Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_716.3022822811681e-165
YGR095C (RRP46)2232227172e-96
Sklu_1989.12232166252e-82
CAGL0G03113g2332245975e-78
Kwal_23.39692242215767e-75
KLLA0D14993g2252235636e-73
AAR035C2522204335e-53
ACR035W2461401333e-09
Kwal_33.154532451361281e-08
KLLA0D09625g2451371262e-08
Sklu_1267.22731371254e-08
Scas_647.72461361235e-08
CAGL0G09317g2461361201e-07
YGR195W (SKI6)2461361103e-06
AFR109W237193780.037
CAGL0E03223g248154770.056
KLLA0F18304g236133740.13
Kwal_27.1097222439651.7
YGR112W (SHY1)38957651.8
YLR114C76441652.2
Scas_621.17239123642.2
Kwal_23.657550421652.4
Sklu_1879.1238145632.9
YGR158C (MTR3)250146608.1
AGL348W72958609.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_716.30
         (228 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_716.30                                                           454   e-165
YGR095C (RRP46) [2055] chr7 complement(675673..676344) Protein c...   280   2e-96
Sklu_1989.1 YGR095C, Contig c1989 348-1019                            245   2e-82
CAGL0G03113g complement(289747..290448) similar to sp|P53256 Sac...   234   5e-78
Kwal_23.3969                                                          226   7e-75
KLLA0D14993g complement(1266752..1267429) similar to sp|P53256 S...   221   6e-73
AAR035C [221] [Homologous to ScYGR095C (RRP46) - SH] (406091..40...   171   5e-53
ACR035W [1083] [Homologous to ScYGR195W (SKI6) - SH] complement(...    56   3e-09
Kwal_33.15453                                                          54   1e-08
KLLA0D09625g complement(813773..814510) highly similar to sp|P46...    53   2e-08
Sklu_1267.2 YGR195W, Contig c1267 529-1350                             53   4e-08
Scas_647.7                                                             52   5e-08
CAGL0G09317g complement(890158..890898) highly similar to sp|P46...    51   1e-07
YGR195W (SKI6) [2145] chr7 (888885..889625) Component of the exo...    47   3e-06
AFR109W [3301] [Homologous to ScYGR158C (MTR3) - SH] complement(...    35   0.037
CAGL0E03223g complement(297800..298546) similar to sp|P48240 Sac...    34   0.056
KLLA0F18304g complement(1689187..1689897) similar to sp|P48240 S...    33   0.13 
Kwal_27.10972                                                          30   1.7  
YGR112W (SHY1) [2071] chr7 (717360..718529) Mitochondrial protei...    30   1.8  
YLR114C (YLR114C) [3527] chr12 complement(374945..377239) Protei...    30   2.2  
Scas_621.17                                                            29   2.2  
Kwal_23.6575                                                           30   2.4  
Sklu_1879.1 YGR158C, Contig c1879 329-1045 reverse complement          29   2.9  
YGR158C (MTR3) [2112] chr7 complement(805272..806024) Protein in...    28   8.1  
AGL348W [3964] [Homologous to NOHBY] complement(56615..58804) [2...    28   9.7  

>Scas_716.30
          Length = 228

 Score =  454 bits (1168), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 228/228 (100%), Positives = 228/228 (100%)

Query: 1   MSIIAQMGPLTKVDGSSLIESKQTKIICSVTGPIEPKSRQELPTQLALEIIIRPAAGVPN 60
           MSIIAQMGPLTKVDGSSLIESKQTKIICSVTGPIEPKSRQELPTQLALEIIIRPAAGVPN
Sbjct: 1   MSIIAQMGPLTKVDGSSLIESKQTKIICSVTGPIEPKSRQELPTQLALEIIIRPAAGVPN 60

Query: 61  TREKLMEDKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIAL 120
           TREKLMEDKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIAL
Sbjct: 61  TREKLMEDKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIAL 120

Query: 121 IDAGIALNSMCACVPIALTSKEGSDETLLIIDPSDEELKSSNSVHVLALELVDQCKTVKN 180
           IDAGIALNSMCACVPIALTSKEGSDETLLIIDPSDEELKSSNSVHVLALELVDQCKTVKN
Sbjct: 121 IDAGIALNSMCACVPIALTSKEGSDETLLIIDPSDEELKSSNSVHVLALELVDQCKTVKN 180

Query: 181 VLLLDSNGDFNEKDLFNILESGEVEVLKLGKQIRHIVESKINSDITSI 228
           VLLLDSNGDFNEKDLFNILESGEVEVLKLGKQIRHIVESKINSDITSI
Sbjct: 181 VLLLDSNGDFNEKDLFNILESGEVEVLKLGKQIRHIVESKINSDITSI 228

>YGR095C (RRP46) [2055] chr7 complement(675673..676344) Protein
           component of the exosome 3'-5' exoribonuclease complex
           involved in 3'end processing of multiple small RNA
           species [672 bp, 223 aa]
          Length = 223

 Score =  280 bits (717), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 144/222 (64%), Positives = 175/222 (78%), Gaps = 4/222 (1%)

Query: 1   MSIIAQMGPLTKVDGSSLIESKQTKIICSVTGPIEPKSRQELPTQLALEIIIRPAAGVPN 60
           MS+ A++G L  VDGSS   S+ TK+ICSVTGPIEPK+RQELPTQLALEII+RPA GV  
Sbjct: 1   MSVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVAT 60

Query: 61  TREKLMEDKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIAL 120
           TREK++EDKLRAV+TP+ITR+ YPRQLCQIT QIL SGE E EF+ REL+ CINA  +AL
Sbjct: 61  TREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLAL 120

Query: 121 IDAGIALNSMCACVPIALTSKEGSDETLLIIDPSDEELKSSNSVHVLALELVDQCKTVKN 180
           +DAGIALNSMCA +PIA+  K+ SD   +I+DP+ E+LK S SVH LALE V+  K VKN
Sbjct: 121 VDAGIALNSMCASIPIAII-KDTSD---IIVDPTAEQLKISLSVHTLALEFVNGGKVVKN 176

Query: 181 VLLLDSNGDFNEKDLFNILESGEVEVLKLGKQIRHIVESKIN 222
           VLLLDSNGDFNE  LF++LE GE +  +L   IR I++  I+
Sbjct: 177 VLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNIS 218

>Sklu_1989.1 YGR095C, Contig c1989 348-1019
          Length = 223

 Score =  245 bits (625), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 114/216 (52%), Positives = 155/216 (71%), Gaps = 5/216 (2%)

Query: 10  LTKVDGSSLIESKQTKIICSVTGPIEPKSRQELPTQLALEIIIRPAAGVPNTREKLMEDK 69
           L +VDGSS +E   TK+ICSVTGP+EPK+RQELPTQLALEI++RP+ GVPNTREKLMEDK
Sbjct: 9   LDQVDGSSQVECSATKVICSVTGPVEPKARQELPTQLALEIVVRPSKGVPNTREKLMEDK 68

Query: 70  LRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIALIDAGIALNS 129
           +R V+TP++ RYLYPRQLCQ+T Q+L SGESE ++  +EL  CINA  +AL+DAGIAL S
Sbjct: 69  IRGVLTPVLVRYLYPRQLCQLTFQVLESGESEEQYTVKELGCCINAAYLALVDAGIALKS 128

Query: 130 MCACVPIALTSKEGSDETLLIIDPSDEELKSSNSVHVLALELVDQCKTVKNVLLLDSNGD 189
               VPI +      ++  ++ +P+  +L  S S H++++E+      V+NVLL+DSNGD
Sbjct: 129 SFVSVPICIL-----EQNKIVTNPTAHQLAQSVSTHLISMEVGSGGTQVENVLLVDSNGD 183

Query: 190 FNEKDLFNILESGEVEVLKLGKQIRHIVESKINSDI 225
           F E  LF++L  GE E + +    R I++ K+  D 
Sbjct: 184 FQENQLFDVLAEGEKECINVASAFRKIIQEKLQKDF 219

>CAGL0G03113g complement(289747..290448) similar to sp|P53256
           Saccharomyces cerevisiae YGR095c RRP46 involved in rRNA
           processing, hypothetical start
          Length = 233

 Score =  234 bits (597), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 163/224 (72%), Gaps = 1/224 (0%)

Query: 3   IIAQMGPLTKVDGSSLIESKQTKIICSVTGPIEPKSRQELPTQLALEIIIRPAAGVPNTR 62
           I+ ++G L++VDGS+ +    T ++C+VTGP+EPK+RQELPT++ALE+I+RPA GVP  R
Sbjct: 5   IVVELGLLSEVDGSAKLLMNSTNVLCAVTGPVEPKARQELPTEMALEVIVRPAKGVPTPR 64

Query: 63  EKLMEDKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIALID 122
           EK +EDK+RA+ TP+ITR+ YPRQLCQIT QI+ +GE+E    Q+EL+ C+N+ L+AL++
Sbjct: 65  EKYLEDKIRAIFTPLITRHKYPRQLCQITCQIMEAGENEQLHNQKELSACVNSALLALVN 124

Query: 123 AGIALNSMCACVPIALTSKEGS-DETLLIIDPSDEELKSSNSVHVLALELVDQCKTVKNV 181
           AG+ALN + A V IA+   +   ++   II PSDEEL+ S+SVH +A+E+ D  K VK V
Sbjct: 125 AGVALNDLAAAVTIAVIDDQSQENKAQYIIGPSDEELEKSSSVHTIAMEVGDNGKKVKRV 184

Query: 182 LLLDSNGDFNEKDLFNILESGEVEVLKLGKQIRHIVESKINSDI 225
           LL++SNG FN+K +F+ILE  E   L L    R ++   I  ++
Sbjct: 185 LLIESNGIFNDKVIFDILELSESACLNLCSNWRGVLTKHIQKEL 228

>Kwal_23.3969
          Length = 224

 Score =  226 bits (576), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 156/221 (70%), Gaps = 4/221 (1%)

Query: 5   AQMGPLTKVDGSSLIESKQTKIICSVTGPIEPKSRQELPTQLALEIIIRPAAGVPNTREK 64
           AQ G L +VDGS  I+  +T ++CSVTGPIEPK+RQELP+QLALEI++RP  GVPNTREK
Sbjct: 4   AQTGVLDQVDGSCKIQCGETSVLCSVTGPIEPKARQELPSQLALEIVVRPCKGVPNTREK 63

Query: 65  LMEDKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIALIDAG 124
           L+ED++R V+TPI+ RYLYPRQLCQI  QIL SGE +  ++ +EL +CINA  +ALID+G
Sbjct: 64  LLEDQIRGVLTPILARYLYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLALIDSG 123

Query: 125 IALNSMCACVPIALTSKEGSDETLLIIDPSDEELKSSNSVHVLALELVDQCKTVKNVLLL 184
           I L S  A V +++          + I+P+ ++L  S S H+LALE+    K  + VLL+
Sbjct: 124 IGLQSSFASVCLSVNGPNNE----ICINPASDQLIRSTSSHLLALEMGPGSKKTQKVLLI 179

Query: 185 DSNGDFNEKDLFNILESGEVEVLKLGKQIRHIVESKINSDI 225
           +S+G F E+ L ++L  GE   L++ +++R  VE KI++D 
Sbjct: 180 ESHGAFTEQQLLDVLSKGEEACLQVAQELRSAVERKISNDF 220

>KLLA0D14993g complement(1266752..1267429) similar to sp|P53256
           Saccharomyces cerevisiae YGR095c RRP46 involved in rRNA
           processing singleton, hypothetical start
          Length = 225

 Score =  221 bits (563), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 161/223 (72%), Gaps = 16/223 (7%)

Query: 10  LTKVDGSSLIESKQTKIICSVTGPIEPKSRQELPTQLALEIIIRPAAGVPNTREKLMEDK 69
           L  VDGSS++ +  TK+ICSV+GP+EPKSRQELPTQLALEII++PA GV +TREKLMED+
Sbjct: 8   LGHVDGSSVVSNSGTKVICSVSGPMEPKSRQELPTQLALEIIVKPAEGVQSTREKLMEDQ 67

Query: 70  LRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIALIDAGIALNS 129
           +R+V+TP++ RYL+PRQ  QI LQ+L +GES  ++  +E++ C+NA ++AL+DAG+ L S
Sbjct: 68  IRSVLTPVLARYLHPRQFVQICLQVLEAGESR-DYTVKEVSVCVNAAVLALVDAGVPLLS 126

Query: 130 MCACVPIALTSKEGSDETLLIIDPSDEELKSSNSVHVLALEL-------VDQCKTVKNVL 182
           MC+   I +T+ EG     L+++P++ +L    SVHV  LEL       +D    V+N+L
Sbjct: 127 MCSGTCIGITT-EGKQ---LVVNPTESQLAKCESVHVYCLELGTNENGDID----VRNLL 178

Query: 183 LLDSNGDFNEKDLFNILESGEVEVLKLGKQIRHIVESKINSDI 225
           LLDS G F+E  LF +LE+GE E ++L  ++R +++ K+  D 
Sbjct: 179 LLDSLGSFDESQLFKVLETGEKECIRLYTELRSVIKDKVAKDF 221

>AAR035C [221] [Homologous to ScYGR095C (RRP46) - SH]
           (406091..406849) [759 bp, 252 aa]
          Length = 252

 Score =  171 bits (433), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 140/220 (63%), Gaps = 13/220 (5%)

Query: 7   MGPLTKVDGSSLIESKQTKIICSVTGPIEPKSRQELPTQLALEIIIRPAAGVPNTREKLM 66
           +G L+ VDGSS   +     IC V+GPIEPK+RQE+P  LAL++I+RPAAG P TREKL+
Sbjct: 41  LGILSHVDGSSKFSTAAASAICGVSGPIEPKARQEIPQHLALDVIVRPAAGPPTTREKLL 100

Query: 67  EDKLRAVITPIITRYLYPRQLCQITLQILNS-GESELEFAQRELATCINATLIALIDAGI 125
           EDK+RA ITP++  +L+PRQLCQITLQ+L S G+ E      ELA  +NA  +AL+DAG+
Sbjct: 101 EDKVRATITPVVETFLHPRQLCQITLQVLKSVGQHE----HMELAVALNAAYLALLDAGV 156

Query: 126 ALNSMCACVPIALTSKEGSDETLLIIDPSDEELKSSNSVHVLALELVDQCKTVKNVLLLD 185
            L ++ + V IA+     S E  L  +PS  EL+ + SV   A  + D    V  +LLLD
Sbjct: 157 PLRAVLSAVSIAV-----STEGELTQNPSPAELQDARSVFTAAFSVAD---GVNTLLLLD 208

Query: 186 SNGDFNEKDLFNILESGEVEVLKLGKQIRHIVESKINSDI 225
            NG F E  +  +LE  E E ++L  ++RH V+ K+  D 
Sbjct: 209 GNGTFEESTVSKVLELAEKECVRLAGELRHAVKEKLEKDF 248

>ACR035W [1083] [Homologous to ScYGR195W (SKI6) - SH]
           complement(422233..422973) [741 bp, 246 aa]
          Length = 246

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 62/140 (44%), Gaps = 20/140 (14%)

Query: 11  TKVDGSSLIESKQTKIICSVTGPIEPKSRQEL-PTQLALEIII---------RPAAGVPN 60
           T  DGSS +E    K+I  VTGP EP  R ++ P++  L + +         R   G  N
Sbjct: 34  TAADGSSYLEQGNNKLITLVTGPHEPALRSQVNPSKATLTVTVNMTKFAAAERSKTGHKN 93

Query: 61  TREKL-MEDKLRAVITPIITRYLYPRQLCQITLQIL-NSGESELEFAQRELATCINATLI 118
            R  L M+  L       +   LYPR    + + +L N G          L + IN   +
Sbjct: 94  ERRILEMQTALVRTFEKNVMLQLYPRTAIDVQVHVLQNDGGV--------LGSMINGITL 145

Query: 119 ALIDAGIALNSMCACVPIAL 138
           ALIDAGIA+    + + + L
Sbjct: 146 ALIDAGIAMYEYISGISVGL 165

>Kwal_33.15453
          Length = 245

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 60/136 (44%), Gaps = 18/136 (13%)

Query: 14  DGSSLIESKQTKIICSVTGPIEPKSRQELP-TQLALEIII---------RPAAGVPNTRE 63
           DGSS +E    KII  V GP EPK R ++   Q  L + +         R  +   N R 
Sbjct: 37  DGSSYLEQGNNKIITLVNGPQEPKLRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERR 96

Query: 64  KL-MEDKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIALID 122
            L M+  L       +  +LYPR    I + +L   +  L      + + IN   +ALID
Sbjct: 97  VLEMQTALVRTFEKNVMLHLYPRTQIDIQIHVLQQ-DGGL------MGSLINGITLALID 149

Query: 123 AGIALNSMCACVPIAL 138
           AGIA+    + V I L
Sbjct: 150 AGIAMYDYISGVSIGL 165

>KLLA0D09625g complement(813773..814510) highly similar to sp|P46948
           Saccharomyces cerevisiae YGR195w SKI6 3 -5
           exoribonuclease required for 3 end formation of 5.8S
           rRNA singleton, start by similarity
          Length = 245

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 59/137 (43%), Gaps = 18/137 (13%)

Query: 13  VDGSSLIESKQTKIICSVTGPIEPKSRQELPT-QLALEIII---------RPAAGVPNTR 62
            DGSS +E    KII  V GP EP SR ++ T Q  L + I         R  +   N R
Sbjct: 36  ADGSSYLEQGNNKIITLVAGPQEPSSRSQVNTKQATLSVTINLTKFAKMERSKSSHKNER 95

Query: 63  EKL-MEDKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIALI 121
             L  +  L       +  +LYPR    I +Q+       L+     L   +N   +ALI
Sbjct: 96  RTLEWQASLVRTFEKNLMLHLYPR--TSIDVQV-----HALQLDGGILGAMLNGITLALI 148

Query: 122 DAGIALNSMCACVPIAL 138
           DAGIA+    + V + L
Sbjct: 149 DAGIAMYDFVSGVSVGL 165

>Sklu_1267.2 YGR195W, Contig c1267 529-1350
          Length = 273

 Score = 52.8 bits (125), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 56/137 (40%), Gaps = 18/137 (13%)

Query: 13  VDGSSLIESKQTKIICSVTGPIEPKSR-QELPTQLALEIII---------RPAAGVPNTR 62
            DGSS +E    KII  V GP EP  R Q  P+   + + +         R  +   N R
Sbjct: 63  ADGSSYLEQGNNKIITLVNGPQEPALRSQTNPSHATMNVTVNITKFSKMERSKSSHKNER 122

Query: 63  EKL-MEDKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIALI 121
             L M+  L       +   LYPR L  I + +L             +   IN   +ALI
Sbjct: 123 RVLEMQTSLVRTFEKNVMLQLYPRTLIDIQIHVLQQDGG-------IMGALINGITLALI 175

Query: 122 DAGIALNSMCACVPIAL 138
           DAGIA+    + V I L
Sbjct: 176 DAGIAMYDYISGVSIGL 192

>Scas_647.7
          Length = 246

 Score = 52.0 bits (123), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 60/136 (44%), Gaps = 18/136 (13%)

Query: 14  DGSSLIESKQTKIICSVTGPIEPKSRQELPTQLA-LEIII---------RPAAGVPNTRE 63
           DGSS +E    K+I  V GP EP  R ++ T+ A L+I +         R  +   N R 
Sbjct: 37  DGSSYLEQGNNKVITLVKGPKEPTLRSQMDTEKAILKISVNITQFSKFERSKSSHKNERR 96

Query: 64  KL-MEDKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIALID 122
            L M+  L       +   +YPR L  I + +L             + + IN   +ALID
Sbjct: 97  VLEMQTALIRTFEKNVMLNIYPRTLIDIEVHVLQQDGG-------IMGSLINGITLALID 149

Query: 123 AGIALNSMCACVPIAL 138
           AGIA+    + V I L
Sbjct: 150 AGIAMYDYISGVSIGL 165

>CAGL0G09317g complement(890158..890898) highly similar to sp|P46948
           Saccharomyces cerevisiae YGR195w SKI6 3-5
           exoribonuclease required for 3 end formation of 5.8S
           rRNA, start by similarity
          Length = 246

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 60/136 (44%), Gaps = 18/136 (13%)

Query: 14  DGSSLIESKQTKIICSVTGPIEPKSRQELPTQLA-LEIII---------RPAAGVPNTRE 63
           DGSS +E    K+I  V GP EP  + ++  Q A L++ +         R  +   N R 
Sbjct: 37  DGSSYLEQGNNKVITLVKGPKEPTLKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERR 96

Query: 64  KL-MEDKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIALID 122
            L M+  L       +  ++YPR L  I + +L             + T +N   +ALID
Sbjct: 97  VLEMQTALVRTFEKNVMLHVYPRTLIDIEIHVLQQDGG-------IMGTLLNGISLALID 149

Query: 123 AGIALNSMCACVPIAL 138
           AGIA+    + + + L
Sbjct: 150 AGIAMYDYVSGISVGL 165

>YGR195W (SKI6) [2145] chr7 (888885..889625) Component of the
           exosome 3'-5' exoribonuclease complex involved in 3'
           processing of ribosomal 5.8S rRNA, of snoRNAs and of U4
           snRNA, and in degradation of poly(A)- mRNAs, confers
           antiviral activity by repressing replication of
           double-stranded RNA viruses [741 bp, 246 aa]
          Length = 246

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 59/136 (43%), Gaps = 18/136 (13%)

Query: 14  DGSSLIESKQTKIICSVTGPIEPKSRQELPTQLAL----------EIIIRPAAGVPNTRE 63
           DGSS +E    KII  V GP EP+ + ++ T  AL              R  +   N R 
Sbjct: 37  DGSSYMEQGNNKIITLVKGPKEPRLKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERR 96

Query: 64  KL-MEDKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIALID 122
            L ++  L  +    +   +YPR +  I + +       LE     + + IN   +ALID
Sbjct: 97  VLEIQTSLVRMFEKNVMLNIYPRTVIDIEIHV-------LEQDGGIMGSLINGITLALID 149

Query: 123 AGIALNSMCACVPIAL 138
           AGI++    + + + L
Sbjct: 150 AGISMFDYISGISVGL 165

>AFR109W [3301] [Homologous to ScYGR158C (MTR3) - SH]
           complement(632965..633678) [714 bp, 237 aa]
          Length = 237

 Score = 34.7 bits (78), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 78/193 (40%), Gaps = 36/193 (18%)

Query: 2   SIIAQMGPLTKVDGSSLIESK-QTKIICSVTGPIEPKS-RQELPTQLALEIIIRPAAGVP 59
           S+  Q G +   +GSS +E K +T     VT    P+  R    ++ A+ +  +      
Sbjct: 43  SMFIQDGMIVNANGSSYLEVKAETHNTLLVTTAYGPRPIRGSFTSRAAISVHFKEV---- 98

Query: 60  NTREKL-------MEDKLRAVITPIITRYLYPRQLCQITLQILNSG----ESELEFAQRE 108
            T E+        M + L  V +  I    YP+    I L ++       +  L  A+  
Sbjct: 99  -TLERWDSGEVTEMCNFLNTVFSAAINVERYPKSGIDIFLNLIQHSNVRDDKTLNLAEV- 156

Query: 109 LATCINATLIALIDAGIALNSMCA-----CVPIALTSKEGSDETLLIIDPSDEELKSSNS 163
           L  CI+   +AL+DAGI L  + A     C  +A  +     ET+L     D+       
Sbjct: 157 LPDCISGITLALMDAGIELKDVVAAGRHGCNVVAFVNNA---ETILGFWQEDDS------ 207

Query: 164 VHVLALELVDQCK 176
                +E+VD+CK
Sbjct: 208 ---DVMEIVDECK 217

>CAGL0E03223g complement(297800..298546) similar to sp|P48240
           Saccharomyces cerevisiae YGR158c MTR3 involved in mRNA
           transport, start by similarity
          Length = 248

 Score = 34.3 bits (77), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 65/154 (42%), Gaps = 27/154 (17%)

Query: 3   IIAQMGPLTKVDGSSLIESKQTKI-------ICSVTGPIEPKSRQELPTQLALEIIIRPA 55
           I    G +   +GS+L+E K TKI       I SV GP     R    +Q +L I ++  
Sbjct: 41  IALHTGFIANCNGSALVEIKDTKITHHQTSLITSVYGP--KSVRGSFTSQASLSIQLKNG 98

Query: 56  AGVPNTREKLME--DKLRAVITPIITRYLYPRQLCQITLQILNSGESELE-FAQRE---- 108
                   +L E  + L ++   +I    YP+    I + I  + E  LE F ++E    
Sbjct: 99  LLEKYESRELKEVANFLTSIFNSVINLKRYPKSGIDIFIYI--TYEKSLENFKEQEPAAP 156

Query: 109 ---------LATCINATLIALIDAGIALNSMCAC 133
                    L  CI++  +ALIDA I +  + A 
Sbjct: 157 VRKSNIYKILPHCISSITMALIDADIEIIDLAAA 190

>KLLA0F18304g complement(1689187..1689897) similar to sp|P48240
           Saccharomyces cerevisiae YGR158c MTR3 involved in mRNA
           transport singleton, start by similarity
          Length = 236

 Score = 33.1 bits (74), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 60/133 (45%), Gaps = 22/133 (16%)

Query: 10  LTKVDGSSLIE-----SKQTKIICSVTGPIEPKSRQELPTQLALEIIIRPAAGVPNTREK 64
           +T  +GSS +E     S Q  ++ SV GP  P  R    ++ ++ I  +       T E 
Sbjct: 52  VTNANGSSYLEYMDGTSDQVLVMSSVFGP-RPL-RGSFQSKASVSIQFKEV-----TLEH 104

Query: 65  LMEDKLRAVIT-------PIITRYLYPRQLCQITLQIL---NSGESELEFAQRELATCIN 114
           L   +++ + T        +I    YP+    I + ++   NS  +E       L TCIN
Sbjct: 105 LNTGEIKEICTFLTNVFNAVINVEKYPKSGIDIFIDLIQHSNSNPTEEANIVNILPTCIN 164

Query: 115 ATLIALIDAGIAL 127
           +  +AL+DAGI +
Sbjct: 165 SITMALVDAGIEI 177

>Kwal_27.10972
          Length = 224

 Score = 29.6 bits (65), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 63  EKLMEDKLRAVITPIITRYLYPRQLCQITLQILNSGESE 101
           EK  E K     TP+I R++YP   C   L++ NS ++E
Sbjct: 104 EKWREYKKELGATPLIKRFIYPED-CPEVLELSNSNDNE 141

>YGR112W (SHY1) [2071] chr7 (717360..718529) Mitochondrial protein
           required for respiration, involved in assembly of the
           cytochrome c oxidase complex [1170 bp, 389 aa]
          Length = 389

 Score = 29.6 bits (65), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 12/57 (21%)

Query: 9   PLTKVDGSSLIESKQTKIICSVTGPIEPKSRQELPTQLALEIIIRP--AAGVPNTRE 63
           P T V+G+  +++  +K          P+SRQE+PT   +E   R    AGVP  R+
Sbjct: 286 PTTAVNGTQAVDNNTSK----------PRSRQEMPTDQTIEFDERQFIKAGVPIGRK 332

>YLR114C (YLR114C) [3527] chr12 complement(374945..377239) Protein
           of unknown function, has low similarity to
           uncharacterized A. fumigatus AfA5C11.11 [2295 bp, 764
           aa]
          Length = 764

 Score = 29.6 bits (65), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 156 EELKSSNSVHVLALELVDQCKTVKNVLLLDSNGDFNEKDLF 196
           E++ +SN VH+  L  V   K  +N L+ +S  D    DLF
Sbjct: 422 EDMLNSNPVHLFNLNWVQSWKETQNFLIFNSRTDDRLFDLF 462

>Scas_621.17
          Length = 239

 Score = 29.3 bits (64), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 54/123 (43%), Gaps = 9/123 (7%)

Query: 8   GPLTKVDGSSLIESKQTKIICSVTGPIEPKS-RQELPTQLALEIIIRPAA--GVPNTREK 64
           G +   +GS+LIES +  ++ SV G   PKS R    +Q  + I ++         T  K
Sbjct: 51  GVVENCNGSTLIESSKFSLLTSVYG---PKSIRGSFTSQGTITIQLKNGVVENYQTTELK 107

Query: 65  LMEDKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIALIDAG 124
            +   L  +   ++    YP+    I + ++   + ++    + +   I    +AL+D G
Sbjct: 108 EVSSWLVGIFNSVVNLENYPKSGIDIFVNLIIDKQGDI---SKLIPFLIMGICLALVDGG 164

Query: 125 IAL 127
           I +
Sbjct: 165 IEI 167

>Kwal_23.6575
          Length = 504

 Score = 29.6 bits (65), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 17/21 (80%)

Query: 139 TSKEGSDETLLIIDPSDEELK 159
           T  EGSD T++ +DPSDE+L+
Sbjct: 473 TFVEGSDSTVVELDPSDEKLR 493

>Sklu_1879.1 YGR158C, Contig c1879 329-1045 reverse complement
          Length = 238

 Score = 28.9 bits (63), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 65/145 (44%), Gaps = 17/145 (11%)

Query: 2   SIIAQMGPLTKVDGSSLIE-SKQTK------IICSVTGPIEPKSRQELPTQLALEIIIRP 54
           S+  + G ++  +GSS +E + + K      +I SV GP  P  R    ++ +L I  + 
Sbjct: 40  SLFIESGLISNSNGSSYLEVTDENKTQYHALLITSVYGP-RP-IRGSFTSRASLTIQFKE 97

Query: 55  AAGVPNTREKLME--DKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELA-- 110
                 T  ++ E  + L  +   ++    YP+    I L ++    S  +  + ++A  
Sbjct: 98  VTLEKFTTGEIKEVCNFLTNIFNAVVNLERYPKSGIDIFLNLIQ--HSSTDNQETDIASV 155

Query: 111 --TCINATLIALIDAGIALNSMCAC 133
             TCIN   +AL +AGI +  M + 
Sbjct: 156 IPTCINGITLALTNAGIEILDMVSA 180

>YGR158C (MTR3) [2112] chr7 complement(805272..806024) Protein
           involved in mRNA transport, component of the exosome
           complex responsible for 3'-5' degradation of mRNA and
           for 3'-end processing of multiple small RNA species [753
           bp, 250 aa]
          Length = 250

 Score = 27.7 bits (60), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 61/146 (41%), Gaps = 21/146 (14%)

Query: 6   QMGPLTKVDGSSLIESK----QTKIICSVTGPIEPKSRQELPTQLALEIIIRPAA-GVPN 60
             G +   +GS+L+E++    QT +I +V GP     R    +Q  + I ++       N
Sbjct: 49  HTGFIENCNGSALVEARSLGHQTSLITAVYGP--RSIRGSFTSQGTISIQLKNGLLEKYN 106

Query: 61  TRE-KLMEDKLRAVITPIITRYLYPRQLCQITLQIL---------NSGESELEFAQRELA 110
           T E K +   L  +   ++    YP+    I + +             +S+ +    +++
Sbjct: 107 TNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNNPQDDDSQSKMMSSQIS 166

Query: 111 T----CINATLIALIDAGIALNSMCA 132
           +    CI +  +AL DAGI L  M  
Sbjct: 167 SLIPHCITSITLALADAGIELVDMAG 192

>AGL348W [3964] [Homologous to NOHBY] complement(56615..58804) [2190
           bp, 729 aa]
          Length = 729

 Score = 27.7 bits (60), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 31/58 (53%)

Query: 18  LIESKQTKIICSVTGPIEPKSRQELPTQLALEIIIRPAAGVPNTREKLMEDKLRAVIT 75
           LI S+  + IC+ +  +EPK++ ++ T+L  ++     +   N R    ED L A+I 
Sbjct: 444 LITSQMYEQICASSAKMEPKTQLKIATKLIAQLEKYRLSLPENMRPGTKEDDLDAIIA 501

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,759,602
Number of extensions: 277800
Number of successful extensions: 898
Number of sequences better than 10.0: 33
Number of HSP's gapped: 881
Number of HSP's successfully gapped: 33
Length of query: 228
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 130
Effective length of database: 13,203,545
Effective search space: 1716460850
Effective search space used: 1716460850
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)