355 VHTAPGHGHDDYLIGVKNGLNIYSPVDDEGRYKTDMMPSHLREILIEPETGKARKVLSEA 414

Query: 390 DARQLVIDELKRKGFFMKQEDNPMIIPLCSRSGDVIEPLLKHNGGSHKINGQDSDRYC-- 447
              Q ++  L+     ++ E      P   RS    +P++  +      +  D       
Sbjct: 415 TTSQ-ILTMLQNHQMLLRAEKYIHSYPYDWRSK---KPVIVRSTPQWFADLTDVKSLALE 470

Query: 448 GKREIRFSSSNTKNDYFRWLENIQDWCISRQLWWGHRCPVYFINVEGSEDS--------- 498
             + + F      N    ++++  +WCISRQ  WG   P  F  V  SE+          
Sbjct: 471 SLKNVTFHPERGLNRLTSFIKSRNEWCISRQRSWGVPIPA-FHKVGKSEEVLMSEEVAKY 529

Query: 499 --AAINRNDGKYWVAGRNLEEAVHKAAKKFPNKKFSLEQDQDVLDTWF-SSALWPF---- 551
             +AI R     W    N  +        + ++     + +D +D WF S + W      
Sbjct: 530 AISAIKRKGIDAWFKEDN-SDINEWLPPSYQDRGHEYRRGRDTVDVWFDSGSTWKVIDRF 588

Query: 552 --STLGWPNKTNDM-NLFYPFSMLETGWDILFFWVTRMIMLGVKLTGSIPFKEVYCHSLV 608
               LG P   + + +L+   S    GW    F  + +  +        P+  V  H   
Sbjct: 589 YNHRLGLPLPRSPLADLYLEGSDQHRGW----FQSSLLTKVATAGIPQAPYAAVLTHGFT 644

Query: 609 RDFEGRKMSKSLGNVIDPLDIINGCTLKELHEKLQQGNLDPXXXXXXXXXXXXXYPRGIP 668
            D  G KMSKSLGN I P  +I G                                RGIP
Sbjct: 645 LDENGSKMSKSLGNTILPSAVIAG-----------------------------DKDRGIP 675

Query: 669 QCGSDALRFALCAYTTGGRDINLDISRVEGYRKFCNKIYQATKFSIQRLGDDYQPPSSTH 728
             G D LR  L A T    D+++  + ++   +   K+    KF    LG+  +  +   
Sbjct: 676 ALGVDGLRL-LIAQTDFTTDVSIGPTVIKHVAEALKKLRLTLKF---MLGNLQKTAAGCE 731

Query: 729 TPASKSL--VEKWILYQMNNTIAIVNDSFEKRDFL-TCTSKIY----ELWYMICDVYIEN 781
               + L  ++++ L ++        D ++  +F    T+ +Y    +L     DV  + 
Sbjct: 732 LLPFEKLRDIDQYTLCKLQELSIQAKDHYDAYNFSKVLTAVLYHMNNQLSAFYFDVTKDA 791

Query: 782 FKWLANDTIMEKAAKDTLHTLIENGLKMIHPFMPYLSEELWQRL 825
               + +++  +  + TL  + +    ++ P +P + +E W  L
Sbjct: 792 LYSGSINSLKRQQIRTTLFHIFDTYRSILGPILPVMIQEAWNCL 835

>KLLA0E05269g 476546..479173 similar to sp|P11325 Saccharomyces
           cerevisiae YLR382c NAM2 leucine--tRNA ligase precursor,
           mitochondrial singleton, start by similarity
          Length = 875

 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 101/412 (24%), Positives = 164/412 (39%), Gaps = 115/412 (27%)

Query: 77  EFTKDGKIKAEGLFCI-PAPPPNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFD 135
           + +KD + K   + C+ P P    +G LH+GH     I D + R+Y++KG  VL   G+D
Sbjct: 40  KLSKDDRNKNIYVLCMFPYP----SGTLHIGHLRVYTISDVVNRFYQLKGYNVLHPMGWD 95

Query: 136 HAGI-ATQSVVEKQLWKQEKKTRYDYGRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWS 194
             G+ A  + +E+++                      W ++   ++K Q+  + ++++W 
Sbjct: 96  AFGLPAENAAIERKV------------------NPAIWTKENIGKMKAQMGMMASNFNWD 137

Query: 195 REAFTLDPKLSTAVKEAFVRLHDAGIIYRASRLVNWSVKLKTTISNLEVDNKIINGRT-- 252
           RE  T DP+     ++ F+ L   G  YR    +NW    +T ++N +VD+   NG++  
Sbjct: 138 REIATCDPEYYKFTQKLFLELFKNGYAYRKEAEINWDPVDQTVLANEQVDS---NGKSWR 194

Query: 253 -------------LLTVPDYKDKIEF------------------------GVLIYIAYPV 275
                         L +  +  +++                         GV +    P 
Sbjct: 195 SGAQVEKKLLSQWFLGITRFAHELQHDLDGLDGWPSHVKRMQKNWIGESKGVEVVFNLPS 254

Query: 276 IDSNTNERIIVATTRPETLFG--------DVAIA-------------IH-----PEDSRY 309
           ID      I + TTRPETL+         D +I              IH     PEDS+ 
Sbjct: 255 IDP-----IKIFTTRPETLYSVQFVTLALDHSIVRKLKEEDNNLQEFIHRAEKLPEDSKK 309

Query: 310 KH-LHGKFVQHXXXXXXXXXXXDATAVDMTFGTGAVKITPAHDQNDYNVGKRHSLQFVNI 368
            + L   F QH            A  V   +G GAV   PAHDQ D++  K +      I
Sbjct: 310 GYMLSNIFCQHPLDPKKTVPIFVAPYVLGNYGHGAVMGCPAHDQRDFDFWKENCPGKPMI 369

Query: 369 FT----------------DDGLLNENCGSSWEGLKRFDARQLVIDELKRKGF 404
           +T                 DG++NEN G    GL   +AR+LV+++L   G 
Sbjct: 370 YTVSSAEAKIDTSGPYVSKDGVMNENAG-DLVGLTTHEARKLVVEKLTSLGL 420

>AER043C [2548] [Homologous to ScYLR382C (NAM2) - SH]
           (711416..714037) [2622 bp, 873 aa]
          Length = 873

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 168/833 (20%), Positives = 294/833 (35%), Gaps = 217/833 (26%)

Query: 97  PNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGI-ATQSVVEKQLWKQEKK 155
           P  +G LH+GH     I D+L R+YRMKG  V+   G+D  G+ A  + +E+ +      
Sbjct: 56  PYPSGMLHIGHLRVYTISDALNRFYRMKGYEVVHPMGWDAFGLPAENAALERGI------ 109

Query: 156 TRYDYGRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRL 215
                          +W  +   R+K Q   + A ++W RE  T DP+     +E F+ L
Sbjct: 110 ------------APADWTRQNIARMKQQKGDMLAHFEWGREVTTCDPEYYRFTQELFLEL 157

Query: 216 HDAGIIYRASRLVNWSVKLKTTISNLEVDNK--------IINGRTL----LTVPDYKDKI 263
              G+ Y+    +NW    KT ++N +VD +        ++  R L    L +  +  ++
Sbjct: 158 WHHGMAYKKEAEINWDPVDKTVLANEQVDAQGRSWRSGALVEKRKLNQWFLRITRFAHEL 217

Query: 264 EFGVLIYIAYPV-------------------IDSNTNERIIVATTRPETLFGDVAIAIHP 304
              +     +P                    + +   E I+  T R E +FG   +AI  
Sbjct: 218 SHDLDGLDGWPAKVKAMQKHWIGEVEGTEVRLCTGDGEAIVAFTPRIEAVFGLQYVAIST 277

Query: 305 EDSRYK---------------------------HLHGKFVQHXXXXXXXXXXXDATAVDM 337
           E +  K                            L G +VQH              +  +
Sbjct: 278 EHALTKKMAERLPELCEFLQRPLVLSESDLSGFQLPGTYVQHPFAKDHGHRIPVFVSPYV 337

Query: 338 TF-GTGAVKITPAHDQNDYNV--GKRHSLQFVNIFTDDGLLNENCGSSWEGLKRFDARQL 394
              G GAV  TPAHD+ D+      + +   ++ F   G  ++ C               
Sbjct: 338 PADGAGAVLGTPAHDEFDHKFWRANKPAEPVISSFEASGECDDEC--------------- 382

Query: 395 VIDELKRKGFFMKQEDNPMIIPLCSRSGDVIEPLLKHNGGSHKINGQDSDRYCGKREIRF 454
               ++ KG             L +++G++             I+ QD+ +    + +  
Sbjct: 383 ---HIQTKGI------------LNAKAGNL-----------KGISSQDAKQVLADKLVAT 416

Query: 455 SSSNTKNDYFRWLENIQDWCISRQLWWGHRCPVYFINVEGS-----EDSAAINRNDGKYW 509
                   Y      ++DW ISRQ +WG   P+ + +  G+     +D   +  N     
Sbjct: 417 GDGRQTTQY-----RLRDWLISRQRYWGAPIPIIYCDSCGTVPVPKQDLPVMLPNIAGLS 471

Query: 510 VAGRNLEEAVHKAAKKFPNKKFSLEQDQDVLDTWFSSALWPFSTL---------GWPNKT 560
             G  LE          P+     +++ D +DT+  S+ + F  L         G+   T
Sbjct: 472 KKGNTLEHIPEFVNTSCPSCGGPAKRETDTMDTFMDSSWYFFRYLDSHNQKEPFGYDKAT 531

Query: 561 NDMNLFYPFSMLETGWD--ILFFWVTRMIMLGVKLTGSI-----------PFKEVYCHSL 607
             M    P  M   G +  IL     R I    K   SI           PFK +    +
Sbjct: 532 RSM----PVDMYIGGVEHSILHLLYARFIS---KFLASIGKWDGSACNGEPFKRLVTQGM 584

Query: 608 VR-----DFEGRKMSK----SLGNVIDPLDIINGCTLKELHEKLQQG---NLDPXXXXXX 655
           V      D E     K     + N  DP+    G   +  +EK+ +      DP      
Sbjct: 585 VHGKTFIDPENGSFLKPEELDMSNPADPIICRTGQKPRVSYEKMSKSKYNGADPA----- 639

Query: 656 XXXXXXXYPRGIPQCGSDALRFALCAYTTGGRDINLDISRVEGYRKFCNKIYQATKFSIQ 715
                    + I + G DA+R  +         +N D +++ G  ++  +I +       
Sbjct: 640 ---------QCISKHGPDAIRAHILFQAPISDVVNWDETKIVGIERWLARIIKLA----H 686

Query: 716 RLGDDYQPPSSTHTPASK--SLVEKWILYQMNNTIAIVNDSFEKRDFLTCTSKIYELWYM 773
            L  D Q     H P +K  ++ E  +  ++   +  + DSF +               +
Sbjct: 687 TLAADSQ---LKHGPVAKLTNMHEIALFNEVQKLLGSITDSFSRT--------------L 729

Query: 774 ICDVYIENFKWLANDTIMEKAAKDT------LHTLIENGLKMIHPFMPYLSEE 820
             +  I ++  L N  ++++A K+       L T  +  + +IHP +P +SEE
Sbjct: 730 SLNTVISDYMKLTN--LLDQALKNKDINPAWLLTHFKKLVSVIHPTVPAVSEE 780

>CAGL0H05049g complement(483870..486593) similar to sp|P11325
           Saccharomyces cerevisiae YLR382c NAM2, hypothetical
           start
          Length = 907

 Score = 90.1 bits (222), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 182/823 (22%), Positives = 298/823 (36%), Gaps = 185/823 (22%)

Query: 97  PNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGI-ATQSVVEKQLWKQEKK 155
           P  +G LH+GH     I D+L R+Y+ +G  V+   G+D  G+ A  + +E+ +      
Sbjct: 77  PYPSGMLHMGHLRVYVISDTLNRFYQQRGYNVIHPMGWDAFGLPAENAAIERGI------ 130

Query: 156 TRYDYGRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRL 215
                          EW ++  K++K Q+  + A+++W RE  T DP+     +  F++L
Sbjct: 131 ------------DPSEWTKQNIKKMKEQMNDMLANFNWEREVTTCDPEYYKFTQWLFLQL 178

Query: 216 HDAGIIYRASRLVNWSVKLKTTISNLEVDNKIINGRT---------------LLTVPDYK 260
           +  G+ YR    +NW    KT ++N +VD    NGR+                L +  + 
Sbjct: 179 YKNGLAYRKDAEINWDPVDKTVLANEQVD---ANGRSWRSGAIVEKKKLTQWFLGITKFV 235

Query: 261 DKIEFGVLIYIAYPV---------IDSNTN--------------ERIIVATTRPETLFG- 296
           D++   +     +P          I S+T               E + V TTR ETLF  
Sbjct: 236 DQLRDDLKYLEEWPNKVKTMQNNWIGSSTGMEVNFKLNKKIGKFENVTVFTTRAETLFSV 295

Query: 297 -------DVAIAIH------------------PEDSRYKHLHGKFVQHXXXXXXXXXXXD 331
                  D  I  H                  PED++  +                    
Sbjct: 296 EYVVLATDHPITQHYAKQKSDLREFLHKLPELPEDTKTGYRISDLTVENPITHEVIPVFV 355

Query: 332 ATAVDMTFG--TGAVKITPAHDQNDYNVGKRHSLQFVNIFTDDGLLNENCGSSWEGLKRF 389
           A  V   +G    AV   PAHD  DY   K      +N+ T++    E  G         
Sbjct: 356 APYVISGYGDLPAAVMGCPAHDLRDYEFRK------INLNTNE----EPFGC-------- 397

Query: 390 DARQLVIDELKRKGFFMKQEDNPMIIPLCSRSGDVIEPLLKH-----NGGSHKINGQDSD 444
                +I +L R G     +D+   IP  S+SG + E   K+     N     I+ +  +
Sbjct: 398 -----IIPDLSRLG-----QDS---IPYTSKSGTMNERCGKYVGWDVNATRDAISTELEN 444

Query: 445 RYCGKREIRFSSSNTKNDYFRWLENIQDWCISRQLWWGHRCPVYFINVEG-----SEDSA 499
           +  GKR  R+               I+DW ISRQ +WG   P+   N  G      ED  
Sbjct: 445 KNLGKRTTRY--------------RIKDWLISRQRYWGSPIPIIHCNNCGIVPVPEEDLP 490

Query: 500 AINRNDGKYWVAGRNLEEAVHKAAKKFPNKKFSLEQDQDVLDTWFSSALWPFSTLGWPNK 559
                       G  L         + P    S +++ D +DT+  S+ + F  +   NK
Sbjct: 491 VTLPYVQGLHQKGNPLSNISDFVNTECPRCHNSAKRETDTMDTFIDSSWYFFRYIDAHNK 550

Query: 560 T-----NDMNLFYPFSMLETGWD--ILFFWVTRMI--------MLGVKLTGSIPFKEVYC 604
                    N   P  +   G +  IL    +R I        M    ++   PFK++  
Sbjct: 551 VLPFSPEKANKSMPVDIYIGGVEHAILHLLYSRFISKFLSSIGMWDRGISHGEPFKKLVT 610

Query: 605 HSLVRDFEGRKM-SKSLGNVIDPLDIINGCTLKELHEKLQQGNLDPXXXXXXXXXXXXXY 663
             +V   +G+ +     G  + P DI           K++  N+ P              
Sbjct: 611 QGMV---QGKTLIDPETGKFLTPNDI--DYLSSSSTPKIKGKNIAPILKYEKMSKSKYNG 665

Query: 664 P---RGIPQCGSDALRFALCAYTTGGRDINLDISRVEGYRKFCNKIYQATKFSIQRLGDD 720
                 I + G DA R  +   +     +  D  ++ G  ++ +KI Q     +    + 
Sbjct: 666 ADPNECISKHGPDATRAHILFQSPISDALRWDEEKIVGIERWLDKILQ---LCMSFASNP 722

Query: 721 YQPPSSTHTPASKSLVEKWILYQMNNTIAIVND---SFEKRDFLTCTSKIYELWYMICDV 777
            +    T  P  +   ++  LY  NN   +VN    SF +   L+  + I +  YM    
Sbjct: 723 DKIVGMTGIPPDQYNTDEITLY--NNVSKMVNSITKSFSEN--LSLNTVISD--YMKLTT 776

Query: 778 YIENFKWLANDTIMEKAAKDTLHTLIENGLKMIHPFMPYLSEE 820
            +EN K   N  I +    + +  LI    K I+P +P ++EE
Sbjct: 777 LLENAK--KNTKIRDTVTINYVRDLI----KCIYPVVPSIAEE 813

>YLR382C (NAM2) [3761] chr12 complement(882067..884751) Leucyl-tRNA
           synthetase, mitochondrial, forms a ternary complex with
           bI4 maturase and bI4 intron and stimulates bI4 intron
           splicing activity, dominant alleles suppress mutations
           in the bI4 maturase [2685 bp, 894 aa]
          Length = 894

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 110/465 (23%), Positives = 171/465 (36%), Gaps = 135/465 (29%)

Query: 97  PNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGI-ATQSVVEKQLWKQEKK 155
           P  +GALH+GH     I DSL R+Y+ KG  V+   G+D  G+ A  + +E+ +      
Sbjct: 56  PYPSGALHIGHLRVYVISDSLNRFYKQKGYNVIHPMGWDAFGLPAENAAIERSI------ 109

Query: 156 TRYDYGRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRL 215
               + RD   K            +K Q++ + A++DW RE  T DP+     +  F++L
Sbjct: 110 NPAIWTRDNIAK------------MKQQMQSMLANFDWDREITTCDPEYYKFTQWIFLKL 157

Query: 216 HDAGIIYRASRLVNWSVKLKTTISNLEVDNK--------IINGRTL----LTVPDYKDKI 263
            + G+ YR    +NW     T ++N +VD +        I+  + L    L +  +  K+
Sbjct: 158 FENGLAYRKEAEINWDPVDMTVLANEQVDAQGRSWRSGAIVEKKQLKQWFLGITKFAPKL 217

Query: 264 E----------------------FGVLIYIAYPVIDSNTNERIIVATTRPETLFGD--VA 299
           +                        V   + + V D    E +IV TTRPETLF    VA
Sbjct: 218 KKHLNQLKDWPSNVKQMQKNWIGESVGAELVFKVADPKF-ENLIVFTTRPETLFAVQYVA 276

Query: 300 IAI-HPEDSRY-------KHLHGKFVQHXXXXXXXXXXXDATAVD--------------- 336
           +A+ HP   +Y       K    K  Q            +  AV+               
Sbjct: 277 LALDHPIVQKYCEEMPDLKEFIQKSDQLPNDTKEGFQLPNIKAVNPLTKEEVPIFAAPYV 336

Query: 337 -MTFGTG--AVKITPAHDQNDY-----NVGKRHSLQFVNIFTDDGL-LNENCGSSWEGLK 387
             ++G+   AV   P HD  D+     N    H    +  F DD   + E          
Sbjct: 337 VSSYGSAPSAVMGCPGHDNRDFEFWQTNCPGEHIKTCIAPFFDDASKVTEQ--------- 387

Query: 388 RFDARQLVIDELKRKGFFMKQEDNPMIIPLCSRSGDVIEPLLKHNG-----GSHKINGQD 442
               RQ +ID                 +P  S  G + +   +H+G         I G  
Sbjct: 388 ---ERQRIID----------------TVPFTSTDGVLTKECGEHSGVLTVVARKSIMGML 428

Query: 443 SDRYCGKREIRFSSSNTKNDYFRWLENIQDWCISRQLWWGHRCPV 487
           +     K  +R+               I+DW ISRQ +WG   P+
Sbjct: 429 NSEGLSKSVVRY--------------KIRDWLISRQRYWGTPIPI 459

>AER394W [2894] [Homologous to ScYBL076C (ILS1) - SH]
           complement(1386794..1390012) [3219 bp, 1072 aa]
          Length = 1072

 Score = 80.1 bits (196), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 88/390 (22%), Positives = 159/390 (40%), Gaps = 70/390 (17%)

Query: 466 WLENIQDWCISRQLWWGHRCPVY----FINVEGSEDSAAINRNDGKYWVAGRNLEEAVHK 521
           W+ N +DW ISR  +WG   P++    F  +      A +    G   ++  +  + V K
Sbjct: 449 WIANARDWNISRNRYWGTPIPLWVSDDFDEIVCVGSIAELEELSGVSGISDLH-RDTVDK 507

Query: 522 AAKKFPNKKFSLEQDQDVLDTWFSSALWPFSTLGWP-NKTNDMNLFYPFSMLETGWDILF 580
                   K  L + ++V D WF S   P+++  +P   T       P + +  G D   
Sbjct: 508 ITIPSKKGKGELRRIEEVFDCWFESGSMPYASQHYPFENTEKFAQRVPANFISEGLDQTR 567

Query: 581 FWVTRMIMLGVKLTGSIPFKEVYCHSLVRDFEGRKMSKSLGNVIDPLDIINGCTLKELHE 640
            W   + +LG +L G +P++ V    +V   +G+KMSKSL N  DP  +I+         
Sbjct: 568 GWFYTLGVLGTQLFGHVPYQNVIVSGIVLAADGKKMSKSLKNYPDPNIVID--------- 618

Query: 641 KLQQGNLDPXXXXXXXXXXXXXYPRGIPQCGSDALRFALCAYTTGGRDINLDISRV---- 696
                                       + GSDALR  L         IN  + R     
Sbjct: 619 ----------------------------KYGSDALRLYL---------INSPVLRAESLK 641

Query: 697 ---EGYRKFCNKI----YQATKFSIQRLGDDYQPPSS--THTPASKS--LVEKWILYQMN 745
              EG ++  +K+    + + KF   ++    +  S    + P  +S  ++++W+L  + 
Sbjct: 642 FKEEGVKEVVSKVLLPWWNSFKFLEGQIALLKKTSSVDFKYDPNVRSDNVMDRWVLASLQ 701

Query: 746 NTIAIVNDSFEKRDFLTCTSKIYELWYMICDVYIE-NFKWLANDTIMEKA--AKDTLHTL 802
           + I  ++   +     +   ++ +    + + YI  N + L  +  ME    A +TL   
Sbjct: 702 SLIKYIHVEMKAYKLYSVVPRLLDFIDELTNWYIRFNRRRLKGEDGMEDCINALNTLFEA 761

Query: 803 IENGLKMIHPFMPYLSEELWQRLPDGIGKD 832
           +   ++ + PF P+LSE ++ RL + I KD
Sbjct: 762 LFTFVRAMAPFTPFLSETIYLRLREYIPKD 791

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 96/210 (45%), Gaps = 15/210 (7%)

Query: 96  PPNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVEKQLWKQEKK 155
           PP  TG  H GH L   ++D + RY  M G  V    G+D  G+  + +++K+L    K+
Sbjct: 46  PPFATGTPHYGHILASTVKDIVPRYATMNGYHVERRFGWDTHGLPIEHIIDKKLNITCKE 105

Query: 156 TRYDYGRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRL 215
             Y +G + +  +       Y    +  + RLG   D+  +  T+ P    +V  AF +L
Sbjct: 106 DVYKFGIENYNNECRAIIMTYADEWRKTIGRLGRWIDFDNDYKTMYPSFMESVWWAFKQL 165

Query: 216 HDAGIIYRASRLVNWSVKLKTTISNLEVDNKIINGRTLLTVPDYKDKIEFGVLIYIAYPV 275
           ++   +YR  R++ +S    T +SN E               +YK+  +  V   I + V
Sbjct: 166 YEKEQVYRGYRVMPYSTGCTTPLSNFEAQQ------------NYKEVNDPAVT--IGFNV 211

Query: 276 IDSNTNERIIVATTRPETLFGDVAIAIHPE 305
           +    N + +  TT P TL  ++A+ ++PE
Sbjct: 212 V-GEENTQFVAWTTTPWTLPSNLALCVNPE 240

>Kwal_26.9374
          Length = 884

 Score = 76.3 bits (186), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 116/546 (21%), Positives = 196/546 (35%), Gaps = 141/546 (25%)

Query: 97  PNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGI-ATQSVVEKQLWKQEKK 155
           P  +G LH+GH     I D+L R+Y+  G  V+   G+D  G+ A  + +E+++      
Sbjct: 58  PYPSGNLHIGHLRVYTITDALNRFYKQNGYNVIHPMGWDAFGLPAENAAIERKV------ 111

Query: 156 TRYDYGRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRL 215
                           W  +   ++K QL  + A++DW RE  T +P      ++ F+ L
Sbjct: 112 ------------NPASWTHQNIAKMKEQLNNMLANFDWDREVTTCNPDYYKHTQKLFLEL 159

Query: 216 HDAGIIYRASRLVNWSVKLKTTISNLEVDNK--------IINGRTL----LTVPDYKDKI 263
              G+ YR    +NW    +T ++N +VD +        ++  R L    L +  Y   +
Sbjct: 160 FKRGLAYRKDAEINWDPVDQTVLANEQVDAQGRSWRSGALVEKRKLNQWFLGITKYAHAL 219

Query: 264 EFGVLIYIAYP-----------------VID--SNTNERIIVATTRPETLFGD--VAIAI 302
           +  +     +P                  ID   +T+E I V TTRPETLF    VA+A+
Sbjct: 220 QHDLNQLQDWPRNVKTMQKNWVGESHGTEIDFKCSTSETIQVFTTRPETLFSVQYVALAL 279

Query: 303 -----------HPEDSRYKHLHGKFVQ-------HXXXXXXXXXXXDATAVDM------- 337
                       PE  ++     KF+                     A   D+       
Sbjct: 280 DNPVIEKAAISDPELRKFID-QAKFLSPDCKDGYQLKGVKAKNPILKAAEYDLPIFAAPY 338

Query: 338 ---TFGTGAVKITPAHDQNDYNVGKRHSLQFVNIFTDDGLLNENCGSSWEGLKRFDARQL 394
               +G GAV   PAHD+ D            N F    +       S            
Sbjct: 339 VLGNYGKGAVMGCPAHDERD------------NAFWAQNMPGHPTKPS------------ 374

Query: 395 VIDELKRKGFFMKQED----NPMIIPLCSRSGDVIEPLLKHNGGSHKINGQDSDRYCGKR 450
                      + +ED    N + +P  S+SG +    + + G          D     +
Sbjct: 375 ----------IIAKEDGTATNLLQLPFTSKSGILSSAAMTYAG---------MDTTTAAK 415

Query: 451 EIRFSSSNTKNDYFRWLENIQDWCISRQLWWGHRCPVYF------INVEGSEDSAAINRN 504
           ++  +  ++ N  +     ++DW ISRQ +WG   P+        + V        +   
Sbjct: 416 QMTKALESSGNGRYMVSYKLRDWLISRQRYWGTPIPIIHCPSCGPVGVPDEHLPVLLPEI 475

Query: 505 DGKYWVAGRNLEEAVHKAAKKFPNKKFSLEQDQDVLDTWFSSALWPFSTLGWPNKTNDMN 564
           DG     G  L++         P+     +++ D +DT+  S+ + F        T+  N
Sbjct: 476 DG-LATRGNPLQKVDDFVNTTCPSCGSPAKRETDTMDTFIDSSWYFFRF------TDPKN 528

Query: 565 LFYPFS 570
           L  PFS
Sbjct: 529 LHEPFS 534

>Scas_719.5
          Length = 939

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 77/157 (49%), Gaps = 19/157 (12%)

Query: 97  PNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGI-ATQSVVEKQLWKQEKK 155
           P  +G LH+GH     I DSL R+++ +G  V+   G+D  G+ A  + + + +      
Sbjct: 79  PYPSGTLHMGHLRVYVISDSLNRFFKQRGYEVIHPMGWDAFGLPAENAAIARGI------ 132

Query: 156 TRYDYGRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRL 215
                          +W ++   ++K Q+  + A++DW RE  T DP      +  F++L
Sbjct: 133 ------------NPADWTKQNIAKMKEQMNNMLANFDWDREVTTCDPDYYKFNQWIFLKL 180

Query: 216 HDAGIIYRASRLVNWSVKLKTTISNLEVDNKIINGRT 252
           ++ G+ Y+    +NW    KT ++N +VD+  I+ R+
Sbjct: 181 YENGLAYQKEAEINWDPVDKTVLANEQVDSNGISWRS 217

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 41/96 (42%), Gaps = 6/96 (6%)

Query: 470 IQDWCISRQLWWGHRCPVYFIN----VEGSEDSAAINRNDGKYWVA--GRNLEEAVHKAA 523
           I+DW ISRQ +WG   P+   +    V   E    +   + K   A  G  L +      
Sbjct: 464 IRDWLISRQRYWGTPIPIIHCDHCGPVPVPEKDLPVMLPEVKTITAKGGNPLSQIPEFVN 523

Query: 524 KKFPNKKFSLEQDQDVLDTWFSSALWPFSTLGWPNK 559
            K P+     +++ D +DT+  S+ + F  L   NK
Sbjct: 524 AKCPSCGSDAKRETDTMDTFMDSSWYFFRYLDPKNK 559

>AAL088W [99] [Homologous to ScYPL160W (CDC60) - SH]
           complement(185828..189142) [3315 bp, 1104 aa]
          Length = 1104

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/280 (21%), Positives = 95/280 (33%), Gaps = 72/280 (25%)

Query: 90  FCIPAPPPNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVEKQL 149
           F  P   P + G LH+GH  T++  +  + + RM GK  LF  GF   G+   +  +K  
Sbjct: 72  FMAPMAYPYMNGVLHVGHCFTMSKVEFSVGFERMNGKRALFPLGFHCTGMPILACADKLK 131

Query: 150 WKQEK---------------------------------------------KTRYDY---- 160
            + E                                              +++Y +    
Sbjct: 132 REAEMFGEDFANAPAAEEEEELEVREDSKPGSEDVTKFKAKKSKAVAKQGRSKYQFEIMM 191

Query: 161 ----GRDGFIK--KAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVR 214
                R+  IK   A  W   +    +     +GA  DW R   T D        +AFVR
Sbjct: 192 QLGIAREDVIKFADAQHWLTYFPPLCEEDCTAIGARVDWRRAYITTD---MNQYYDAFVR 248

Query: 215 -----LHDAGIIYRASRLVNWSVKLKTTISNLEVDNKIINGRTLLTVPDYKDKIEFGVLI 269
                L +AG +    R   +S +         +D+   +G  +        KIE     
Sbjct: 249 WQMNKLREAGKVKFGERYTIYSERDGQAC----MDHDRQSGEGVTPQEYVGIKIEVLEFA 304

Query: 270 YIAYPVIDSNTNER-----IIVATTRPETLFGDVAIAIHP 304
             A  +ID++  ++      I AT RPET++G     + P
Sbjct: 305 AEAQEIIDNSGLDKSKKIHFIAATLRPETMYGQTCCFVSP 344

>Scas_650.7
          Length = 1119

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 97  PNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVEK 147
           P   GALH GH  T++  +  + + RM GK  LF  GF   G+   +  +K
Sbjct: 95  PYANGALHAGHCFTLSKVEFSVGFERMNGKRALFPLGFHCTGMPILACADK 145

>KLLA0D06105g complement(522480..525767) highly similar to sp|P26637
           Saccharomyces cerevisiae YPL160w CDC60 leucine--tRNA
           ligase, cytosolic singleton, start by similarity
          Length = 1095

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 97  PNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVEK 147
           P + G LH GH  T++  +  I + RM GK  LF  GF   G+   +  +K
Sbjct: 71  PYMNGVLHAGHCFTLSKVEFSIGFERMNGKRALFPIGFHCTGMPILACADK 121

>CAGL0J03652g 346614..349895 highly similar to sp|P26637
           Saccharomyces cerevisiae YPL160w CDC60 leucine-tRNA
           ligase, hypothetical start
          Length = 1093

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 97  PNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVEK 147
           P + G LH GH  T++  +  I + RM GK  LF  GF   G+   +  +K
Sbjct: 69  PYMNGVLHAGHCFTLSKVEFSIGFERMNGKRALFPLGFHCTGMPILACADK 119

>Sklu_2298.2 YPL160W, Contig c2298 4548-7838
          Length = 1096

 Score = 37.4 bits (85), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 97  PNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVEK 147
           P + G LH GH  T++  +  + + RM GK  LF  GF   G+   +  +K
Sbjct: 71  PYMNGVLHAGHCFTLSKVEFSVGFERMNGKRALFPLGFHCTGMPILACADK 121

>YPL160W (CDC60) [5287] chr16 (246989..250261) Leucyl-tRNA
           synthetase, cytoplasmic [3273 bp, 1090 aa]
          Length = 1090

 Score = 37.0 bits (84), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 97  PNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVEK 147
           P + G +H GH  T++  +  I + RM GK  LF  GF   G+   +  +K
Sbjct: 66  PYMNGVMHAGHCFTLSKVEFSIGFERMNGKRALFPLGFHCTGMPILACADK 116

>Kwal_33.15315
          Length = 583

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 20/23 (86%), Gaps = 2/23 (8%)

Query: 613 GRKMSKSLGNVIDPLDIIN--GC 633
           G KMSKS+GNV+DPLD+I+  GC
Sbjct: 345 GTKMSKSVGNVVDPLDMISYYGC 367

>AAL133W [54] [Homologous to ScYGR171C (MSM1) - SH]
           complement(113951..115654) [1704 bp, 567 aa]
          Length = 567

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 32/71 (45%)

Query: 84  IKAEGLFCIPAPPPNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQS 143
           ++A   F I  P        HLGH  +  I D   R+ +++   VLF  G D  G+  Q+
Sbjct: 9   LRAIQKFHITTPIFYPNAKPHLGHLYSSLICDVQARWQKLRDSEVLFTTGTDEHGLKIQT 68

Query: 144 VVEKQLWKQEK 154
             E+Q +   K
Sbjct: 69  ASEQQGYASPK 79

>YGR171C (MSM1) [2124] chr7 complement(840827..842554)
           Methionyl-tRNA synthetase, mitochondrial, member of
           class I family of aminoacyl-tRNA synthetases [1728 bp,
           575 aa]
          Length = 575

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 6/49 (12%)

Query: 581 FWVTRMIMLGVKLTGSIPFKEVYCHSLVRDFEGRKMSKSLGNVIDPLDI 629
           +W + ++  G+ L   I    V+ H L     G KMSKSLGNV+DP+D+
Sbjct: 313 YWPSFLLAAGLPLPRQI---VVHGHWLC---NGMKMSKSLGNVVDPIDM 355

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 22/52 (42%)

Query: 104 HLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVEKQLWKQEKK 155
           HLGH  +  + D   R+   KG    F  G D  G+  Q   E   + Q KK
Sbjct: 29  HLGHLYSSLLSDVYHRWQLFKGNLSFFTTGTDEHGLKIQCASESNGFDQPKK 80

>KLLA0F14971g complement(1386169..1387875) similar to sp|P22438
           Saccharomyces cerevisiae YGR171c MSM1 methionyl-tRNA
           synthetase singleton, hypothetical start
          Length = 568

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 17/19 (89%)

Query: 613 GRKMSKSLGNVIDPLDIIN 631
           G KMSKSLGNV+DP+ II+
Sbjct: 340 GVKMSKSLGNVVDPIQIIS 358

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 35/167 (20%), Positives = 64/167 (38%), Gaps = 18/167 (10%)

Query: 84  IKAEGLFCIPAPPPNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQS 143
           ++A   F I  P        HLGH  +  + D   R+ ++ G+   F  G D  G+  Q 
Sbjct: 6   VRAVSKFHITTPIFYPNAKPHLGHLYSSLLCDVQNRWKKLAGQDTCFTTGVDEHGLKIQL 65

Query: 144 VVEKQLWKQEKKTRYDYGRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPK 203
             +++ +   K          F+ +  E      K          A+  ++R   T DP 
Sbjct: 66  AAQQKGYSNPK---------AFVDELCEHFVHLDK---------DANIKFTRFIRTTDPD 107

Query: 204 LSTAVKEAFVRLHDAGIIYRASRLVNWSVKLKTTISNLEVDNKIING 250
               VK+ +   ++ G IY+      +SV  +T   + ++    I+G
Sbjct: 108 HVNNVKKLWNLCYNNGYIYKGEHKGWYSVSDETFYPDTKILKLTIDG 154

>Sklu_2399.6 YGR171C, Contig c2399 15064-16788
          Length = 574

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 19/23 (82%), Gaps = 2/23 (8%)

Query: 613 GRKMSKSLGNVIDPLDIIN--GC 633
           G KMSKSLGNV+DPL +I+  GC
Sbjct: 347 GVKMSKSLGNVVDPLLMISYYGC 369

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 26/66 (39%)

Query: 83  KIKAEGLFCIPAPPPNVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQ 142
           K   +  F +  P        HLGH  +  + D   R+Y +     LF  G D  G+  Q
Sbjct: 12  KCSKQAKFHVTTPIFYPNAKPHLGHLYSSLLCDVTRRWYDLLSYKTLFTTGTDEHGLKIQ 71

Query: 143 SVVEKQ 148
              EKQ
Sbjct: 72  LASEKQ 77

>YKR020W (VPS51) [3275] chr11 (477981..478475) Class B vacuolar
            sorting protein involved in Prc1p and Pho8p vacuolar
            trafficking pathways, plays a role in secretion of mature
            alpha-factor, and maintenance of actin cytoskeleton and
            apical bud growth [495 bp, 164 aa]
          Length = 164

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 2/44 (4%)

Query: 970  AATQRMLTNKDFIKKASEEIREMNEKKLINIHNKILGMQNTVNN 1013
            +AT+  L  K+  + A EEI+ +  K+L+ IHNK+LG +   NN
Sbjct: 78   SATEEDL--KEGSEDAEEEIKNLPFKRLVQIHNKLLGKETETNN 119

>CAGL0I08723g 849045..850799 similar to sp|P22438 Saccharomyces
           cerevisiae YGR171c MSM1 methionyl-tRNA synthetase,
           hypothetical start
          Length = 584

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 6/51 (11%)

Query: 579 LFFWVTRMIMLGVKLTGSIPFKEVYCHSLVRDFEGRKMSKSLGNVIDPLDI 629
           + FW + ++   + L   I    V+ H L   F   KMSKSLGNV++P+ I
Sbjct: 324 IIFWPSFLLAANLPLPKQI---VVHSHWLCNGF---KMSKSLGNVVEPMKI 368

>Scas_620.7
          Length = 576

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 6/49 (12%)

Query: 581 FWVTRMIMLGVKLTGSIPFKEVYCHSLVRDFEGRKMSKSLGNVIDPLDI 629
           +W + ++  G+ L   +    V+ H L     G KMSKSLGNV+DP+++
Sbjct: 315 YWPSFLMAAGLPLPKQVV---VHNHWLCN---GVKMSKSLGNVVDPIEM 357

>Sklu_2208.4 YDR322W, Contig c2208 7462-8532
          Length = 356

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 39/98 (39%), Gaps = 16/98 (16%)

Query: 668 PQCGSDALRFALCAYTTGGRDINLDISRVEGYRKFCNKIYQATKFSIQRLGDDYQPPSST 727
           P   SD+ +  L   + G  D+ +          + + I  A KFS Q +  DY PP   
Sbjct: 231 PDLASDSFKTTL---SYGLADLKIS---------YNDNIVDARKFSEQNIVADYLPPVPE 278

Query: 728 HTPASKSLVEKWILYQM---NNTIAIVNDSFEKRDFLT 762
              A K     W+  Q    NN+IA     F+ R F+ 
Sbjct: 279 KN-AGKQRFAVWVFRQTNPYNNSIAFDRQDFDIRSFVA 315

>Sklu_2194.5 YOR308C, Contig c2194 9459-11252 reverse complement
          Length = 597

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 14/96 (14%)

Query: 374 LLNENCGSSWEGLKRFDARQLVIDELKRK-GFFMKQED-------NPMIIPLCSRSGDVI 425
           L+NEN     E  +    +Q+  D  ++K GF    ED       N  +      SG+V+
Sbjct: 190 LINENITHEAEDARNIKLKQMAKDRKRKKIGFGRALEDALGEDQENGDLFFRIGTSGEVV 249

Query: 426 EPLLKHNGGSHKINGQDSDRYCGKREIRFSSSNTKN 461
           E +      S  +   D+D + GKR++ F S +  N
Sbjct: 250 ESV------SRNLEEGDADNHKGKRKVSFQSPDEDN 279

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 33,106,697
Number of extensions: 1463053
Number of successful extensions: 3889
Number of sequences better than 10.0: 47
Number of HSP's gapped: 3870
Number of HSP's successfully gapped: 76
Length of query: 1019
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 907
Effective length of database: 12,718,893
Effective search space: 11536035951
Effective search space used: 11536035951
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)