Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_716.2931631616810.0
YGR096W (TPC1)3143188151e-108
CAGL0G03135g3073107681e-101
Kwal_23.39653073047013e-91
KLLA0D15015g3173066971e-90
AAR036W3173046414e-82
CAGL0J01661g3273382625e-26
Sklu_2363.23233102609e-26
Kwal_14.22103153212582e-25
YPR011C3263342573e-25
Scas_709.93653062434e-23
YHR002W (LEU5)3573292355e-22
Scas_717.203563502321e-21
CAGL0K08250g2972962291e-21
CAGL0J02002g3613032294e-21
AGL047C3163062257e-21
Sklu_2334.23193012222e-20
CAGL0K02915g3423292223e-20
CAGL0J05522g5193292253e-20
YJR095W (SFC1)3223012203e-20
YIL006W3732962206e-20
KLLA0C11363g5173262201e-19
AGL311C3623212171e-19
Sklu_2037.23103142152e-19
ADL009W3793082153e-19
Scas_379.23013062115e-19
Kwal_55.213353172962107e-19
Scas_691.43343142091e-18
YNL083W5453272112e-18
Scas_662.123083162072e-18
Sklu_2374.75133262112e-18
Scas_582.73293132064e-18
CAGL0L05742g3053112054e-18
KLLA0E02772g2843012026e-18
YEL006W3353182046e-18
Kwal_55.208683803082048e-18
CAGL0M09020g3483332039e-18
Scas_721.1293233311974e-17
Kwal_23.30425423271997e-17
YKL120W (OAC1)3243311958e-17
YBR085W (AAC3)3072991958e-17
Sklu_1926.23053211949e-17
Scas_578.3*5241961989e-17
Scas_632.92923121931e-16
KLLA0B12826g3193241941e-16
Kwal_26.79723583231913e-16
ACR260W3113171904e-16
Scas_667.223063211904e-16
YKR052C (MRS4)3043171904e-16
YJL133W (MRS3)3142941904e-16
AER184W3052871894e-16
YOR222W (ODC2)3073041886e-16
Sklu_2127.52782971861e-15
CAGL0K11616g3203231861e-15
AGL065C3353231871e-15
Kwal_27.124813042941861e-15
AGR383W2933151851e-15
AER419W4933171882e-15
Kwal_33.140503143081852e-15
CAGL0D01606g3053231852e-15
Sklu_2430.103243261842e-15
CAGL0K02365g9193011883e-15
KLLA0E15532g3263301833e-15
Kwal_27.125993043251824e-15
KLLA0F03212g3053051816e-15
KLLA0E18788g3813431826e-15
YBL030C (PET9)3182861808e-15
Sklu_2115.42993231798e-15
Kwal_23.47313143201791e-14
KLLA0F04697g3073131772e-14
YIL134W (FLX1)3113291762e-14
Kwal_26.76533253181763e-14
KLLA0D14036g4313301765e-14
KLLA0B08503g3033211735e-14
CAGL0F07711g3682541746e-14
YOR130C (ORT1)2923151727e-14
CAGL0F04213g3062901711e-13
CAGL0G08910g2892991702e-13
YMR056C (AAC1)3092881702e-13
Scas_714.183053171702e-13
Scas_718.243372901702e-13
KLLA0E13453g9061961713e-13
Kwal_47.182163333271675e-13
KLLA0D07073g2973021649e-13
CAGL0B04543g3172541641e-12
Sklu_2432.52882921631e-12
KLLA0E23705g3683181632e-12
ADL264C3293101622e-12
Scas_718.53243321613e-12
YPR058W (YMC1)3073261613e-12
KLLA0E18810g3773061614e-12
Scas_667.43082871595e-12
ADL049W9123001617e-12
CAGL0K10362g3013161577e-12
YER053C3001901578e-12
Scas_640.253063051561e-11
Sklu_1149.22963161561e-11
Kwal_47.173218812051581e-11
Kwal_26.86692962991552e-11
YOR100C (CRC1)3273161552e-11
AEL253W3653211552e-11
YPR021C (AGC1)9022951562e-11
Kwal_33.129883033151532e-11
Scas_645.93912151543e-11
KLLA0E12353g3052971533e-11
Sklu_2431.53703181543e-11
Kwal_27.114192983171524e-11
Scas_697.473283121508e-11
Kwal_23.43543433611491e-10
CAGL0K12210g3113131481e-10
KLLA0E08877g2943211471e-10
KLLA0D04290g1881751422e-10
Sklu_2359.69021961482e-10
ACR109W2992991462e-10
YMR166C3683231463e-10
Scas_721.273742681463e-10
Kwal_26.79672973081435e-10
YPL134C (ODC1)3103111436e-10
Kwal_56.230113033131418e-10
Scas_589.103163061419e-10
Sklu_2075.33452991421e-09
CAGL0H10538g2973221411e-09
Scas_602.88851961422e-09
KLLA0E09680g3072971392e-09
YBR291C (CTP1)2993081392e-09
AER366W2931911392e-09
Sklu_2442.82752081382e-09
YDL198C (YHM1)3003101382e-09
AFR146W2813101373e-09
Kwal_33.154463053021373e-09
Scas_715.453052051373e-09
AFR131C3443391373e-09
Scas_489.42973091363e-09
CAGL0L02079g2973171347e-09
Kwal_33.155973051961331e-08
KLLA0F17864g3073131321e-08
Scas_669.63732961322e-08
Kwal_55.211063283221312e-08
CAGL0M05225g3813231303e-08
CAGL0J09790g3003151293e-08
Kwal_27.120813693261294e-08
CAGL0B03883g3063131275e-08
KLLA0F13464g3002311275e-08
YLR348C (DIC1)2983031275e-08
KLLA0A09383g3662611276e-08
Sklu_1119.13071961267e-08
Kwal_27.116262993101259e-08
Scas_673.173141781251e-07
AFL196W3613001251e-07
CAGL0F08305g3742631251e-07
YGR257C (MTM1)3662021251e-07
Scas_613.241771681211e-07
Scas_558.22892021241e-07
KLLA0D09889g3642861251e-07
KLLA0C13431g3283131241e-07
AGR191W2982341241e-07
Scas_687.15*3281951232e-07
Sklu_2117.22982331232e-07
YBR192W (RIM2)3773311223e-07
CAGL0H03839g2822081213e-07
Sklu_2398.43093211213e-07
Sklu_2433.84201621223e-07
YBR104W (YMC2)3293411214e-07
Sklu_2260.53021861197e-07
KLLA0B14454g3051971179e-07
CAGL0C02013g3291901171e-06
Scas_328.12271471151e-06
KLLA0D04950g2741981161e-06
Kwal_23.29133203121161e-06
Kwal_0.2322741771151e-06
Sklu_1275.13113091162e-06
Scas_562.123002231152e-06
YJR077C (MIR1)3111811152e-06
AGL064W296851142e-06
Sklu_2435.23443291143e-06
YNL003C (PET8)2842141133e-06
Scas_702.103022601134e-06
CAGL0J04114g3031821124e-06
KLLA0D04312g1031041045e-06
AAL014C2711971091e-05
YPR128C (ANT1)3283071091e-05
CAGL0F00231g3071811082e-05
Kwal_23.57573071851062e-05
KLLA0E02750g3042011062e-05
Kwal_23.35293953071073e-05
KLLA0B11319g3552061054e-05
Kwal_55.213383231851045e-05
AER450C3081681028e-05
KLLA0A00979g3431501021e-04
Kwal_47.192282811531001e-04
Sklu_2127.4323267992e-04
Scas_705.9323304992e-04
CAGL0D04774g322311964e-04
AFR253W344218956e-04
CAGL0G01166g295297948e-04
YDL119C307326930.001
YFR045W285203900.002
Scas_671.1*12346810.012
Scas_660.17497277830.026
ABL023W309299800.040
AFR147C315275730.29
CAGL0K06545g512249740.30
KLLA0F08547g308189681.5
KLLA0E22880g43685671.9
AEL060C429123671.9
AFR542W310114662.7
Scas_696.931282643.9
KLLA0C01914g25246644.1
Kwal_34.1590731262627.1
Scas_713.2087651637.1
Sklu_2194.331262627.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_716.29
         (316 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_716.29                                                           652   0.0  
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...   318   e-108
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...   300   e-101
Kwal_23.3965                                                          274   3e-91
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...   273   1e-90
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....   251   4e-82
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...   105   5e-26
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                         104   9e-26
Kwal_14.2210                                                          103   2e-25
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...   103   3e-25
Scas_709.9                                                             98   4e-23
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    95   5e-22
Scas_717.20                                                            94   1e-21
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    93   1e-21
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    93   4e-21
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    91   7e-21
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         90   2e-20
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    90   3e-20
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    91   3e-20
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    89   3e-20
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    89   6e-20
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    89   1e-19
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    88   1e-19
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         87   2e-19
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    87   3e-19
Scas_379.2                                                             86   5e-19
Kwal_55.21335                                                          86   7e-19
Scas_691.4                                                             85   1e-18
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    86   2e-18
Scas_662.12                                                            84   2e-18
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       86   2e-18
Scas_582.7                                                             84   4e-18
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    84   4e-18
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    82   6e-18
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    83   6e-18
Kwal_55.20868                                                          83   8e-18
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    83   9e-18
Scas_721.129                                                           80   4e-17
Kwal_23.3042                                                           81   7e-17
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    80   8e-17
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    80   8e-17
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          79   9e-17
Scas_578.3*                                                            81   9e-17
Scas_632.9                                                             79   1e-16
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    79   1e-16
Kwal_26.7972                                                           78   3e-16
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    78   4e-16
Scas_667.22                                                            78   4e-16
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    78   4e-16
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    78   4e-16
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    77   4e-16
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    77   6e-16
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         76   1e-15
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    76   1e-15
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    77   1e-15
Kwal_27.12481                                                          76   1e-15
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    76   1e-15
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    77   2e-15
Kwal_33.14050                                                          76   2e-15
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    76   2e-15
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         75   2e-15
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    77   3e-15
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    75   3e-15
Kwal_27.12599                                                          75   4e-15
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    74   6e-15
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    75   6e-15
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    74   8e-15
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            74   8e-15
Kwal_23.4731                                                           74   1e-14
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    73   2e-14
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    72   2e-14
Kwal_26.7653                                                           72   3e-14
KLLA0D14036g complement(1203522..1204817) some similarities with...    72   5e-14
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    71   5e-14
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    72   6e-14
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    71   7e-14
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    70   1e-13
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    70   2e-13
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    70   2e-13
Scas_714.18                                                            70   2e-13
Scas_718.24                                                            70   2e-13
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    70   3e-13
Kwal_47.18216                                                          69   5e-13
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    68   9e-13
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    68   1e-12
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       67   1e-12
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    67   2e-12
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    67   2e-12
Scas_718.5                                                             67   3e-12
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    67   3e-12
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    67   4e-12
Scas_667.4                                                             66   5e-12
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    67   7e-12
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    65   7e-12
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    65   8e-12
Scas_640.25                                                            65   1e-11
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         65   1e-11
Kwal_47.17321                                                          65   1e-11
Kwal_26.8669                                                           64   2e-11
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    64   2e-11
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    64   2e-11
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    65   2e-11
Kwal_33.12988                                                          64   2e-11
Scas_645.9                                                             64   3e-11
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    64   3e-11
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            64   3e-11
Kwal_27.11419                                                          63   4e-11
Scas_697.47                                                            62   8e-11
Kwal_23.4354                                                           62   1e-10
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    62   1e-10
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    61   1e-10
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    59   2e-10
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          62   2e-10
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    61   2e-10
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    61   3e-10
Scas_721.27                                                            61   3e-10
Kwal_26.7967                                                           60   5e-10
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    60   6e-10
Kwal_56.23011                                                          59   8e-10
Scas_589.10                                                            59   9e-10
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                59   1e-09
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    59   1e-09
Scas_602.8                                                             59   2e-09
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    58   2e-09
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    58   2e-09
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    58   2e-09
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          58   2e-09
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    58   2e-09
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    57   3e-09
Kwal_33.15446                                                          57   3e-09
Scas_715.45                                                            57   3e-09
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    57   3e-09
Scas_489.4                                                             57   3e-09
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    56   7e-09
Kwal_33.15597                                                          56   1e-08
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    55   1e-08
Scas_669.6                                                             55   2e-08
Kwal_55.21106                                                          55   2e-08
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    55   3e-08
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    54   3e-08
Kwal_27.12081                                                          54   4e-08
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    54   5e-08
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    54   5e-08
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    54   5e-08
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    54   6e-08
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             53   7e-08
Kwal_27.11626                                                          53   9e-08
Scas_673.17                                                            53   1e-07
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    53   1e-07
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    53   1e-07
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    53   1e-07
Scas_613.24                                                            51   1e-07
Scas_558.2                                                             52   1e-07
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    53   1e-07
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    52   1e-07
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    52   1e-07
Scas_687.15*                                                           52   2e-07
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            52   2e-07
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    52   3e-07
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    51   3e-07
Sklu_2398.4 , Contig c2398 9476-10405                                  51   3e-07
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       52   3e-07
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    51   4e-07
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         50   7e-07
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    50   9e-07
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    50   1e-06
Scas_328.1                                                             49   1e-06
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    49   1e-06
Kwal_23.2913                                                           49   1e-06
Kwal_0.232                                                             49   1e-06
Sklu_1275.1 , Contig c1275 314-1249                                    49   2e-06
Scas_562.12                                                            49   2e-06
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    49   2e-06
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    49   2e-06
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         49   3e-06
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    48   3e-06
Scas_702.10                                                            48   4e-06
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    48   4e-06
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    45   5e-06
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    47   1e-05
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    47   1e-05
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    46   2e-05
Kwal_23.5757                                                           45   2e-05
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    45   2e-05
Kwal_23.3529                                                           46   3e-05
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    45   4e-05
Kwal_55.21338                                                          45   5e-05
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    44   8e-05
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    44   1e-04
Kwal_47.19228                                                          43   1e-04
Sklu_2127.4 , Contig c2127 6322-7293                                   43   2e-04
Scas_705.9                                                             43   2e-04
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    42   4e-04
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    41   6e-04
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    41   8e-04
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    40   0.001
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    39   0.002
Scas_671.1*                                                            36   0.012
Scas_660.17                                                            37   0.026
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    35   0.040
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    33   0.29 
CAGL0K06545g complement(641129..642667) similar to tr|Q03327 Sac...    33   0.30 
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    31   1.5  
KLLA0E22880g complement(2033077..2034387) similar to ca|CA2800|I...    30   1.9  
AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, ...    30   1.9  
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    30   2.7  
Scas_696.9                                                             29   3.9  
KLLA0C01914g 152834..153592 highly similar to sp|Q06287 Saccharo...    29   4.1  
Kwal_34.15907                                                          28   7.1  
Scas_713.20                                                            29   7.1  
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            28   7.5  

>Scas_716.29
          Length = 316

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/316 (100%), Positives = 316/316 (100%)

Query: 1   MTNIDDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQA 60
           MTNIDDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQA
Sbjct: 1   MTNIDDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQA 60

Query: 61  PSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQL 120
           PSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQL
Sbjct: 61  PSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQL 120

Query: 121 QSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTA 180
           QSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTA
Sbjct: 121 QSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTA 180

Query: 181 SMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRR 240
           SMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRR
Sbjct: 181 SMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRR 240

Query: 241 RIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVP 300
           RIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVP
Sbjct: 241 RIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVP 300

Query: 301 STVVSLWAYETVMRLY 316
           STVVSLWAYETVMRLY
Sbjct: 301 STVVSLWAYETVMRLY 316

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score =  318 bits (815), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 163/318 (51%), Positives = 227/318 (71%), Gaps = 22/318 (6%)

Query: 12  DHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSG--LLKMMK 69
           D LRKG++V   ++L+AG+VSGLLAR++ AP+DT+KIRLQL P+  G  P G  ++++ +
Sbjct: 6   DSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPA-NGLKPFGSQVMEVAR 64

Query: 70  GMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNL---FGETSDMNGQLQSLVVG 126
            MI NEG +RSFWKGN+PG+++YV YG AQFSSYS +N     FG    +  +L SLVVG
Sbjct: 65  SMIKNEG-IRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFG----LEARLHSLVVG 119

Query: 127 ALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTIT 186
           A AG+TSS VSYP DVLRTR +AN  +   S++   ++IW +EG+PGFF+G  ASM TIT
Sbjct: 120 AFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTIT 179

Query: 187 LSASILFGTYESIKIYCDEYSKESDYTNY-----LRYSASSISGVTSKMVTYPLDTIRRR 241
           L+ASI+FGTYE+I+IYCDE  K +          L +SA +I GV +K++T+PL+TIRRR
Sbjct: 180 LTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRR 239

Query: 242 IQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPS 301
           +Q  NS +++    +   + +Y SYKG  F R+GL IL+QEG+ SLY+G+ ++L KT+P+
Sbjct: 240 MQFMNSKHLEKFSRH---SSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPT 296

Query: 302 TVVSLWAYETV---MRLY 316
           T VS W YET    +R+Y
Sbjct: 297 TFVSFWGYETAIHYLRMY 314

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score =  300 bits (768), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 159/310 (51%), Positives = 211/310 (68%), Gaps = 13/310 (4%)

Query: 9   HNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMM 68
           +  DHLRK E+V  + SLVAGS+SGL ART IAPLDT+KI+LQ+ P    +  + L+   
Sbjct: 2   NKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPH--NKNANVLIN-- 57

Query: 69  KGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMN--GQLQSLVVG 126
              IL   G+R FWKGNVPG++MY++YGGAQF SY++  +      D+N   QL S +VG
Sbjct: 58  ---ILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVG 114

Query: 127 ALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTIT 186
           +LAGMTSS  SYP DVLRTRF AN    L  L      IW+ EG+ GFF GC +SM  I 
Sbjct: 115 SLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIG 174

Query: 187 LSASILFGTYESIKIYCDEYSKESDYTN---YLRYSASSISGVTSKMVTYPLDTIRRRIQ 243
           L+ +I+FG YESIKI+ +E SK SD  +    L   A  ISG TSK+ T+PLDT+RRRIQ
Sbjct: 175 LNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQ 234

Query: 244 VRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTV 303
           +RNS   + + + +   +IY+SYK   F+ +G+++++QEG LSLY+GV+MSL K+VPST 
Sbjct: 235 IRNSPNEERH-DREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTA 293

Query: 304 VSLWAYETVM 313
           +SLW+YE  M
Sbjct: 294 ISLWSYELFM 303

>Kwal_23.3965
          Length = 307

 Score =  274 bits (701), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 140/304 (46%), Positives = 200/304 (65%), Gaps = 4/304 (1%)

Query: 12  DHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGM 71
           DHLRKG++V V QSLVAG +SG+ AR V APLDTLKIRLQL+ +   Q   G+L   K +
Sbjct: 4   DHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQY-GGILVTFKRL 62

Query: 72  ILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGM 131
           +  EG +R+ WKGNVP   MY+LYG  QF+SY+  N L  + S +  Q+ + +VGAL+G 
Sbjct: 63  VRQEG-VRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSK-SQLPAQIHTGMVGALSGT 120

Query: 132 TSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASI 191
            S+  SYP DVLRTRFIAN    LS++    +EIW  EG  GFF+G ++S+ +I ++ S 
Sbjct: 121 CSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSS 180

Query: 192 LFGTYESIKIYCDEY-SKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYV 250
           +  TYES+KI+C++   ++S     L  SAS I+G+ SK + +P+DT+R+R QV +   +
Sbjct: 181 ILATYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQL 240

Query: 251 QHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
            H        + Y+SY   +F+R+ L I+ +EGLL+LY G ++ + K+VPSTVVSL  YE
Sbjct: 241 GHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300

Query: 311 TVMR 314
             +R
Sbjct: 301 WCLR 304

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score =  273 bits (697), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 140/306 (45%), Positives = 203/306 (66%), Gaps = 7/306 (2%)

Query: 12  DHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGM 71
           DHLRKGE V    S++AGSVSG+ AR   AP+DT+KIR QL+P    +   G+   ++  
Sbjct: 8   DHLRKGETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKY-KGIASTVR-T 65

Query: 72  ILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF-GETSDMNGQLQSLVVGALAG 130
           I+ E GLR+ WKGN+P T MYV+YG  QF SYS++NN++  +    + Q Q+L VGALAG
Sbjct: 66  IMKEEGLRALWKGNIPATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQGQTLTVGALAG 125

Query: 131 MTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSAS 190
           MTSS VSYP D+LRTR IAN+    +S++  C+++W  EG+ GFF G + +M T+TLS +
Sbjct: 126 MTSSVVSYPLDLLRTRLIANRTSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLSTA 185

Query: 191 ILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYV 250
           I+F TYE++ I C+ + KE  ++  +  S+  I+G  SK + +P+DT+RRR+QV NS   
Sbjct: 186 IMFLTYETVNIVCENHEKEF-WSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQVMNSKRT 244

Query: 251 QHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
            H  +      +Y  Y+  S   +   ILRQEG+ +LY+G++M LCK+VP+T +SL+ YE
Sbjct: 245 VHFTK---FPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAISLFVYE 301

Query: 311 TVMRLY 316
             M L+
Sbjct: 302 RTMDLF 307

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score =  251 bits (641), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 125/304 (41%), Positives = 192/304 (63%), Gaps = 11/304 (3%)

Query: 12  DHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGM 71
           DHLRKGE V    ++VAGSVSGL+AR+V AP+DT+KIR QL+ + +     G+L   +  
Sbjct: 14  DHLRKGEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLA-SEHKYHGILHTFR-T 71

Query: 72  ILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGM 131
           +  E G+R+ WKGNVP + MYVLYG  QF +Y++ N     ++ +  Q  SL VGALAG+
Sbjct: 72  VAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTA-AASAGLPPQAHSLAVGALAGL 130

Query: 132 TSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASI 191
            SS ++YP D+LRTR +AN+     SL    + IW+ EG  GFFRG   ++   TL+  +
Sbjct: 131 VSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRGGAWAIAATTLTTGL 190

Query: 192 LFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQ 251
           +FG YE+  I  D Y        +L  +AS  +G+ SK   +PLDT+RRR+Q+ ++ ++ 
Sbjct: 191 IFGIYETCTIAADTYG-----LPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIP 245

Query: 252 HNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYET 311
               +      Y + +G  F+ + ++++R EG+ SLY+G++M+LCK+ P+TV++LW Y+ 
Sbjct: 246 FFTRDP---GAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQR 302

Query: 312 VMRL 315
            +RL
Sbjct: 303 CLRL 306

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score =  105 bits (262), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 93/338 (27%), Positives = 153/338 (45%), Gaps = 53/338 (15%)

Query: 1   MTNIDDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQA 60
           +  I++     + L++  +V    + +AG ++G ++RTV++P + +KI LQ++ S T   
Sbjct: 6   LPAIEEENQLKNFLKQDTNV----AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN 61

Query: 61  PSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYS------FYNNLFGETS 114
             GL   + G +  E  ++  ++GN    +    Y   QF  +       F+ +  G+  
Sbjct: 62  -KGLFDAI-GQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGE 119

Query: 115 DMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKE-------IWN 167
            +N   Q L  GAL G  S   +YP D++RTR ++ Q   LS LS            +W 
Sbjct: 120 QLN-NWQRLFSGALCGGCSVVATYPLDLVRTR-LSVQTANLSKLSKSRASDIAKPPGVWK 177

Query: 168 M--------EGIPGFFRGCTASMFTITLSASILFGTYESIKIY--CDEYSKESDYTNYLR 217
           +         GI G +RG   +   I    ++ F  YE +K +   DE    S   +  +
Sbjct: 178 LLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYK 237

Query: 218 YSASSISGVTSKMVTYPLDTIRRRIQVR----NSVYVQHN-VENKIVTEIYQSYKGASFI 272
            S  +ISG  ++ +TYP D +RRR QV     N +   +N V + +VT            
Sbjct: 238 LSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVT------------ 285

Query: 273 RMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
                I + EG    Y+G++ +L K VPST VS   YE
Sbjct: 286 -----IGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score =  104 bits (260), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 89/310 (28%), Positives = 144/310 (46%), Gaps = 34/310 (10%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKG 84
           + +AG ++G ++RTV++P + +KI LQ++ S T     G++  ++  +  E G    ++G
Sbjct: 25  AFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYN-QGIVGAVR-QVYREEGTPGLFRG 82

Query: 85  NVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNG--QLQS---LVVGALAGMTSSFVSYP 139
           N    +    Y   QF  Y      F       G  QLQ+   L  GAL G  S   +YP
Sbjct: 83  NGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYP 142

Query: 140 TDVLRTRF---IANQDVALSSLSHGCKE---IWNM--------EGIPGFFRGCTASMFTI 185
            D++RTR     AN      S +H   +   +W++         GI G +RG   +   +
Sbjct: 143 LDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGV 202

Query: 186 TLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVR 245
               ++ F  YE  K +  E   ++   N+ + S  ++SG  ++ VTYP D +RRR QV 
Sbjct: 203 VPYVALNFAVYEQFKEFMPE-GTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQV- 260

Query: 246 NSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVS 305
             + +  N       E+   YK  S +   + I + EG    Y+G++ +L K +PST VS
Sbjct: 261 --LAMGGN-------ELGFRYK--SVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVS 309

Query: 306 LWAYETVMRL 315
              YE V  L
Sbjct: 310 WLVYEVVCDL 319

>Kwal_14.2210
          Length = 315

 Score =  103 bits (258), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 92/321 (28%), Positives = 143/321 (44%), Gaps = 32/321 (9%)

Query: 9   HNTDH-LRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKM 67
           H  DH  R         +  AG ++G ++RTV++P + +KI LQ++ S T     GL + 
Sbjct: 3   HLQDHSWRCALKSDAGIAFCAGGIAGAVSRTVVSPFERVKILLQVQSS-THAYNHGLFRA 61

Query: 68  MKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNN-LFGETSD-MNGQLQSLVV 125
           +K + L EG +    +GN    +    Y   QF  Y F     F +  D +      LV 
Sbjct: 62  VKQVYLEEG-VPGLLRGNGLNCIRIFPYSAVQFLVYEFCKKQWFQQNPDTVVLNWHRLVS 120

Query: 126 GALAGMTSSFVSYPTDVLRTRF------IANQDVALSSLSHGCKEIWNM--------EGI 171
           GAL G  S   +YP D++RTR       +A    A ++ +     +W +         GI
Sbjct: 121 GALCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGI 180

Query: 172 PGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMV 231
            G +RG   +   +    ++ F  YE ++ Y       +  + Y + S  +ISG  ++ +
Sbjct: 181 FGLYRGVWPTSIGVVPYVALNFAVYEQLREYIPASFDPASASLY-KLSIGAISGGVAQTI 239

Query: 232 TYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGV 291
           TYP D +RRR QV      +     K V +        + I +G    R EG    Y+G+
Sbjct: 240 TYPFDLLRRRFQVLAMGQSELGFHYKSVPD--------ALITIG----RTEGFKGYYKGL 287

Query: 292 SMSLCKTVPSTVVSLWAYETV 312
           + +L K VPST VS   YETV
Sbjct: 288 TANLFKVVPSTAVSWVVYETV 308

 Score = 68.2 bits (165), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 92/196 (46%), Gaps = 17/196 (8%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQ----------APSGLLKMMKGMIL 73
             LV+G++ G  +     PLD ++ RL ++ +   +           P G+ ++++    
Sbjct: 116 HRLVSGALCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYT 175

Query: 74  NEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSD-MNGQLQSLVVGALAGMT 132
            EGG+   ++G  P ++  V Y    F+ Y         + D  +  L  L +GA++G  
Sbjct: 176 QEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYIPASFDPASASLYKLSIGAISGGV 235

Query: 133 SSFVSYPTDVLRTRF----IANQDVAL--SSLSHGCKEIWNMEGIPGFFRGCTASMFTIT 186
           +  ++YP D+LR RF    +   ++     S+      I   EG  G+++G TA++F + 
Sbjct: 236 AQTITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVV 295

Query: 187 LSASILFGTYESIKIY 202
            S ++ +  YE+++ Y
Sbjct: 296 PSTAVSWVVYETVRDY 311

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score =  103 bits (257), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 89/334 (26%), Positives = 155/334 (46%), Gaps = 41/334 (12%)

Query: 1   MTNIDDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQA 60
           +T ++      D L++  ++    + +AG V+G ++RTV++P + +KI LQ++ S T   
Sbjct: 5   LTVLEQPNSIKDFLKQDSNI----AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN 60

Query: 61  PSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQ- 119
             G+   ++  + +E G +  ++GN    +    Y   QF  Y          +  NGQ 
Sbjct: 61  -RGIFSSIR-QVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQE 118

Query: 120 ----LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKE-------IWNM 168
                Q L  GAL G  S   +YP D+++TR ++ Q   LSSL+    +       IW +
Sbjct: 119 QLTNTQRLFSGALCGGCSVVATYPLDLIKTR-LSIQTANLSSLNRSKAKSISKPPGIWQL 177

Query: 169 --------EGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYS--KESDYTNYLRY 218
                    G+ G +RG   +   +    ++ F  YE ++ +    S  + S  +N  + 
Sbjct: 178 LSETYRLEGGLRGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKL 237

Query: 219 SASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNI 278
           +  +ISG  ++ +TYP D +RRR QV   + +  N      T ++ +          + I
Sbjct: 238 TIGAISGGVAQTITYPFDLLRRRFQV---LAMGGNELGFRYTSVWDAL---------VTI 285

Query: 279 LRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETV 312
            R EG+   Y+G++ +L K VPST VS   YE V
Sbjct: 286 GRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVV 319

>Scas_709.9
          Length = 365

 Score = 98.2 bits (243), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 80/306 (26%), Positives = 149/306 (48%), Gaps = 33/306 (10%)

Query: 19  DVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP--SGLLKMMKGMILNEG 76
           D K++   ++G+++G L+  ++ PLD  K RLQ +   + + P   G+L  M  ++++EG
Sbjct: 63  DPKITA--LSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEG 120

Query: 77  GLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFV 136
            +R  +KG +P  + Y       FS Y F  +L+      +  +        AG  S+ +
Sbjct: 121 -VRGLYKGLIPIILGYFPTWMIYFSVYEFAKDLYPRVLPNSDFISHSCSAITAGAASTVL 179

Query: 137 SYPTDVLRTRFIANQDVALSSLSH-----GCKEIWNMEGIPGFFRGCTASMFTITLSASI 191
           + P  V++TR +    +  S   +       K+I   EG+   + G   SMF + L  +I
Sbjct: 180 TNPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGL-LHVAI 238

Query: 192 LFGTYESIK--IYCD-----EYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQV 244
            F  YE +K  ++CD       S+E          ASS S + + ++TYP + +R R+Q+
Sbjct: 239 HFPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQL 298

Query: 245 RNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVV 304
           ++   +    ++K++  I ++Y             R EGLL  Y G + +L +TVP++ +
Sbjct: 299 KSDKLLI--SKHKLLDLIKRTY-------------RYEGLLGFYSGFATNLLRTVPASAI 343

Query: 305 SLWAYE 310
           +L ++E
Sbjct: 344 TLVSFE 349

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 95.1 bits (235), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 85/329 (25%), Positives = 140/329 (42%), Gaps = 52/329 (15%)

Query: 22  VSQSLVAGSVSGLLARTVIAPLDTLKIRLQL-RPSYTGQAPS--GLLKMMKGMILNEGGL 78
           + +S +AG +SG  A+T+IAPLD +KI  Q   P YT    S  GL++  K + +N+G +
Sbjct: 33  IVRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDG-V 91

Query: 79  RSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSY 138
           R F++G+    +    Y   +F +Y    N    + +     + LV G+LAG+ S F++Y
Sbjct: 92  RGFFQGHSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFESHWRRLVSGSLAGLCSVFITY 151

Query: 139 PTDVLRTRFIANQDVALSSLSHGCKEIWNMEG---------IP-------GFFRG----- 177
           P D++R R     +     L    K+I+             IP        F+RG     
Sbjct: 152 PLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPTV 211

Query: 178 ------CTASMFTITLSASIL----FGTYESIKIYCDEYSK--ESDYTNYLRYSASSIS- 224
                    S F   L   +L    F  Y  +++  D+  +  +      LR  A  IS 
Sbjct: 212 LGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAELISG 271

Query: 225 ---GVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQ 281
              G+ S+   YP + IRRR+QV           + +  +    +K  S   +   I ++
Sbjct: 272 GLAGMASQTAAYPFEIIRRRLQV-----------SALSPKTMYDHKFQSISEIAHIIFKE 320

Query: 282 EGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
            G+   + G+S+   K  P    S + YE
Sbjct: 321 RGVRGFFVGLSIGYIKVTPMVACSFFVYE 349

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 91/219 (41%), Gaps = 42/219 (19%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMM------KGMILNE-- 75
           + LV+GS++GL +  +  PLD +++RL     +       ++K +        +I N+  
Sbjct: 134 RRLVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYI 193

Query: 76  ----GGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNL-----FGETSDM----NGQLQ- 121
                   +F++G VP  +  + Y G  F ++   +++     F   S +    + +L+ 
Sbjct: 194 PNWFCHWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELER 253

Query: 122 -------------SLVVGALAGMTSSFVSYPTDVLRTRFIANQ-------DVALSSLSHG 161
                         L+ G LAGM S   +YP +++R R   +        D    S+S  
Sbjct: 254 VQKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEI 313

Query: 162 CKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIK 200
              I+   G+ GFF G +     +T   +  F  YE +K
Sbjct: 314 AHIIFKERGVRGFFVGLSIGYIKVTPMVACSFFVYERMK 352

 Score = 34.7 bits (78), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 38/95 (40%), Gaps = 16/95 (16%)

Query: 220 ASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGA--SFIRMGLN 277
           A  ISG  +K +  PLD I+   Q  N  Y +              Y G+    +    +
Sbjct: 39  AGGISGSCAKTLIAPLDRIKILFQTSNPHYTK--------------YTGSLIGLVEAAKH 84

Query: 278 ILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETV 312
           I   +G+   +QG S +L +  P   V   AYE +
Sbjct: 85  IWINDGVRGFFQGHSATLLRIFPYAAVKFVAYEQI 119

>Scas_717.20
          Length = 356

 Score = 94.0 bits (232), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 88/350 (25%), Positives = 149/350 (42%), Gaps = 54/350 (15%)

Query: 2   TNIDDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQL-RPSYTGQA 60
           TN    + N   + K     +++S +AG +SG  A+T+IAPLD +KI  Q   P YT  A
Sbjct: 12  TNEPTRKRNQMPIDKNSLEYITRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYA 71

Query: 61  PS--GLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNG 118
            S  GL +  K + LN+G +R F++G+    M    Y   +F +Y    N    + +   
Sbjct: 72  GSLVGLKEAAKHIWLNDG-IRGFFQGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYES 130

Query: 119 QLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEG-------- 170
             + L+ G+LAG+ S F +YP D++R R     +    SL    K I+            
Sbjct: 131 HWRRLMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKG 190

Query: 171 -IP-------GFFRGCTASMFTITLSASILFGTYESIK-------------IYCDEYSKE 209
            IP        F+RG T ++  +   A + F  ++ +              +   E  +E
Sbjct: 191 YIPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQE 250

Query: 210 SDYTNYLRYS--------ASSISGVTSKMVTYPLDTIRRRIQVRN-SVYVQHNVENKIVT 260
             +  + R          +  ++G+ S+   YP + IRRR+QV   SV   ++   + ++
Sbjct: 251 ERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSIS 310

Query: 261 EIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
           EI +             I ++ G    + G+S+   K  P    S + YE
Sbjct: 311 EIAKI------------IYKERGWRGFFVGLSIGYIKVTPMVACSFFVYE 348

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 89/219 (40%), Gaps = 42/219 (19%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMM-----------KGMI 72
           + L++GS++GL +     PLD +++RL     +   +  GL+K +           KG I
Sbjct: 133 RRLMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYI 192

Query: 73  LNE-GGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF---------------GETSDM 116
            N      +F++G  P  +  + Y G  F ++   +++                 E  + 
Sbjct: 193 PNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEER 252

Query: 117 NGQLQ--------SLVVGALAGMTSSFVSYPTDVLRTRFIANQ-------DVALSSLSHG 161
           + + Q         L+ G LAGM S   +YP +++R R   +        D    S+S  
Sbjct: 253 HFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEI 312

Query: 162 CKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIK 200
            K I+   G  GFF G +     +T   +  F  YE +K
Sbjct: 313 AKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYERMK 351

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 38/95 (40%), Gaps = 16/95 (16%)

Query: 220 ASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGA--SFIRMGLN 277
           A  ISG  +K +  PLD I+   Q  N  Y +              Y G+         +
Sbjct: 38  AGGISGSCAKTLIAPLDRIKILFQTSNPHYTK--------------YAGSLVGLKEAAKH 83

Query: 278 ILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETV 312
           I   +G+   +QG S++L +  P   V   AYE +
Sbjct: 84  IWLNDGIRGFFQGHSVTLMRIFPYAAVKFVAYEQI 118

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 92.8 bits (229), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 74/296 (25%), Positives = 135/296 (45%), Gaps = 31/296 (10%)

Query: 22  VSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSF 81
           +   L+AG+ +G++  +V+ P+D +K R+Q   S +G A  GL+K +  +   EG L + 
Sbjct: 16  LHHQLLAGAFAGIMEHSVLFPVDAIKTRIQ--SSSSGAATQGLIKQISKITTAEGSL-AL 72

Query: 82  WKGNVPGTMMYVLYGGAQ-----FSSYSFYNNLFGETSDMNGQ--LQSLVVGALAGMTSS 134
           WKG     +  V+ G        F++Y F  +   +  DM+    +++ + G  A   + 
Sbjct: 73  WKG-----VQSVILGAGPAHAVYFATYEFSKSKLIDPQDMHTHQPIKTAISGMAATTVAD 127

Query: 135 FVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFG 194
            +  P DV++ R   N      S+ H  K I++ EG   F+     ++      A+  F 
Sbjct: 128 ALMNPFDVIKQRMQLNTR---ESVWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFA 184

Query: 195 TYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNV 254
            YES   + +     ++Y  ++   +  +SG T   +T PLD I+  +QVR S      V
Sbjct: 185 IYESATKFMN---PSNEYNPFIHCISGGLSGATCAAITTPLDCIKTVLQVRGS----ETV 237

Query: 255 ENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
            N+I+ +        +F R    I +  G     +G+   +   +P+T +S  +YE
Sbjct: 238 SNEIMKQ------ANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYE 287

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 79/202 (39%), Gaps = 34/202 (16%)

Query: 121 QSLVVGALAGMTSSFVSYPTDVLRTRFIANQD-VALSSLSHGCKEIWNMEGIPGFFRGCT 179
             L+ GA AG+    V +P D ++TR  ++    A   L     +I   EG    ++G  
Sbjct: 18  HQLLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWKGVQ 77

Query: 180 ASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSA--SSISGVTSKMVT----Y 233
           + +     + ++ F TYE  K      SK  D  +   +    ++ISG+ +  V      
Sbjct: 78  SVILGAGPAHAVYFATYEFSK------SKLIDPQDMHTHQPIKTAISGMAATTVADALMN 131

Query: 234 PLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSM 293
           P D I++R+Q+     V H      VT+               NI  +EG  + Y     
Sbjct: 132 PFDVIKQRMQLNTRESVWH------VTK---------------NIYHKEGFAAFYYSYPT 170

Query: 294 SLCKTVPSTVVSLWAYETVMRL 315
           +L   +P    +   YE+  + 
Sbjct: 171 TLVMNIPFAAFNFAIYESATKF 192

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/197 (19%), Positives = 83/197 (42%), Gaps = 21/197 (10%)

Query: 18  EDVKVSQSLVAGSVSGLLARTV----IAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMIL 73
           +D+   Q  +  ++SG+ A TV    + P D +K R+QL           +  + K  I 
Sbjct: 105 QDMHTHQP-IKTAISGMAATTVADALMNPFDVIKQRMQLNTR------ESVWHVTKN-IY 156

Query: 74  NEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTS 133
           ++ G  +F+       +M + +    F+ Y         +++ N  +   + G L+G T 
Sbjct: 157 HKEGFAAFYYSYPTTLVMNIPFAAFNFAIYESATKFMNPSNEYNPFIH-CISGGLSGATC 215

Query: 134 SFVSYPTDVLRT-------RFIANQDVA-LSSLSHGCKEIWNMEGIPGFFRGCTASMFTI 185
           + ++ P D ++T         ++N+ +   ++       I+ + G  GF RG    +   
Sbjct: 216 AAITTPLDCIKTVLQVRGSETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIAN 275

Query: 186 TLSASILFGTYESIKIY 202
             + +I + +YE  K +
Sbjct: 276 MPATAISWTSYECAKHF 292

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 92.8 bits (229), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 85/303 (28%), Positives = 147/303 (48%), Gaps = 38/303 (12%)

Query: 27  VAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPS----GLLKMMKGMILNEGGLRSFW 82
           ++G+++GLL+  V+ PLD  K RLQ +   T    +    G +  M  ++ +E G+R  +
Sbjct: 73  ISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDE-GVRGLY 131

Query: 83  KGNVPGTMMYVLYGGAQFSSYSF-YNNLFGETSDMNGQLQSLVVGAL-AGMTSSFVSYPT 140
           KG VP  M Y       FS Y F  +NL   T+  N    S    A+ AG  S+ V+ P 
Sbjct: 132 KGLVPIIMGYFPTWMIYFSVYEFCKDNL--RTNSSNWSFVSHSFSAITAGAVSTVVTNPI 189

Query: 141 DVLRTRFIANQDVALSSLSH------GCKEIWNMEGIPGFFRGCTASMFTITLSASILFG 194
            V++TR +    +  S+ +H        K+I N EG+   + G   S+  + L  +I F 
Sbjct: 190 WVVKTRLMLQTHIG-SNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLLGL-LHVAIHFP 247

Query: 195 TYESIKI--YC---DEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVY 249
            YE +K+   C   DE S ES         ASS+S + + +++YP + +R R+Q+++ + 
Sbjct: 248 VYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQLKSDLP 307

Query: 250 VQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAY 309
                + +++  I  +Y              QEG+   Y G   +L +T+P++ ++L ++
Sbjct: 308 SH---QRRLIPLIKITYI-------------QEGIFGFYSGFGTNLFRTLPASAITLVSF 351

Query: 310 ETV 312
           E V
Sbjct: 352 EYV 354

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 89/197 (45%), Gaps = 26/197 (13%)

Query: 107 NNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIAN--QDVALSSLSH---- 160
           N LFG T  +N    + + GALAG+ S  V  P DV +TR  A   Q     +L +    
Sbjct: 58  NTLFGFT--LNDNRINAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSI 115

Query: 161 -GCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYS 219
                I   EG+ G ++G    +     +  I F  YE  K   D     S   +++ +S
Sbjct: 116 GTMTTIVRDEGVRGLYKGLVPIIMGYFPTWMIYFSVYEFCK---DNLRTNSSNWSFVSHS 172

Query: 220 ASSI-SGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNI 278
            S+I +G  S +VT P+  ++ R+ ++   ++  N  +   T  Y ++K          I
Sbjct: 173 FSAITAGAVSTVVTNPIWVVKTRLMLQT--HIGSNTTHYQGT--YDAFK---------KI 219

Query: 279 LRQEGLLSLYQGVSMSL 295
           + QEG+ +LY G+  SL
Sbjct: 220 INQEGVKALYAGLVPSL 236

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 101/200 (50%), Gaps = 24/200 (12%)

Query: 22  VSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPS---GLLKMMKGMILNEGGL 78
           VS S  A + +G ++  V  P+  +K RL L+ ++ G   +   G     K  I+N+ G+
Sbjct: 169 VSHSFSAIT-AGAVSTVVTNPIWVVKTRLMLQ-THIGSNTTHYQGTYDAFKK-IINQEGV 225

Query: 79  RSFWKGNVPGTMMYVLYGGAQFSSY-----SFYNNLFGETSDMNG-QLQSLVVGA-LAGM 131
           ++ + G VP +++ +L+    F  Y     SF      E+S+ +   L+ L++ + ++ M
Sbjct: 226 KALYAGLVP-SLLGLLHVAIHFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKM 284

Query: 132 TSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEI------WNMEGIPGFFRGCTASMFTI 185
            +S +SYP ++LRTR     D+     SH  + I      +  EGI GF+ G   ++F  
Sbjct: 285 VASVLSYPHEILRTRLQLKSDLP----SHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRT 340

Query: 186 TLSASILFGTYESIKIYCDE 205
             +++I   ++E ++ + ++
Sbjct: 341 LPASAITLVSFEYVRNFLNK 360

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 91.3 bits (225), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 86/306 (28%), Positives = 144/306 (47%), Gaps = 33/306 (10%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKG 84
           + VAG V G ++RTV++P++ +KI LQ++ S T     GL+  +K  +  E G++  ++G
Sbjct: 19  AFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYN-GGLVHAVK-QVYKEEGVKGLFRG 76

Query: 85  NVPGTMMYVLYGGAQFSSYSF-YNNLFGETSDMNGQLQS---LVVGALAGMTSSFVSYPT 140
           N    +    Y   Q++ Y F    +F      + QL+S   LV GAL G  S  V+YP 
Sbjct: 77  NGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTYPL 136

Query: 141 DVLRTRF---IANQDVALSSLSHGC----------KEIWNME-GIPGFFRGCTASMFTIT 186
           D++RTR     AN      S +H            + I+  E G+ G++RG   +   + 
Sbjct: 137 DLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVV 196

Query: 187 LSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRN 246
              ++ F  YE +K     +  ++      + +  ++SG  ++ V YP D +RRR QV  
Sbjct: 197 PFVALNFALYERLKALIP-HDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLT 255

Query: 247 SVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSL 306
                       + +    ++ AS       I RQEGL   Y+G++ +L K VP+  V  
Sbjct: 256 ------------MGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQW 303

Query: 307 WAYETV 312
           + YE +
Sbjct: 304 FVYELI 309

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/104 (21%), Positives = 47/104 (45%), Gaps = 18/104 (17%)

Query: 209 ESDYTN--YLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSY 266
           ++ Y N  ++ + A  + G  S+ V  P++ ++  +QV++S    +     +V  + Q Y
Sbjct: 9   QTVYKNDGFIAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYN---GGLVHAVKQVY 65

Query: 267 KGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
           K             +EG+  L++G  ++  +  P + V    YE
Sbjct: 66  K-------------EEGVKGLFRGNGINCLRIFPYSAVQYAVYE 96

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 90.1 bits (222), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 130/301 (43%), Gaps = 30/301 (9%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQL--RPSYTGQAPSGLLKMMKGMILNEGGLRSFW 82
           +L+AG  +GL       PLDT+K+R+Q+  R +  G  P G +K  +  I  E GL + +
Sbjct: 13  NLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRN-IYTEEGLLALY 71

Query: 83  KGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQL---QSLVVGALAGMTSS-FVSY 138
           KG     +  +     +FSSY FY +   +     G +    + + G  AG T +  V  
Sbjct: 72  KGLGAVVIGIIPKMAIRFSSYEFYRSALAD--KQTGSVSTGNTFLAGVGAGTTEAVLVVN 129

Query: 139 PTDVLRTRFIANQDVALSSLS-------HGCKEIWNMEGIPGFFRGCTASMFTITLSASI 191
           P +V++ R  A      ++ S         C  I   EGI   +RG + +      +   
Sbjct: 130 PMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQGA 189

Query: 192 LFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQ 251
            F  Y  +K +  E+ K     ++       ISG        PLDTI+ R+Q ++     
Sbjct: 190 NFTVYSKLKEFLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQ-KDKSTAN 248

Query: 252 HNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYET 311
            +  ++IVT             +G  ++++EG  +LY+G++  + +  P   V+   YE 
Sbjct: 249 MSGWSRIVT-------------IGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEF 295

Query: 312 V 312
           V
Sbjct: 296 V 296

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 81/187 (43%), Gaps = 14/187 (7%)

Query: 28  AGSVSGLLARTVIAPLDTLKIRLQ---LRPSYTGQAPSGLLKMMKG-MILNEGGLRSFWK 83
           AG+   +L   V+ P++ +KIRLQ   L P  T  +P     +    +I+ E G+ + ++
Sbjct: 119 AGTTEAVL---VVNPMEVVKIRLQAQHLHPE-TAASPRYRNALQACYLIVKEEGIGALYR 174

Query: 84  GNVPGTMMYVLYGGAQFSSYSFYNNLFGE--TSDMNGQLQSLVVGALAGMTSSFVSYPTD 141
           G            GA F+ YS       E   +D     ++  +G ++G    F + P D
Sbjct: 175 GVSLTAARQATNQGANFTVYSKLKEFLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLD 234

Query: 142 VLRTRFIANQDVA----LSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYE 197
            ++TR   ++  A     S +    K++   EG    ++G T  +  +    ++ F  YE
Sbjct: 235 TIKTRLQKDKSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 294

Query: 198 SIKIYCD 204
            ++ + +
Sbjct: 295 FVREHLE 301

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 49/104 (47%), Gaps = 13/104 (12%)

Query: 207 SKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSY 266
           SK+      +   A   +G+   +  +PLDTI+ R+Q+    Y +  +E           
Sbjct: 3   SKKKSSNPAVNLIAGGTAGLFEALCCHPLDTIKVRMQI----YRRSALEG---------I 49

Query: 267 KGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
           K   FI+ G NI  +EGLL+LY+G+   +   +P   +   +YE
Sbjct: 50  KPPGFIKTGRNIYTEEGLLALYKGLGAVVIGIIPKMAIRFSSYE 93

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 40/98 (40%), Gaps = 6/98 (6%)

Query: 8   QHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKM 67
            H TD L   E   +      G +SG +     APLDT+K RLQ   S    +    +  
Sbjct: 204 HHKTDALPSWETSCI------GLISGAIGPFSNAPLDTIKTRLQKDKSTANMSGWSRIVT 257

Query: 68  MKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSF 105
           +   ++ E G R+ +KG  P  M         F+ Y F
Sbjct: 258 IGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEF 295

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 90.1 bits (222), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 80/329 (24%), Positives = 139/329 (42%), Gaps = 52/329 (15%)

Query: 22  VSQSLVAGSVSGLLARTVIAPLDTLKIRLQL-RPSYTGQAPS--GLLKMMKGMILNEGGL 78
           V +S +AG VSG  A+T+IAPLD +KI  Q   P Y+  A S  GL +  K + +N+G +
Sbjct: 18  VVRSGLAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDG-I 76

Query: 79  RSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSY 138
           R F++G+    +    Y   +F +Y    ++   + +     + L  G+LAG+ S F++Y
Sbjct: 77  RGFFQGHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWRRLASGSLAGLCSVFITY 136

Query: 139 PTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPG----------------FFRGCTASM 182
           P D+ R R     +     L    K I++     G                F+RG   ++
Sbjct: 137 PLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYVPTV 196

Query: 183 FTITLSASILFGTYESI---------------------KIYCDEYSKESDYTNYLRYSAS 221
             +   A + F  ++ I                     ++   +  +++    +    A 
Sbjct: 197 LGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPLRTWAELVAG 256

Query: 222 SISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQ 281
            +SG+ S+   YPL+ IRRR+QV            K+    +QS    + I     I ++
Sbjct: 257 GLSGILSQTAAYPLEIIRRRLQVSTL------SPRKMYDHKFQSISSIARI-----IYQE 305

Query: 282 EGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
           +G    + G+S+   K  P    S + YE
Sbjct: 306 KGWRGFFVGLSIGYIKVTPMVACSFFVYE 334

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 94/213 (44%), Gaps = 22/213 (10%)

Query: 112 ETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDV------ALSSLSHGCKEI 165
           + + ++  ++S + G ++G  +  +  P D ++  F  +         +L  L    K I
Sbjct: 11  DKNSLDYVVRSGLAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHI 70

Query: 166 WNMEGIPGFFRGCTASMFTITLSASILFGTYESIK---IYCDEYSKESDYTNYLRYSASS 222
           W  +GI GFF+G + ++  I   A++ F  YE I+   I   EY      +++ R ++ S
Sbjct: 71  WINDGIRGFFQGHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYE-----SHWRRLASGS 125

Query: 223 ISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENK---IVTEIYQSYKGASFIRMGLNIL 279
           ++G+ S  +TYPLD  R R+      YV  +   K   IV  IY            L   
Sbjct: 126 LAGLCSVFITYPLDLTRVRL-----AYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPK 180

Query: 280 RQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETV 312
                 + Y+G   ++   +P   VS +A++ +
Sbjct: 181 WFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLI 213

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 90/223 (40%), Gaps = 50/223 (22%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEG---GLRS 80
           + L +GS++GL +  +  PLD  ++RL    +Y  +     L+ +   I +E    GL S
Sbjct: 119 RRLASGSLAGLCSVFITYPLDLTRVRL----AYVTEHKRVKLRDIVKTIYHEPASEGLTS 174

Query: 81  -------------FWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGET-------SDMNGQL 120
                        F++G VP  +  + Y G  F ++   +++   +         ++ Q 
Sbjct: 175 HLLVPKWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQE 234

Query: 121 Q----------------SLVVGALAGMTSSFVSYPTDVLRTRFIANQ-------DVALSS 157
           +                 LV G L+G+ S   +YP +++R R   +        D    S
Sbjct: 235 ELERKKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQS 294

Query: 158 LSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIK 200
           +S   + I+  +G  GFF G +     +T   +  F  YE +K
Sbjct: 295 ISSIARIIYQEKGWRGFFVGLSIGYIKVTPMVACSFFVYERMK 337

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 7/76 (9%)

Query: 14  LRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQL-----RPSYTGQAPSGLLKMM 68
           LR+   ++    LVAG +SG+L++T   PL+ ++ RLQ+     R  Y  +  S  +  +
Sbjct: 241 LRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQS--ISSI 298

Query: 69  KGMILNEGGLRSFWKG 84
             +I  E G R F+ G
Sbjct: 299 ARIIYQEKGWRGFFVG 314

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 91.3 bits (225), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 76/329 (23%), Positives = 142/329 (43%), Gaps = 57/329 (17%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTG---------------QAPSGLLKMMKG 70
            +AG +SG+++RT  AP D LK+ L  R   +                  P+ L   +  
Sbjct: 204 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVK 263

Query: 71  MILN---EGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF------GETSDMNGQLQ 121
            I++   +GG++SF+ GN    +        +F S+     L        +T D++ +L 
Sbjct: 264 AIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLS-KLS 322

Query: 122 SLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHG-------CKEIWNMEGIPGF 174
           + + G LAG+ + F  YP D L+ R    Q   L++   G        KE++   G+  F
Sbjct: 323 TFIAGGLAGVCAQFSVYPIDTLKFRM---QCAPLNAELKGRKLMIQTAKEMYTEGGLKLF 379

Query: 175 FRGCTASMFTITLSASILFGTYESIKIY--------CDEYSKESDYTNYLRYSASSISGV 226
           +RG T  +  I   A++  GT+  +K +         ++  ++ + +N +     + SG 
Sbjct: 380 YRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGT 439

Query: 227 TSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLS 286
               V YP++ +R R+Q + +                  Y+   F  + L  +++EG   
Sbjct: 440 FGATVVYPINLLRTRLQAQGT--------------FAHPYRYDGFRDVLLKTIQREGYPG 485

Query: 287 LYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
           L++G+  +L K  P+  +S   YE + +L
Sbjct: 486 LFKGLVPTLAKVCPAVSISYLCYENLKKL 514

 Score = 73.9 bits (180), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 94/203 (46%), Gaps = 14/203 (6%)

Query: 12  DHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGM 71
           ++ +  +D+    + +AG ++G+ A+  + P+DTLK R+Q  P         L+      
Sbjct: 310 ENCKDTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKE 369

Query: 72  ILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF--GETSDMNG-----QLQSLV 124
           +  EGGL+ F++G   G +    Y      ++S     +   +   +N      +L +LV
Sbjct: 370 MYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLV 429

Query: 125 V---GALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIW----NMEGIPGFFRG 177
           V   GA +G   + V YP ++LRTR  A    A      G +++       EG PG F+G
Sbjct: 430 VLPMGAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKG 489

Query: 178 CTASMFTITLSASILFGTYESIK 200
              ++  +  + SI +  YE++K
Sbjct: 490 LVPTLAKVCPAVSISYLCYENLK 512

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 89.4 bits (220), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 126/301 (41%), Gaps = 26/301 (8%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTG---QAPSGLLKMMKGMILNEGGLRSF 81
           +L+AG  +GL       PLDT+K+R+Q+     G     P G +K  + +   EG L + 
Sbjct: 13  NLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFL-AL 71

Query: 82  WKGNVPGTMMYVLYGGAQFSSYSFYNNLF-GETSDMNGQLQSLVVGALAGMTSS-FVSYP 139
           +KG     +  +     +FSSY FY  L   + S +     + V G  AG+T +  V  P
Sbjct: 72  YKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLVVNP 131

Query: 140 TDVLRTRFIA--------NQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASI 191
            +V++ R  A        N     ++  H    I   EG+   +RG + +      +   
Sbjct: 132 MEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGA 191

Query: 192 LFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQ 251
            F  Y  +K +   Y +     ++       ISG        PLDTI+ R+Q   S+ ++
Sbjct: 192 NFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISLE 251

Query: 252 HNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYET 311
                K              I +G  +L++EG  +LY+G++  + +  P   V+   YE 
Sbjct: 252 KQSGMK------------KIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEY 299

Query: 312 V 312
           V
Sbjct: 300 V 300

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 85/199 (42%), Gaps = 15/199 (7%)

Query: 20  VKVSQSLVAGSVSGLL-ARTVIAPLDTLKIRLQ---LRPSYTGQAPSGLLKMMKG-MILN 74
           V    + VAG  +G+  A  V+ P++ +KIRLQ   L PS     P     +     I+ 
Sbjct: 108 VSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVK 167

Query: 75  EGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMN--GQLQSLVVGALAGMT 132
           E G+ + ++G            GA F+ YS           M+     ++  +G ++G  
Sbjct: 168 EEGVSALYRGVSLTAARQATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAI 227

Query: 133 SSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNM-------EGIPGFFRGCTASMFTI 185
             F + P D ++TR   ++ ++L   S G K+I  +       EG    ++G T  +  +
Sbjct: 228 GPFSNAPLDTIKTRLQKDKSISLEKQS-GMKKIITIGAQLLKEEGFRALYKGITPRVMRV 286

Query: 186 TLSASILFGTYESIKIYCD 204
               ++ F  YE ++ + +
Sbjct: 287 APGQAVTFTVYEYVREHLE 305

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 89.4 bits (220), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 70/296 (23%), Positives = 136/296 (45%), Gaps = 30/296 (10%)

Query: 27  VAGSVSGLLARTVIAPLDTLKIRLQ---LRPSYTGQAPSGLLKMMKGMILNEGGLRSFWK 83
           ++G+ +G L+   + PLD  K RLQ   L+  +      G++  +  ++ +EG  R  +K
Sbjct: 82  LSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGP-RGLYK 140

Query: 84  GNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVL 143
           G VP  + Y       FS Y F    F         +        AG  S+ ++ P  V+
Sbjct: 141 GLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQSCAAITAGAASTTLTNPIWVV 200

Query: 144 RTRFIANQDVALSSLSH-----GCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYES 198
           +TR +   ++      +       ++++  EG    + G   S+  +    +I F  YE 
Sbjct: 201 KTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGL-FHVAIHFPIYED 259

Query: 199 IKIYCDEYSKESDYTNYLRYS----ASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNV 254
           +K+    YS+E++ TN +       ASS+S + +  VTYP + +R R+Q+++ +    ++
Sbjct: 260 LKVRFHCYSRENN-TNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDI--PDSI 316

Query: 255 ENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
           + ++   I  +Y              QEGL   Y G + +L +T+P++ ++L ++E
Sbjct: 317 QRRLFPLIKATYA-------------QEGLKGFYSGFTTNLVRTIPASAITLVSFE 359

 Score = 35.0 bits (79), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 42/97 (43%), Gaps = 1/97 (1%)

Query: 20  VKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLR 79
           + + + ++A SVS ++A  V  P + L+ R+QL+          L  ++K     E GL+
Sbjct: 276 INLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQE-GLK 334

Query: 80  SFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDM 116
            F+ G     +  +        S+ ++ N     S M
Sbjct: 335 GFYSGFTTNLVRTIPASAITLVSFEYFRNRLENISTM 371

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/326 (23%), Positives = 144/326 (44%), Gaps = 51/326 (15%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYT-----------GQAPSGLLKMMKGMILN 74
            +AG  SG+++RT  AP D +K+ L  R   +            + P+  L  +K  ++ 
Sbjct: 203 FIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIK 262

Query: 75  -------EGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFG------ETSDMNGQLQ 121
                  +GGLR+F+ GN    +        +F S+     +        +TS+++ +L 
Sbjct: 263 AATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELS-RLS 321

Query: 122 SLVVGALAGMTSSFVSYPTDVLRTRFIA---NQDVALSS-LSHGCKEIWNMEGIPGFFRG 177
           + + G L G+ + F  YP D L+ R      N ++  SS L    KE++   GI  F+RG
Sbjct: 322 TYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLFYRG 381

Query: 178 CTASMFTITLSASILFGTYESIKI-YCDEYSKESDY-------TNYLRYSASSISGVTSK 229
               +  I   A++  GT+ ++K  Y  + +K++         +N +     + SG    
Sbjct: 382 VHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTVGA 441

Query: 230 MVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQ 289
            + YP++ +R R+Q + +    H            +Y G S +      +++EG   L++
Sbjct: 442 TLVYPINLLRTRLQAQGTYAHPH------------TYNGFSDVLK--KTIQREGYQGLFK 487

Query: 290 GVSMSLCKTVPSTVVSLWAYETVMRL 315
           G+  +L K  P+  +S   YE + RL
Sbjct: 488 GLVPNLAKVCPAVSISYLCYENLKRL 513

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 89/203 (43%), Gaps = 20/203 (9%)

Query: 18  EDVKVSQSL------VAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGM 71
           E+VK +  L      +AG + G+ A+  + P+DTLK R+Q  P  T    S +L      
Sbjct: 309 ENVKDTSELSRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKE 368

Query: 72  ILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF----------GETSDMNGQLQ 121
           +  +GG+R F++G   G M    Y      ++S     +           E   +   L 
Sbjct: 369 MYQQGGIRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLI 428

Query: 122 SLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHG----CKEIWNMEGIPGFFRG 177
            L +GA +G   + + YP ++LRTR  A    A     +G     K+    EG  G F+G
Sbjct: 429 VLPMGAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKG 488

Query: 178 CTASMFTITLSASILFGTYESIK 200
              ++  +  + SI +  YE++K
Sbjct: 489 LVPNLAKVCPAVSISYLCYENLK 511

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/221 (19%), Positives = 83/221 (37%), Gaps = 43/221 (19%)

Query: 123 LVVGALAGMTSSFVSYPTDVLRTRFIANQDVA----------------------LSSLSH 160
            + G  +G+ S   + P D ++   IA  D++                       S L  
Sbjct: 203 FIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIK 262

Query: 161 GCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLR--- 217
               ++   G+  F+ G   ++  +   ++I FG++E  K          D +   R   
Sbjct: 263 AATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRLST 322

Query: 218 YSASSISGVTSKMVTYPLDTIRRRIQVR--NSVYVQHNVENKIVTEIYQSYKGASFIRMG 275
           Y A  + GV ++   YP+DT++ RIQ    N+   + ++  +   E+YQ           
Sbjct: 323 YIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQ----------- 371

Query: 276 LNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
                Q G+   Y+GV + +    P   + L  +  + + Y
Sbjct: 372 -----QGGIRLFYRGVHIGVMGIFPYAALDLGTFSALKKWY 407

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 88.2 bits (217), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 80/321 (24%), Positives = 133/321 (41%), Gaps = 42/321 (13%)

Query: 12  DHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQL-RPSYTGQAPSGLLKMMKG 70
           +H+   +    + +LVAG  +GL       PLDT+K+R+Q+ R +  G  P G L+    
Sbjct: 47  NHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGAN 106

Query: 71  MILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGE-TSDMNGQLQSLVVGALA 129
           +   E GL +F+KG     +  +     +FSSY FY  L  +  + +     + + G  A
Sbjct: 107 IYSGE-GLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGA 165

Query: 130 GMTSS-FVSYPTDVLRTRFIANQDVALSSLSHGCKE-------------IWNMEGIPGFF 175
           G+T +  V  P +V++ R  A          HG  E             I   EGI   +
Sbjct: 166 GVTEAVLVVNPMEVVKIRLQAQH-------LHGAAEQQKYRNAIQAAYLIVKEEGIGALY 218

Query: 176 RGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPL 235
           RG + +      +    F  Y  +     EY    +  ++       +SG        PL
Sbjct: 219 RGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPL 278

Query: 236 DTIRRRIQVRNSVYVQHNVEN--KIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSM 293
           DTI+ R+Q   S     N+ N  +I T             +G  ++++EG  +LY+G++ 
Sbjct: 279 DTIKTRLQKDKST---RNLSNWVRITT-------------IGRQLVQEEGFRALYKGITP 322

Query: 294 SLCKTVPSTVVSLWAYETVMR 314
            + +  P   V+   YE V R
Sbjct: 323 RVMRVAPGQAVTFTVYEFVRR 343

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 49/110 (44%), Gaps = 15/110 (13%)

Query: 202 YCDEYSKESDYTN-YLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVT 260
           Y D +      TN  +   A   +G+   +  +PLDTI+ R+Q+    Y + N       
Sbjct: 44  YPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQI----YRRAN------- 92

Query: 261 EIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
              +  K   F+R G NI   EGLL+ Y+G+   +   +P   +   +YE
Sbjct: 93  ---EGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYE 139

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 87.4 bits (215), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 146/314 (46%), Gaps = 42/314 (13%)

Query: 22  VSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSF 81
           V + +++G  +G +      PLD +K+RLQL    T + P G   ++K  I+ +    SF
Sbjct: 8   VQKEMISGLTAGTITTVSTHPLDLVKVRLQLLA--TNKKPQGYYDVVK-RIVKDSKQHSF 64

Query: 82  WKGNVPG--------TMMYVLYGGAQFSSYSF-----------YNNLFGETSDMNGQLQS 122
           ++    G        ++ + LY G   +S  +           +NN      +M   L  
Sbjct: 65  FRETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTS-LMY 123

Query: 123 LVVGALAGMTSSFVSYPTDVLRTRFIANQDV---ALSSLSHGCKEIWNMEGIPGFFRGCT 179
           L+  A++G+ +S ++ P  V++TR ++   V   +  S   G K+++ +EG+ GF+RG  
Sbjct: 124 LLAAAMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGLV 183

Query: 180 ASMFTITLSASILFGTYESIKIY---CDEYSKESDYTNYLRYSASSISGVTSKMVTYPLD 236
            S+F ++  A I F  Y+++K +        K+   +N    + +S+S + S    YPL 
Sbjct: 184 PSLFGVSQGA-IYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVYPLQ 242

Query: 237 TIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLC 296
            ++  +Q   S  V   +  K    ++         ++   I  ++G+  LY+G+  +L 
Sbjct: 243 LLKSNLQ---SFEVSTVINPKTSHRVW---------KLITTIYVRDGVTGLYKGLLANLI 290

Query: 297 KTVPSTVVSLWAYE 310
           + VPST ++   YE
Sbjct: 291 RAVPSTCITFCVYE 304

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 82/189 (43%), Gaps = 19/189 (10%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGN 85
           L+A ++SG+    +  P+  +K R+        ++    +  +K +   EG L  FW+G 
Sbjct: 124 LLAAAMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEG-LAGFWRGL 182

Query: 86  VPGTMMYVLYGGAQFSSYSF--YNNLFGETSDMNGQLQSL---VVGALAGMTSSFVSYPT 140
           VP ++  V  G   F+ Y    Y+    +  D   +L +L    + +L+ M S    YP 
Sbjct: 183 VP-SLFGVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVYPL 241

Query: 141 DVLRTRFIANQDVALSSL--SHGCKEIWNM-------EGIPGFFRGCTASMFTITLSASI 191
            +L++     Q   +S++        +W +       +G+ G ++G  A++     S  I
Sbjct: 242 QLLKSNL---QSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCI 298

Query: 192 LFGTYESIK 200
            F  YE+ +
Sbjct: 299 TFCVYENFR 307

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 87.4 bits (215), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 80/308 (25%), Positives = 147/308 (47%), Gaps = 39/308 (12%)

Query: 18  EDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP-SGLLKMMKGMILNEG 76
           +D +V+   V+G+++G ++  ++ PLD  K RLQ + + +G+    G++  +   IL + 
Sbjct: 82  DDTQVTA--VSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSA-ILRDE 138

Query: 77  GLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGAL-AGMTSSF 135
           G+   +KG  P  + Y       FS Y      +   S + G   S    AL AG  S+ 
Sbjct: 139 GVAGLYKGLAPIVLGYFPTWMLYFSVYEKCKQRY--PSYLPGGFVSHAASALTAGAISTA 196

Query: 136 VSYPTDVLRTRFIANQDVALSSLSH-----GCKEIWNMEGIPGFFRGCTASMFTITLSAS 190
           ++ P  V++TR +   DV+  S ++       ++++  EG+  F+ G   S+F +    +
Sbjct: 197 LTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLFGL-FHVA 255

Query: 191 ILFGTYESIKIYCDEYSKESDYT----NYLRYS----ASSISGVTSKMVTYPLDTIRRRI 242
           I F  YE +KI+    +  +D      N L+      AS +S V + ++TYP + +R R+
Sbjct: 256 IHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRM 315

Query: 243 QVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPST 302
           QVR+S                      S + +   I   EG +  Y G + +L +TVP++
Sbjct: 316 QVRHSGV------------------PPSLLNLLGRIRASEGYVGFYSGFATNLVRTVPAS 357

Query: 303 VVSLWAYE 310
           V++L ++E
Sbjct: 358 VITLVSFE 365

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 90/207 (43%), Gaps = 18/207 (8%)

Query: 8   QHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPS--GLL 65
           Q    +L  G     + +L AG++S  L      P+  +K RL ++   +  + +    L
Sbjct: 170 QRYPSYLPGGFVSHAASALTAGAISTALTN----PIWVVKTRLMIQSDVSRDSTNYRSTL 225

Query: 66  KMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYS-----FYNNLF---GETSDMN 117
              + M  +EG L+ F+ G VP ++  + +    F  Y       + N     G+  D N
Sbjct: 226 DAFRKMYRSEG-LKVFYSGLVP-SLFGLFHVAIHFPVYEKLKIWLHRNTPAADGQRLDHN 283

Query: 118 G-QLQSLVVGA-LAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFF 175
             QL  L+V + L+ + +S ++YP ++LRTR          SL +    I   EG  GF+
Sbjct: 284 KLQLDRLIVASCLSKVVASVITYPHEILRTRMQVRHSGVPPSLLNLLGRIRASEGYVGFY 343

Query: 176 RGCTASMFTITLSASILFGTYESIKIY 202
            G   ++     ++ I   ++E  + Y
Sbjct: 344 SGFATNLVRTVPASVITLVSFEYFRKY 370

>Scas_379.2
          Length = 301

 Score = 85.9 bits (211), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 73/306 (23%), Positives = 137/306 (44%), Gaps = 32/306 (10%)

Query: 12  DHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGM 71
           D+    +   +S  L+AG+ +G++  +V+ P+D LK R+Q   S + ++ S +L  M  +
Sbjct: 13  DYEALPDSAPLSHQLLAGAFAGIMEHSVMFPIDALKTRIQ---STSAKSTSNMLSQMAKI 69

Query: 72  ILNEGGLRSFWKGNVPGTMMYVLYGGAQ-----FSSYSFYNNLFGETSDMNGQ--LQSLV 124
              EG L + WKG     +  V+ G        F++Y +      +  DM     L++ +
Sbjct: 70  STAEGSL-ALWKG-----VQSVILGAGPAHAVYFATYEYTKKYLIDEKDMQTHQPLKTAL 123

Query: 125 VGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFT 184
            G +A + +  +  P D L+ R   N +  + +++   K+I+  EG   F+     ++  
Sbjct: 124 SGTVATIAADALMNPFDTLKQRMQLNTNTTVWNVT---KQIYKNEGFSAFYYSYPTTLAM 180

Query: 185 ITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQV 244
               A+  F  YES   +   ++  +DY   +   +  +SG T   +T PLD I+  +QV
Sbjct: 181 NIPFAAFNFMIYESATKF---FNPTNDYNPLVHCLSGGLSGATCAAITTPLDCIKTVLQV 237

Query: 245 RNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVV 304
           R S  V   V  +  T          F +    I +  G    ++G+   +   +P+T +
Sbjct: 238 RGSESVSLQVMKEANT----------FQKATKAIYQVHGAKGFWRGLQPRVFANMPATAI 287

Query: 305 SLWAYE 310
           +  AYE
Sbjct: 288 AWTAYE 293

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 94/206 (45%), Gaps = 19/206 (9%)

Query: 8   QHNTDHLRKGEDVKVSQSL---VAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGL 64
           ++   +L   +D++  Q L   ++G+V+ + A  ++ P DTLK R+QL  + T      +
Sbjct: 101 EYTKKYLIDEKDMQTHQPLKTALSGTVATIAADALMNPFDTLKQRMQLNTNTT------V 154

Query: 65  LKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLV 124
             + K +  NEG   +F+        M + +    F  Y      F  T+D N  +  L 
Sbjct: 155 WNVTKQIYKNEG-FSAFYYSYPTTLAMNIPFAAFNFMIYESATKFFNPTNDYNPLVHCLS 213

Query: 125 VGALAGMTSSFVSYPTDVLRT--RFIANQDVAL------SSLSHGCKEIWNMEGIPGFFR 176
            G L+G T + ++ P D ++T  +   ++ V+L      ++     K I+ + G  GF+R
Sbjct: 214 -GGLSGATCAAITTPLDCIKTVLQVRGSESVSLQVMKEANTFQKATKAIYQVHGAKGFWR 272

Query: 177 GCTASMFTITLSASILFGTYESIKIY 202
           G    +F    + +I +  YE  K +
Sbjct: 273 GLQPRVFANMPATAIAWTAYECAKHF 298

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/198 (21%), Positives = 84/198 (42%), Gaps = 25/198 (12%)

Query: 121 QSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTA 180
             L+ GA AG+    V +P D L+TR  +    + S++     +I   EG    ++G  +
Sbjct: 25  HQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKISTAEGSLALWKGVQS 84

Query: 181 SMFTITLSASILFGTYESIKIY-CDEYSKESDYTNYLRYSAS-SISGVTSKMVTYPLDTI 238
            +     + ++ F TYE  K Y  DE  K+      L+ + S +++ + +  +  P DT+
Sbjct: 85  VILGAGPAHAVYFATYEYTKKYLIDE--KDMQTHQPLKTALSGTVATIAADALMNPFDTL 142

Query: 239 RRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKT 298
           ++R+Q+  +  V +     +  +IY                + EG  + Y     +L   
Sbjct: 143 KQRMQLNTNTTVWN-----VTKQIY----------------KNEGFSAFYYSYPTTLAMN 181

Query: 299 VPSTVVSLWAYETVMRLY 316
           +P    +   YE+  + +
Sbjct: 182 IPFAAFNFMIYESATKFF 199

>Kwal_55.21335
          Length = 317

 Score = 85.5 bits (210), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 135/296 (45%), Gaps = 29/296 (9%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWK 83
           + ++ GS++G   + +  PLDT+K+RLQ +P++    P+     +K     EG ++ F++
Sbjct: 47  KDILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHV--FPTSW-SCIKYTYQKEGFVKGFYQ 103

Query: 84  GNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVL 143
           G     +   L     F +++   N   +   ++   Q+++ GA AG  +S+V  P +++
Sbjct: 104 GVASPLVGAALENAVLFVTFNRAQNFLQQYESVSPLSQTVLSGAFAGACTSYVLTPVELI 163

Query: 144 R-TRFIANQDVAL---SSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESI 199
           + T  ++N + A    S +    K I   +GI G ++G +++        ++ F TYES+
Sbjct: 164 KCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESL 223

Query: 200 KIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIV 259
           K Y      +++   +   ++ + +GV      +P DTI+   Q       QH       
Sbjct: 224 KSYLARRRNDTENHTWELLASGASAGVAFNASIFPADTIKSTAQ------TQH------- 270

Query: 260 TEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
                       +     IL + G   LY+G+ ++L +  P+  +  + YET+  L
Sbjct: 271 ---------LGIVDATKRILARSGPAGLYRGLGITLIRAAPANAIVFYTYETLSNL 317

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/202 (21%), Positives = 90/202 (44%), Gaps = 23/202 (11%)

Query: 115 DMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGC-KEIWNMEG-IP 172
           D    L+ ++ G++AG     + YP D ++ R +  Q   +   S  C K  +  EG + 
Sbjct: 41  DFKDALKDILYGSIAGAAGKVIEYPLDTIKVR-LQTQPAHVFPTSWSCIKYTYQKEGFVK 99

Query: 173 GFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVT 232
           GF++G  + +    L  ++LF T+   + +  +Y   S  +  +   + + +G  +  V 
Sbjct: 100 GFYQGVASPLVGAALENAVLFVTFNRAQNFLQQYESVSPLSQTVL--SGAFAGACTSYVL 157

Query: 233 YPLDTIRRRIQVRN--SVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQG 290
            P++ I+  +QV N      +H       ++I+ + K         +I++ +G+  L+QG
Sbjct: 158 TPVELIKCTLQVSNLEGATTRH-------SKIWPTVK---------HIVQHKGIGGLWQG 201

Query: 291 VSMSLCKTVPSTVVSLWAYETV 312
            S +  +      V    YE++
Sbjct: 202 QSSTFIRECAGGAVWFTTYESL 223

>Scas_691.4
          Length = 334

 Score = 85.1 bits (209), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/314 (24%), Positives = 127/314 (40%), Gaps = 40/314 (12%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKG 84
           +LVAG  +GL       PLDT+K+R+Q+     G  P G +   + +  +EG L + +KG
Sbjct: 16  NLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHEGFL-ALYKG 74

Query: 85  NVPGTMMYVLYGGAQFSSYSFYNNLF--GETSDMNGQLQSLVVGALAGMTSS-FVSYPTD 141
                +  +     +FSSY FY N     ET  +     + + G  AG+T +  V  P +
Sbjct: 75  LGAVVIGIIPKMAIRFSSYEFYRNALTDKETRTITTG-NTFLAGVGAGITEAVLVVNPME 133

Query: 142 VLRTRFIAN-------QDVALSSLS--------------HGCKEIWNMEGIPGFFRGCTA 180
           V++ R  A        Q   +S+                H    I   EG    +RG + 
Sbjct: 134 VVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGALYRGVSL 193

Query: 181 SMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRR 240
           +      +    F  Y  +K Y  +Y       ++       ISG        PLDTI+ 
Sbjct: 194 TAARQATNQGANFTVYSYLKDYLQKYHNRESLPSWETSCIGLISGAIGPFSNAPLDTIKT 253

Query: 241 RIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVP 300
           R+Q   S+       N    +IY          +G  ++++EG  +LY+G++  + +  P
Sbjct: 254 RLQKDKSI-----SSNSAWKKIYI---------IGTQLIKEEGFRALYKGITPRVMRVAP 299

Query: 301 STVVSLWAYETVMR 314
              V+   YE V +
Sbjct: 300 GQAVTFTVYEFVRK 313

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 86/188 (45%), Gaps = 14/188 (7%)

Query: 120 LQSLVVGALAGMTSSFVSYPTDVLRTRF-IANQDVALSSLSHGC----KEIWNMEGIPGF 174
           L +LV G  AG+  +   +P D ++ R  IA +   +    HG     + I++ EG    
Sbjct: 14  LINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMR--PHGFITTGRNIYSHEGFLAL 71

Query: 175 FRGCTASMFTITLSASILFGTYESIK-IYCDEYSKESDYTNYLRYSASSISGVTSK-MVT 232
           ++G  A +  I    +I F +YE  +    D+ ++     N   + A   +G+T   +V 
Sbjct: 72  YKGLGAVVIGIIPKMAIRFSSYEFYRNALTDKETRTITTGN--TFLAGVGAGITEAVLVV 129

Query: 233 YPLDTIRRRIQVR--NSVYVQH-NVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQ 289
            P++ ++ R+Q +  N +  Q   V            K A+ I     I+++EG  +LY+
Sbjct: 130 NPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGALYR 189

Query: 290 GVSMSLCK 297
           GVS++  +
Sbjct: 190 GVSLTAAR 197

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 9/109 (8%)

Query: 12  DHLRK---GEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMM 68
           D+L+K    E +   ++   G +SG +     APLDT+K RLQ   S +  +    + ++
Sbjct: 214 DYLQKYHNRESLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISSNSAWKKIYII 273

Query: 69  KGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYN------NLFG 111
              ++ E G R+ +KG  P  M         F+ Y F        N FG
Sbjct: 274 GTQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRKHLETLNFFG 322

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 79/327 (24%), Positives = 139/327 (42%), Gaps = 53/327 (16%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYT-------------------GQAPSGLLK 66
            +AG +SG+++RT  AP D LK+ L  R   +                    +  S L K
Sbjct: 231 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAK 290

Query: 67  MMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFG------ETSDMNGQL 120
            +K +   +GG+++F+ GN    +        +F S+     +        +T D++ + 
Sbjct: 291 AVKSL-YRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLS-KF 348

Query: 121 QSLVVGALAGMTSSFVSYPTDVLRTRF-IANQDVALSS---LSHGCKEIWNMEGIPGFFR 176
            + + G LAGM + F  YP D L+ R   A  D  L     L    K+++   G+  F+R
Sbjct: 349 STYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFREGGLRLFYR 408

Query: 177 GCTASMFTITLSASILFGTYESIKI-YCDEYSK-------ESDYTNYLRYSASSISGVTS 228
           G T  +  I   A++  GT+ ++K  Y  + +K       +   +N +     + SG   
Sbjct: 409 GVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFSGTVG 468

Query: 229 KMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLY 288
             V YP++ +R R+Q + + Y    V N              F  + L  L +EG   L+
Sbjct: 469 ASVVYPINLLRTRLQAQGT-YAHPYVYN-------------GFKDVLLKTLEREGYQGLF 514

Query: 289 QGVSMSLCKTVPSTVVSLWAYETVMRL 315
           +G+  +L K  P+  +S   YE + + 
Sbjct: 515 KGLVPTLAKVCPAVSISYLCYENLKKF 541

 Score = 75.1 bits (183), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 93/202 (46%), Gaps = 14/202 (6%)

Query: 15  RKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILN 74
           R  +D+    + +AG ++G+ A+  + P+DTLK R+Q  P  T    + LL      +  
Sbjct: 340 RDTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFR 399

Query: 75  EGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF--GETSDMN--------GQLQSLV 124
           EGGLR F++G   G +    Y      ++S     +   +   +N          L  L 
Sbjct: 400 EGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLP 459

Query: 125 VGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEI----WNMEGIPGFFRGCTA 180
           +GA +G   + V YP ++LRTR  A    A   + +G K++       EG  G F+G   
Sbjct: 460 MGAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVP 519

Query: 181 SMFTITLSASILFGTYESIKIY 202
           ++  +  + SI +  YE++K +
Sbjct: 520 TLAKVCPAVSISYLCYENLKKF 541

 Score = 31.6 bits (70), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 58/131 (44%), Gaps = 29/131 (22%)

Query: 205 EYSKESDYT---NYLR----YSASSISGVTSKMVTYPLDTIRRRIQVR---NSVYVQHNV 254
           + S E D T   +++R    + A  ISGV S+  T P D ++  +  R   +S+ +    
Sbjct: 211 DLSSEGDVTLINDFIRGFGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKT 270

Query: 255 E----------NKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVV 304
           +          NKI + + ++ K         ++ RQ G+ + Y G  +++ K  P + +
Sbjct: 271 DLLAKNPNADINKISSPLAKAVK---------SLYRQGGIKAFYVGNGLNVIKVFPESSI 321

Query: 305 SLWAYETVMRL 315
              ++E   ++
Sbjct: 322 KFGSFEVTKKI 332

>Scas_662.12
          Length = 308

 Score = 84.3 bits (207), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 79/316 (25%), Positives = 147/316 (46%), Gaps = 39/316 (12%)

Query: 18  EDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQA-PSGLLKMMKGMILN-- 74
           E   + + +++G  +G L   ++ PLD +K+RLQL  + T Q    G   ++  +I N  
Sbjct: 3   ELTPIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSK 62

Query: 75  ----EGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSD---MNGQLQS----- 122
               +G + +  K +  G  + +L G A   ++S Y  ++  T D    N  L +     
Sbjct: 63  KMGSQGPIYNLIKESYRGLPINLL-GNA--VAWSLYFTIYNSTKDYMFQNNYLHNNNTTI 119

Query: 123 -LVVGALAGMTSSFVSYPTDVLRTRFIA---NQDVALSSLSHGCKEIWNMEGIPGFFRGC 178
            L  G ++G++++ ++ P  V++TR ++   +   +  S+ HG K +   EG    + G 
Sbjct: 120 FLTSGLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGL 179

Query: 179 TASMFTITLSASILFGTYESIKIY----CDEYSKESDYTNYLRYSASSISGVTSKMVTYP 234
             S+  ++  A I F  Y+++K++     ++  K++   N      SS+S + S M  YP
Sbjct: 180 LPSLLGVSQGA-IYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYP 238

Query: 235 LDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMS 294
              ++  +Q   SV       N I    Y       FI +   I R  G+  LY+G+S +
Sbjct: 239 FQLLKSNLQTFRSV------TNNIPQNDYH------FITLIRKIYRDNGIKGLYKGLSAN 286

Query: 295 LCKTVPSTVVSLWAYE 310
           L + +PST ++   YE
Sbjct: 287 LLRAIPSTCITFCIYE 302

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 81/192 (42%), Gaps = 24/192 (12%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGN 85
           L +G +SG+    +  PL  +K R+     +   +   +    K ++  EG  ++ W G 
Sbjct: 121 LTSGLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGP-KAIWMGL 179

Query: 86  VP-------GTMMYVLYGGAQFSSYSFYNNLFGETSD-MNGQLQSLVVGALAGMTSSFVS 137
           +P       G + +++Y   +     F  NL     D  N  L+ +++ +L+ M S    
Sbjct: 180 LPSLLGVSQGAIYFMIYDNLKLH---FNVNLNKSKKDNANANLKIVLISSLSKMLSVMSV 236

Query: 138 YPTDVLRTRF---------IANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLS 188
           YP  +L++           I   D    +L    ++I+   GI G ++G +A++     S
Sbjct: 237 YPFQLLKSNLQTFRSVTNNIPQNDYHFITL---IRKIYRDNGIKGLYKGLSANLLRAIPS 293

Query: 189 ASILFGTYESIK 200
             I F  YE+ K
Sbjct: 294 TCITFCIYENFK 305

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/326 (23%), Positives = 140/326 (42%), Gaps = 51/326 (15%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTG-----------QAPSGLLKMMKGMILN 74
            +AG  SG+++RT  AP D +K+ L  R   +            + P+  +  +K  ++ 
Sbjct: 199 FIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIK 258

Query: 75  -------EGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFG------ETSDMNGQLQ 121
                  +GG+R+F+ GN    +        +F S+     L         TS+++ +  
Sbjct: 259 AATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELS-KFS 317

Query: 122 SLVVGALAGMTSSFVSYPTDVLRTRF-IANQDVALSS---LSHGCKEIWNMEGIPGFFRG 177
           + + G + G+ + F  YP D L+ R   A  D AL     L    ++++   G+  F+RG
Sbjct: 318 TYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKLFYRG 377

Query: 178 CTASMFTITLSASILFGTYESIKI-YCDEYSK-------ESDYTNYLRYSASSISGVTSK 229
            T  +  I   A++  GT+ ++K  Y    +K       +   +N++     + SG    
Sbjct: 378 VTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSGTVGA 437

Query: 230 MVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQ 289
            V YP++ +R R+Q + +    H            +Y G  F  +    +++EG   L++
Sbjct: 438 TVVYPINLLRTRLQAQGTYAHPH------------TYTG--FRDVLWKTVQREGYQGLFK 483

Query: 290 GVSMSLCKTVPSTVVSLWAYETVMRL 315
           G+  +L K  P+  +S   YE   RL
Sbjct: 484 GLVPNLAKVCPAVSISYLCYENFKRL 509

 Score = 71.2 bits (173), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 92/209 (44%), Gaps = 20/209 (9%)

Query: 6   DGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLL 65
           +G H+T  L K        + +AG + G++A+  + P+DTLK R+Q  P  T    + LL
Sbjct: 305 EGVHHTSELSK------FSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELL 358

Query: 66  KMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF-GETSDMNG------ 118
                 +  +GGL+ F++G   G M    Y      ++S     +    + M G      
Sbjct: 359 ISTARQMYRDGGLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQV 418

Query: 119 ---QLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEI-WNM---EGI 171
                  L +GA +G   + V YP ++LRTR  A    A      G +++ W     EG 
Sbjct: 419 TISNFIVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGY 478

Query: 172 PGFFRGCTASMFTITLSASILFGTYESIK 200
            G F+G   ++  +  + SI +  YE+ K
Sbjct: 479 QGLFKGLVPNLAKVCPAVSISYLCYENFK 507

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/259 (18%), Positives = 97/259 (37%), Gaps = 54/259 (20%)

Query: 96  GGAQFSSYSFYNNLFGETSDMNGQ------------LQSLVVGALAGMTSSFVSYPTDVL 143
           G    ++YS++  LF E  D++ +                + G  +G+ S   + P D +
Sbjct: 161 GSRLHTAYSYFY-LFNEDVDLSSEGDVTLINDFIRGFGFFIAGGCSGVISRTCTAPFDRI 219

Query: 144 RTRFIANQDVA----------------------LSSLSHGCKEIWNMEGIPGFFRGCTAS 181
           +   IA  D++                       S L      ++   GI  F+ G   +
Sbjct: 220 KVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIKAATTLYRQGGIRAFYVGNGLN 279

Query: 182 MFTITLSASILFGTYESIK---IYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTI 238
           +  +   +++ FG++E  K    + +     S+ + +  Y A  + GV ++   YP+DT+
Sbjct: 280 VIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFSTYIAGGMGGVVAQFSVYPIDTL 339

Query: 239 RRRIQVRNSVYVQHNVENKIVTEIYQSYKGAS-FIRMGLNILRQEGLLSLYQGVSMSLCK 297
           + R+Q                  +  + KG    I     + R  GL   Y+GV++ +  
Sbjct: 340 KYRVQ---------------CAPLDTALKGNELLISTARQMYRDGGLKLFYRGVTVGVMG 384

Query: 298 TVPSTVVSLWAYETVMRLY 316
             P   + L  +  + + Y
Sbjct: 385 IFPYAALDLGTFSALKKWY 403

>Scas_582.7
          Length = 329

 Score = 84.0 bits (206), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 79/313 (25%), Positives = 137/313 (43%), Gaps = 28/313 (8%)

Query: 6   DGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSY-TGQAPSGL 64
           D   + D+        +S  L+AG+ +G++  + + P+D LK R+Q   +  T Q  + +
Sbjct: 20  DFDADVDYEALPAHAPLSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSI 79

Query: 65  LKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQ-----FSSYSFYN-NLFGETSDMNG 118
           +K +  +   EG L + WKG     +  V+ G        F++Y F   +L  ++     
Sbjct: 80  IKQISKISTMEGSL-ALWKG-----VQSVILGAGPAHAVYFATYEFTKAHLIPDSQRETH 133

Query: 119 Q-LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRG 177
           Q ++  V GA A + S F   P D ++ R +   D+    + +  K+I+N+EG+  F+  
Sbjct: 134 QPIKVAVSGATATVASDFFMNPFDTIKQR-MQISDLKKEKVYNVAKKIYNLEGLSAFYYS 192

Query: 178 CTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDT 237
              ++      A+  F  YES   +   ++    Y   +      ISG  +  VT PLD 
Sbjct: 193 YPTTIAMNIPFAAFNFMIYESASKF---FNPLHHYNPLIHCLCGGISGAIAAAVTTPLDC 249

Query: 238 IRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCK 297
           I+  IQ+R S  V   V  K  T          F +    IL   G    ++G+   +  
Sbjct: 250 IKTVIQIRGSSVVSLEVMKKANT----------FKKATSAILMVYGWKGFWRGLQPRILA 299

Query: 298 TVPSTVVSLWAYE 310
            +P+T +S  AYE
Sbjct: 300 NMPATAISWTAYE 312

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 78/204 (38%), Gaps = 31/204 (15%)

Query: 121 QSLVVGALAGMTSSFVSYPTDVLRTRFIANQ----DVALSSLSHGCKEIWNMEGIPGFFR 176
             L+ GA AG+      +P D L+TR  +      +   +S+     +I  MEG    ++
Sbjct: 38  HQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWK 97

Query: 177 GCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLD 236
           G  + +     + ++ F TYE  K +    S+   +       + + + V S     P D
Sbjct: 98  GVQSVILGAGPAHAVYFATYEFTKAHLIPDSQRETHQPIKVAVSGATATVASDFFMNPFD 157

Query: 237 TIRRRIQV----RNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVS 292
           TI++R+Q+    +  VY   NV  K                    I   EGL + Y    
Sbjct: 158 TIKQRMQISDLKKEKVY---NVAKK--------------------IYNLEGLSAFYYSYP 194

Query: 293 MSLCKTVPSTVVSLWAYETVMRLY 316
            ++   +P    +   YE+  + +
Sbjct: 195 TTIAMNIPFAAFNFMIYESASKFF 218

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 83.6 bits (205), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 136/311 (43%), Gaps = 34/311 (10%)

Query: 12  DHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYT---GQA-PSGLLKM 67
           D+    +   ++  L+AG+ +G+   +VI PLD LK RLQ   + +   GQ  PS +L+ 
Sbjct: 8   DYEALPDHAPLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQ 67

Query: 68  MKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQ-----FSSYSFYNNLFGETSDMNGQ--- 119
           +  +   EG +   WKG     +  VL G        F++Y    +   + +    +   
Sbjct: 68  LSSISAQEGSM-VLWKG-----VQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHF 121

Query: 120 LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCT 179
            ++   GA A + +  +  P DV++ R   N ++   S+    K I++ EG   F+    
Sbjct: 122 FKTAFSGATATIAADALMNPFDVIKQRIQLNTNI---SVWDTAKRIYSKEGFQAFYSSYP 178

Query: 180 ASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIR 239
            ++      A+  FG Y++   Y   ++    Y  ++      ISG     +T PLD I+
Sbjct: 179 TTLAINIPFAAFNFGIYDTATRY---FNPSGVYNPFIHCLCGGISGAACAGLTTPLDCIK 235

Query: 240 RRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTV 299
             +QVR S         K+  E+++  +  +F +    I +  G    + GV   +   +
Sbjct: 236 TALQVRGS--------EKVSMEVFK--QADTFKKATRAIYQVYGWRGFWSGVKPRILANM 285

Query: 300 PSTVVSLWAYE 310
           P+T +S  AYE
Sbjct: 286 PATAISWTAYE 296

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/204 (20%), Positives = 80/204 (39%), Gaps = 29/204 (14%)

Query: 121 QSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVAL-------SSLSHGCKEIWNMEGIPG 173
             L+ GA AG+    V +P D L+TR  A   ++        S++      I   EG   
Sbjct: 20  HQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEGSMV 79

Query: 174 FFRGCTASMFTITLSASILFGTYESIKIY-CDEYSKESDYTNYLRYSASSISGVTSKMVT 232
            ++G  + +     + ++ F TYE +K +  DE +  S Y  +    + + + + +  + 
Sbjct: 80  LWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTAFSGATATIAADALM 139

Query: 233 YPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVS 292
            P D I++RIQ+  ++ V    +                      I  +EG  + Y    
Sbjct: 140 NPFDVIKQRIQLNTNISVWDTAKR---------------------IYSKEGFQAFYSSYP 178

Query: 293 MSLCKTVPSTVVSLWAYETVMRLY 316
            +L   +P    +   Y+T  R +
Sbjct: 179 TTLAINIPFAAFNFGIYDTATRYF 202

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 82.4 bits (202), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 61/301 (20%), Positives = 132/301 (43%), Gaps = 33/301 (10%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWK 83
           + +  GSV+G + + +  P DT+K+RLQ +P++    P+     ++    +EG  + F++
Sbjct: 9   KDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHL--YPT-TWSCIRSTYTDEGIWKGFYQ 65

Query: 84  GNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVL 143
           G         L     F S++   N   E + +    +++  GA AG  +SF+  P +++
Sbjct: 66  GIASPLFGAALENAVLFVSFNQCTNFLDEFTQLKPLTKTIYSGAFAGACASFILTPVELV 125

Query: 144 RTRF----IAN---QDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTY 196
           + +     I+N   Q    +S+    K +   +G+ G ++G  ++     L  ++ F TY
Sbjct: 126 KCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTY 185

Query: 197 ESIKI-YCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVE 255
           E +K+ +   +  E +   +    + + +GV      +P DT++   Q  +         
Sbjct: 186 EIMKMKFASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQTEH--------- 236

Query: 256 NKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
                         S +     +LR  G+   Y+G+ ++L +  P+     + YET+ ++
Sbjct: 237 -------------VSIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYETLKKM 283

Query: 316 Y 316
           +
Sbjct: 284 F 284

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 87/179 (48%), Gaps = 16/179 (8%)

Query: 114 SDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGC-KEIWNMEGI- 171
           SD+   L+ +  G++AG     + YP D ++ R +  Q   L   +  C +  +  EGI 
Sbjct: 2   SDLESALKDIAYGSVAGAIGKVIEYPFDTVKVR-LQTQPAHLYPTTWSCIRSTYTDEGIW 60

Query: 172 PGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMV 231
            GF++G  + +F   L  ++LF ++     + DE+++    T  + YS  + +G  +  +
Sbjct: 61  KGFYQGIASPLFGAALENAVLFVSFNQCTNFLDEFTQLKPLTKTI-YSG-AFAGACASFI 118

Query: 232 TYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQG 290
             P++ ++ ++QV N           I   + Q+ +  S      ++++++GLL L+QG
Sbjct: 119 LTPVELVKCKLQVSN-----------ISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQG 166

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 83.2 bits (204), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 77/318 (24%), Positives = 147/318 (46%), Gaps = 42/318 (13%)

Query: 12  DHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRP----SYTGQAPSGLLKM 67
           + L+K  D +V+   ++G++SG L+  ++ P D  K RLQ +     ++  Q   G    
Sbjct: 30  NRLKKNADPRVAA--ISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGT 87

Query: 68  MKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYN----NLFGETSDMNGQLQSL 123
              +  +EG     +KG  P  + Y+      FS Y F      ++F  +  ++    ++
Sbjct: 88  FATIFKDEGA-AGLYKGLQPTVLGYIPTLMIYFSVYDFCRKYSVDIFPHSPFLSNASSAI 146

Query: 124 VVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHG-----CKEIWNMEGIPGFFRGC 178
             GA+    S+  + P  V++TR +    +   S  +       ++I   EG    + G 
Sbjct: 147 TAGAI----STVATNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGL 202

Query: 179 TASMFTITLSASILFGTYESIKI---YCDEYSKESDYT--NYLRYS-ASSISGVTSKMVT 232
             ++  + L+ +I F  YE++KI   Y +     +D T  N+ +   AS +S + +  VT
Sbjct: 203 VPALLGM-LNVAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVT 261

Query: 233 YPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVS 292
           YP + +R R+Q+++ +   + V+  ++  I  +Y             RQEG    Y G +
Sbjct: 262 YPHEILRTRMQLKSDL--PNTVQRHLLPLIKITY-------------RQEGFAGFYSGFA 306

Query: 293 MSLCKTVPSTVVSLWAYE 310
            +L +TVP+ VV+L ++E
Sbjct: 307 TNLVRTVPAAVVTLVSFE 324

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 90/198 (45%), Gaps = 21/198 (10%)

Query: 23  SQSLVAGSVSGLLARTVIAPLDTLKIRLQLRP---SYTGQAPSGLLKMMKGMILNEGGLR 79
           S ++ AG++S +       P+  +K RL L+     Y+     G +   + +I  EG  +
Sbjct: 143 SSAITAGAISTVATN----PIWVVKTRLMLQTGIGKYSTHY-KGTIDTFRKIIQQEGA-K 196

Query: 80  SFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFG--ETSDMN-----GQLQSLVVGA-LAGM 131
           + + G VP  ++ +L    QF  Y      FG  E++D++        Q L++ + L+ M
Sbjct: 197 ALYAGLVPA-LLGMLNVAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKM 255

Query: 132 TSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEI---WNMEGIPGFFRGCTASMFTITLS 188
            +S V+YP ++LRTR     D+  +   H    I   +  EG  GF+ G   ++     +
Sbjct: 256 VASTVTYPHEILRTRMQLKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVRTVPA 315

Query: 189 ASILFGTYESIKIYCDEY 206
           A +   ++E  K Y   +
Sbjct: 316 AVVTLVSFEYSKKYLTTF 333

>Kwal_55.20868
          Length = 380

 Score = 83.2 bits (204), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 76/308 (24%), Positives = 140/308 (45%), Gaps = 24/308 (7%)

Query: 15  RKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP--SGLLKMMKGMI 72
           R  +D +++   ++G+++G LA   + PLD  K RLQ +  ++  +    G+L  +  +I
Sbjct: 70  RSFDDTEITA--LSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTII 127

Query: 73  LNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMT 132
            +EG  R  +KG VP  M Y       FS Y     L+         +        AG  
Sbjct: 128 RDEGA-RGLYKGLVPIIMGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHSASALTAGTV 186

Query: 133 SSFVSYPTDVLRTRFIANQDVALSSLSH-----GCKEIWNMEGIPGFFRGCTASMFTITL 187
           S+ ++ P  V++TR +    V  +S  +        +++  EG+  F+ G   S+  +  
Sbjct: 187 STILTNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGL-F 245

Query: 188 SASILFGTYESIKIY---CDEYSKESDYT-NYLRYS-ASSISGVTSKMVTYPLDTIRRRI 242
             +I F  YE +K++       S+  D+  N  R   ASS S + +  +TYP + +R R+
Sbjct: 246 HVAIHFPIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRM 305

Query: 243 QVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPST 302
           Q++   Y    +         Q       IR+  +  + EGL   Y G + +L +T+P++
Sbjct: 306 QLK--AYPTDPLA------ALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPAS 357

Query: 303 VVSLWAYE 310
            ++L ++E
Sbjct: 358 AITLVSFE 365

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 89/199 (44%), Gaps = 25/199 (12%)

Query: 23  SQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP--SGLLKMMKGMILNEGGLRS 80
           + +L AG+VS +L      P+  +K RL L+      +   +        M   EG LR+
Sbjct: 178 ASALTAGTVSTILTN----PVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEG-LRT 232

Query: 81  FWKGNVPGTMMYVLYGGAQFSSYS------FYNNLFGETSDMNGQLQSLVVGALAG-MTS 133
           F+ G +P +++ + +    F  Y               T D N  L  L++ + A  M +
Sbjct: 233 FYAGLLP-SLLGLFHVAIHFPIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVA 291

Query: 134 SFVSYPTDVLRTR-----FIANQDVALSSLS-HG----CKEIWNMEGIPGFFRGCTASMF 183
           S ++YP ++LRTR     +  +   AL   S HG     K  +  EG+ GF+ G TA++ 
Sbjct: 292 STLTYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLA 351

Query: 184 TITLSASILFGTYESIKIY 202
               +++I   ++E  + Y
Sbjct: 352 RTLPASAITLVSFEYFRKY 370

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 82.8 bits (203), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 77/333 (23%), Positives = 130/333 (39%), Gaps = 60/333 (18%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQL-----------------------------RPS 55
           +LVAG  +GL       PLDT+K+R+Q+                               +
Sbjct: 14  NLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGDA 73

Query: 56  YTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGET-S 114
                P G ++  + +   EG L + +KG     +  +     +FSSY FY  L  +  +
Sbjct: 74  TAAIKPPGFIRTGRNIYAQEGFL-ALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADKQT 132

Query: 115 DMNGQLQSLVVGALAGMTSS-FVSYPTDVLRTRFIA-----NQDVALSSLSHGCKE---I 165
            +     + + G  AG+T +  V  P +V++ R  A     N D+A    ++  +    I
Sbjct: 133 GVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTI 192

Query: 166 WNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISG 225
              EGI   +RG + +      +    F  Y  ++ +  EY       ++       ISG
Sbjct: 193 IKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIGLISG 252

Query: 226 VTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGAS----FIRMGLNILRQ 281
                   PLDTI+ R+Q   S                 S+KG S       +G  +L++
Sbjct: 253 AIGPFSNAPLDTIKTRLQKDKST----------------SFKGESGWKRIAHIGTQLLKE 296

Query: 282 EGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMR 314
           EG  +LY+G++  + +  P   V+   YE V R
Sbjct: 297 EGFRALYKGITPRVMRVAPGQAVTFTVYEFVRR 329

>Scas_721.129
          Length = 323

 Score = 80.5 bits (197), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 78/331 (23%), Positives = 143/331 (43%), Gaps = 39/331 (11%)

Query: 4   IDDGQHNTDHLRKGEDVKVSQ--SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP 61
           + D +     + K    KVS+  S +AG ++  +A T   P++ +KIR+QL+        
Sbjct: 1   MSDTKPQKKEIEKTAAQKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQ 60

Query: 62  SGLLKMMKGM--ILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGET---SDM 116
                 ++GM  I    G+R   KG V   +  +   G++   Y    N    T   ++ 
Sbjct: 61  KVYRNPIQGMGVIFRNEGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEE 120

Query: 117 NGQLQSLVV----GALAGMTSSFVSYPTDVLRTRFIANQD-VALSSLSHGCKEIWN---- 167
           + ++Q + +    GA +G+  + +  P  +++TR  +  D + +   +H  + +WN    
Sbjct: 121 SHKIQKVSINVAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTH-YRNVWNGLST 179

Query: 168 ---MEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSIS 224
               EG  G FRG  A++      +S+    Y + K +  +     D    L  +AS+IS
Sbjct: 180 IARTEGFKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPG-LHLTASTIS 238

Query: 225 GVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGL 284
           G+   +V  P D I  RI         +N +  +       YKG   +   +  +R EG+
Sbjct: 239 GLGVAVVMNPWDVILTRI---------YNQKGNL-------YKGP--VDCFVKTVRTEGI 280

Query: 285 LSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
            +LY+G    + +  P T++ L   E  M+L
Sbjct: 281 SALYKGFQAQILRIAPHTIICLTFMEQTMKL 311

>Kwal_23.3042
          Length = 542

 Score = 81.3 bits (199), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 76/327 (23%), Positives = 136/327 (41%), Gaps = 55/327 (16%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTG-----------QAPSGLLKMMKGMILN 74
            +AG VSG+++RT  AP D +K+ L  R   +            + P+  L  +K  ++ 
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVK 287

Query: 75  -------EGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGE---TSDMNG--QLQS 122
                  +GG+R+F+ GN    M        +F S+     L  +     D  G  +  +
Sbjct: 288 AATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFST 347

Query: 123 LVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHG-------CKEIWNMEGIPGFF 175
            + G L G+ +    YP D L+ R    Q   L++ S G        K+++   G+  F+
Sbjct: 348 YLAGGLGGVMAQLSVYPIDTLKYRV---QCAPLNTESKGRQLLISTAKDMYKEGGLRIFY 404

Query: 176 RGCTASMFTITLSASILFGTYESIKI-YCDEYSK-------ESDYTNYLRYSASSISGVT 227
           RG T  +  I   A++  GT+ ++K  Y    ++       +   +N       + SG  
Sbjct: 405 RGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGTV 464

Query: 228 SKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSL 287
                YP++ +R R+Q + +    H             Y G  F  + L  +++EG   L
Sbjct: 465 GATAVYPVNLLRTRLQAQGTFAHPHR------------YNG--FRDVLLKTVQREGYQGL 510

Query: 288 YQGVSMSLCKTVPSTVVSLWAYETVMR 314
           ++G+  +L K  P+  +S   YE + R
Sbjct: 511 FKGLVPNLAKVCPAVSISYLCYENLKR 537

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 51/122 (41%), Gaps = 11/122 (9%)

Query: 205 EYSKESDYT---NYLR----YSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENK 257
           + S E D T   +++R    + A  +SGV S+  T P D I+  +  R  +         
Sbjct: 208 DLSSEGDVTLINDFIRGFGFFIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKD 267

Query: 258 IVTEIYQ----SYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVM 313
           I+ E       S   +  ++    + RQ G+ + Y G  ++  K  P + +   ++E   
Sbjct: 268 IILEKNPNADLSKIKSPLVKAATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAK 327

Query: 314 RL 315
           RL
Sbjct: 328 RL 329

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 79.7 bits (195), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 82/331 (24%), Positives = 149/331 (45%), Gaps = 43/331 (12%)

Query: 6   DGQHNTDHLRKGEDVKVSQ--SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSG 63
           D       + K    K+S+  S VAG ++  +A TV  P++ +KIR+QL+   +  A   
Sbjct: 4   DNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKV 63

Query: 64  LLKMMKGM--ILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSY----SFYNNLFGETSDMN 117
               ++GM  I    G++   KG     +  +   G++   Y    S  N LF    + +
Sbjct: 64  YKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPH 123

Query: 118 GQLQSLVV----GALAGMTSSFVSYPTDVLRTRFIA-NQDVALSSLSH------GCKEIW 166
            ++QS+ V    GA +G+  + +  P  +++TR  + ++ + +   +H      G   I+
Sbjct: 124 -KVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIF 182

Query: 167 NMEGIPGFFRGCTASMFTITLSASILFGTYESIK--IYCDEYSKESDYTNYLRYSASSIS 224
             EG+ G FRG  A++      +S+    Y + K  +  ++  K+      L  +AS+IS
Sbjct: 183 KTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGP---ALHLTASTIS 239

Query: 225 GVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGL 284
           G+   +V  P D I  RI         +N +  +       YKG   I   +  +R EG+
Sbjct: 240 GLGVAVVMNPWDVILTRI---------YNQKGDL-------YKGP--IDCLVKTVRIEGV 281

Query: 285 LSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
            +LY+G +  + +  P T++ L   E  M+L
Sbjct: 282 TALYKGFAAQVFRIAPHTIMCLTFMEQTMKL 312

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 79.7 bits (195), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 77/299 (25%), Positives = 132/299 (44%), Gaps = 22/299 (7%)

Query: 16  KGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP-----SGLLKMMKG 70
           K ++   + + + G VS  +A+T  +P++ +KI +Q +     Q       SG++   K 
Sbjct: 6   KQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKR 65

Query: 71  MILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFG-ETSDMNGQ--LQSLVVGA 127
               EG L SFW+GN    + Y       F+       +FG +  +  G+    +L  G 
Sbjct: 66  TAKQEG-LISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAGNLASGG 124

Query: 128 LAGMTSSFVSYPTDVLRTRFIANQDVA-------LSSLSHGCKEIWNMEGIPGFFRGCTA 180
            AG  S    Y  D  RTR  A+   +        + L+   K+    +GI G +RG   
Sbjct: 125 AAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMP 184

Query: 181 SMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRR 240
           S+  I +   + FG ++S+K      S +  +           +G ++   +YPLDT+RR
Sbjct: 185 SVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLLGWVVTTGAST--CSYPLDTVRR 242

Query: 241 RIQVRNSVYVQHNVENKIVTEIYQSYK-GASFIRMGLNILRQ---EGLLSLYQGVSMSL 295
           R+ + +   V++N     + +I  S   G+ F   G NILR     G++S+Y  + M L
Sbjct: 243 RMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVISMYDQLQMIL 301

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 79.3 bits (194), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 75/321 (23%), Positives = 140/321 (43%), Gaps = 43/321 (13%)

Query: 6   DGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLL 65
           DG H++         +V + L+AG+  G+    +  P DT K+RLQ     T   P+  L
Sbjct: 15  DGAHDS--------TRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQ-----TSSVPTTAL 61

Query: 66  KMMKGMILNEGGLRSFWKGNVP-----GTMMYVLYGGAQFSSYSFYNNLFGET--SDMNG 118
            ++K ++ NE G R F+KG +      G  + V +G  + +   F+++  G +  ++  G
Sbjct: 62  DVVKKLVKNE-GFRGFYKGTLTPLVGVGACVSVQFGVNE-AMKRFFHSRNGNSGPNETLG 119

Query: 119 QLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKE-IWNMEGIPGFFRG 177
            LQ  + G   G  +SF++ P + +R R         ++  HG  + I  +       RG
Sbjct: 120 LLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRG 179

Query: 178 CTASMFTITLSASILFGTYESIKIYCDEYSK---ESDYTNYLRYSASSISGVTSKMVTYP 234
            T +M   +    + F TYE+  +  +E  K    S+   +      + SG T  ++ YP
Sbjct: 180 LTPTMLRESHGCGVYFLTYEA--LIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYP 237

Query: 235 LDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMS 294
           LD I+  +Q  +               + Q  +G + +++   I    GL S ++G   +
Sbjct: 238 LDVIKSVMQTDS---------------LLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPT 282

Query: 295 LCKTVPSTVVSLWAYETVMRL 315
           + +  P+   +   +E  MR+
Sbjct: 283 MLRAAPANGATFATFELAMRV 303

>Scas_578.3*
          Length = 524

 Score = 80.9 bits (198), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 90/196 (45%), Gaps = 14/196 (7%)

Query: 19  DVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGL 78
           D+   Q+ VAG ++G++A+  I P+DTLK R+Q  P       + LL      +  EGG+
Sbjct: 323 DLSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGI 382

Query: 79  RSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF----------GETSDMNGQLQSLVVGAL 128
           R F++G + G +    Y      ++S     +           E   M   L  L +GA 
Sbjct: 383 RVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAF 442

Query: 129 AGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIW----NMEGIPGFFRGCTASMFT 184
           +G   +   YP ++LRTR  A    A      G ++++      EG+PGF++G   ++  
Sbjct: 443 SGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTLVK 502

Query: 185 ITLSASILFGTYESIK 200
           +  + SI +  YE  K
Sbjct: 503 VCPAVSIGYLCYEKFK 518

 Score = 77.8 bits (190), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 131/323 (40%), Gaps = 57/323 (17%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYT-----------------GQAPSGLLKMM 68
            +AG +SG+++RT  APLD +K+ L  R   +                  +  S ++K +
Sbjct: 212 FIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKAI 271

Query: 69  KGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETS------DMNGQLQS 122
           + +   +GGLR+F+ GN             +F ++     L    S      D++ +LQ+
Sbjct: 272 RSL-YRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLS-KLQT 329

Query: 123 LVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHG-------CKEIWNMEGIPGFF 175
            V G +AG+ +    YP D L+ R    Q   L     G        KE++   GI  F+
Sbjct: 330 YVAGGIAGVMAQISIYPIDTLKFRI---QCAPLEGNLKGNALLISTAKEMYKEGGIRVFY 386

Query: 176 RGCTASMFTITLSASILFGTYESIKI-YCDEYSK-----ESD--YTNYLRYSASSISGVT 227
           RG       I   A++  GT+ ++K  Y    SK     E D   +  L     + SG  
Sbjct: 387 RGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGTV 446

Query: 228 SKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSL 287
                YP++ +R R+Q + +                  Y    F  + +  L++EG+   
Sbjct: 447 GATAVYPINLLRTRLQAQGTY--------------AHPYTYTGFRDVFMQTLKREGVPGF 492

Query: 288 YQGVSMSLCKTVPSTVVSLWAYE 310
           Y+G+  +L K  P+  +    YE
Sbjct: 493 YKGLVPTLVKVCPAVSIGYLCYE 515

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 46/101 (45%), Gaps = 4/101 (3%)

Query: 218 YSASSISGVTSKMVTYPLDTIRRRIQVR---NSVYVQHNVENKIVTEIYQSYKGASFIRM 274
           + A  +SGV S+  T PLD I+  +  R   +S  +   +  +I        + +  I+ 
Sbjct: 212 FIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIR-SPIIKA 270

Query: 275 GLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
             ++ RQ GL + Y G  +S+ K  P + +    +E   RL
Sbjct: 271 IRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRL 311

>Scas_632.9
          Length = 292

 Score = 79.0 bits (193), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/312 (22%), Positives = 139/312 (44%), Gaps = 33/312 (10%)

Query: 12  DHLRKGEDVKVSQS-LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKG 70
           DH  +   V+ + S +V GS++G   + +  P DT+K+RLQ + S+        +K    
Sbjct: 6   DHPIEKSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQTQGSHIFPTTWSCIKYTYH 65

Query: 71  MILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAG 130
              NEG  R F++G         L     F SY+  +N+  + ++++     L+ GA AG
Sbjct: 66  ---NEGVWRGFFQGIGSPLFGAALENATLFVSYNQCSNVLEKFTNVSPLSNILLSGAFAG 122

Query: 131 MTSSFVSYPTDVLRTRF-IANQDVALSSLSHGCKEIWNM------EGIPGFFRGCTASMF 183
             +SFV  P ++++ +  ++N   A+       K I  +      +GI G ++G +++  
Sbjct: 123 SCASFVLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFI 182

Query: 184 TITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQ 243
             +L     F TYE +K    +  K+++   +    + + +G+      +P DT++  +Q
Sbjct: 183 RESLGGVAWFATYEVMKQGLKDRRKDTENKTWELLVSGASAGLAFNASIFPADTVKSMMQ 242

Query: 244 VRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTV 303
             +   +  N   K++T                      G+   Y+G+ ++L + VP+  
Sbjct: 243 TEHITLI--NAVKKVLTTY--------------------GITGFYRGLGITLIRAVPANA 280

Query: 304 VSLWAYETVMRL 315
              + YET+ ++
Sbjct: 281 TVFYMYETLSKM 292

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 79.3 bits (194), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/324 (24%), Positives = 137/324 (42%), Gaps = 41/324 (12%)

Query: 12  DHLRKGEDVKVSQ--SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMK 69
            H +K    KVS+  S VAG ++  +A TV  P D +K R+QL+      A       ++
Sbjct: 8   KHNQKTAAHKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQ 67

Query: 70  --GMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYS---------FYNNLFGETSDMNG 118
             G+I    G+    KG     +  +   G++   Y          FY N+  E+  +  
Sbjct: 68  AFGVIFKNEGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNV--ESHKVQH 125

Query: 119 QLQSLVVGALAGMTSSFVSYPTDVLRTRFIA-------NQDVALSSLSHGCKEIWNMEGI 171
              ++  GA +G+  +F+  P  +++TR  +        Q    +S  +G   I+  EGI
Sbjct: 126 IGINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGI 185

Query: 172 PGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMV 231
            G FRG  A+M    + +++    Y   K +  ++   +D T  L   +S+I+G    + 
Sbjct: 186 KGLFRGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTG-LHLLSSTIAGFGVGVA 244

Query: 232 TYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGV 291
             P D +  R+         +N +  +       Y G   I   +  +R EGL +LY+G 
Sbjct: 245 MNPWDVVLTRV---------YNQKGNL-------YSGP--IDCFIKTVRNEGLSALYKGF 286

Query: 292 SMSLCKTVPSTVVSLWAYETVMRL 315
              + +  P TV+ L   E  ++L
Sbjct: 287 GAQILRIGPHTVLCLTFMEQTLKL 310

>Kwal_26.7972
          Length = 358

 Score = 78.2 bits (191), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 78/323 (24%), Positives = 135/323 (41%), Gaps = 52/323 (16%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQL-RPSYTGQAPSGLLKMMKGMILN-EGGLRSF 81
           +S +AG ++G  A+T+IAPLD +KI  Q   P Y   + S +  +  G  +N   G+R F
Sbjct: 29  RSGLAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGF 88

Query: 82  WKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTD 141
           ++G+    +    Y   +F +Y    +    + +     + L  G++AG+ S F++YP D
Sbjct: 89  YQGHSATLIRIFPYAAIKFIAYEQIRHFMIPSKEYETHARRLASGSMAGLCSVFMTYPLD 148

Query: 142 VLRTRFIANQDVALSSLSHGCKEIWNMEG---------IP-------GFFRGCTA----- 180
           ++R R     D +   +    K+I+             +P        F+RG T      
Sbjct: 149 LIRVRLAYVTDRSRIKMLPVIKQIYTERASESLTSKSYVPRWFAHWCNFYRGFTPTVLGM 208

Query: 181 ------SMFTITLSASIL----FGTYESIKIYCDEYSKESD------YTNYLRYSASSIS 224
                 S F   L   IL       Y  + I  +E +  S          +    A  ++
Sbjct: 209 IPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPLKTWAELVAGGLA 268

Query: 225 GVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGL 284
           G+ S+  +YP + IRRR+QV  SV    ++ N      +Q+      IR+   I ++ G 
Sbjct: 269 GMASQTASYPFEIIRRRLQV--SVVSPTSIHN------FQTI--PDMIRI---IYKERGW 315

Query: 285 LSLYQGVSMSLCKTVPSTVVSLW 307
              + G+S+   K  P    S +
Sbjct: 316 RGFFVGLSIGYIKVTPMVACSFF 338

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 42/95 (44%), Gaps = 16/95 (16%)

Query: 220 ASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGAS--FIRMGLN 277
           A  I+G  +K +  PLD I+   Q  N  Y++              Y G++   IR G +
Sbjct: 33  AGGIAGSCAKTLIAPLDRIKILFQTSNPHYLK--------------YSGSTMGLIRAGAH 78

Query: 278 ILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETV 312
           I   +G+   YQG S +L +  P   +   AYE +
Sbjct: 79  INAHDGIRGFYQGHSATLIRIFPYAAIKFIAYEQI 113

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 77.8 bits (190), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 76/317 (23%), Positives = 139/317 (43%), Gaps = 37/317 (11%)

Query: 12  DHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQA-----PSGLLK 66
           D+    E+  +   L AG+ +G++  +++ P+D +K R+Q   S TG +     PS +L 
Sbjct: 7   DYEALPENAPLVYQLAAGAFAGIMEHSIMFPIDAIKTRMQAV-STTGSSAATRLPSNMLA 65

Query: 67  MMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQ----FSSYSFYNNLFGETSD--MNGQL 120
            +  +   EG L + WKG        VL  G      F++Y    +   +  D   +  L
Sbjct: 66  QIAKISTTEGSL-ALWKG----VQSVVLGAGPAHAVYFATYEMCKSRLIDPEDRQTHQPL 120

Query: 121 QSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTA 180
           ++ + G LA + +  +  P D ++ R    Q     S++     ++  EGI  FF     
Sbjct: 121 KTALSGTLATVAADALMNPFDTIKQRL---QLHPSDSMTKCAVRMYQREGIAAFFYSYPT 177

Query: 181 SMFTITLSASILFGTYES-IKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIR 239
           ++      A++ F  YES  KI+    +  ++Y  ++      ISG T   +T PLD ++
Sbjct: 178 TIAMNIPFAALNFVIYESSTKIF----NPSNNYNPWIHCLCGGISGATCAAITTPLDCVK 233

Query: 240 RRIQVRNSVYVQHNVENKIVTEIYQSYKGA-SFIRMGLNILRQEGLLSLYQGVSMSLCKT 298
             +Q+R +  VQ            Q +K A +F +    I +  G    ++G+   +   
Sbjct: 234 TVLQIRGADSVQS-----------QLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISN 282

Query: 299 VPSTVVSLWAYETVMRL 315
           +P+T +S  +YE    L
Sbjct: 283 MPATAISWTSYEFAKHL 299

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/204 (17%), Positives = 80/204 (39%), Gaps = 34/204 (16%)

Query: 123 LVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNM----------EGIP 172
           L  GA AG+    + +P D ++TR    Q V+ +  S   +   NM          EG  
Sbjct: 21  LAAGAFAGIMEHSIMFPIDAIKTRM---QAVSTTGSSAATRLPSNMLAQIAKISTTEGSL 77

Query: 173 GFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVT 232
             ++G  + +     + ++ F TYE  K    +      +       + +++ V +  + 
Sbjct: 78  ALWKGVQSVVLGAGPAHAVYFATYEMCKSRLIDPEDRQTHQPLKTALSGTLATVAADALM 137

Query: 233 YPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVS 292
            P DTI++R+Q+  S                      S  +  + + ++EG+ + +    
Sbjct: 138 NPFDTIKQRLQLHPS---------------------DSMTKCAVRMYQREGIAAFFYSYP 176

Query: 293 MSLCKTVPSTVVSLWAYETVMRLY 316
            ++   +P   ++   YE+  +++
Sbjct: 177 TTIAMNIPFAALNFVIYESSTKIF 200

>Scas_667.22
          Length = 306

 Score = 77.8 bits (190), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 74/321 (23%), Positives = 137/321 (42%), Gaps = 36/321 (11%)

Query: 4   IDDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSG 63
           IDD +++  H    ++ +V + L+AG+  G+    V  P DT K+RLQ     T   P+ 
Sbjct: 11  IDDLENHPKH----DNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQ-----TSSTPTT 61

Query: 64  LLKMMKGMILNEGGLRSFWKGNVP-----GTMMYVLYGGAQFSSYSFYNNLFGETSDMNG 118
            +++++ ++ NEG  + F+KG +      G  + + +G  +     F++     TS +  
Sbjct: 62  AMEVIRKLLKNEGP-KGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILS 120

Query: 119 QLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKE-IWNMEGIPGFFRG 177
             Q  + G   G+T+SF++ P + +R R         +    G  + I  +    GF RG
Sbjct: 121 LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRG 180

Query: 178 CTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSA---SSISGVTSKMVTYP 234
            T +M          F  YE+  +  +E +K    T    +      ++SG T  M+ YP
Sbjct: 181 LTPTMLREGHGCGTYFLVYEA--MVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYP 238

Query: 235 LDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMS 294
           LD I+  +Q  N               +     G S   +   +  + GL + ++G   +
Sbjct: 239 LDVIKSVMQTDN---------------LKSPKYGNSISSVAKTLYAKGGLGAFFKGFGPT 283

Query: 295 LCKTVPSTVVSLWAYETVMRL 315
           + +  P+   +   +E  MRL
Sbjct: 284 MLRAAPANGATFATFELAMRL 304

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 46/99 (46%), Gaps = 7/99 (7%)

Query: 16  KGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQ---LRPSYTGQAPSGLLKMMKGMI 72
           K  +V   +  + G++SG     ++ PLD +K  +Q   L+    G + S + K +    
Sbjct: 212 KRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYA-- 269

Query: 73  LNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFG 111
             +GGL +F+KG  P  +      GA F+++     L G
Sbjct: 270 --KGGLGAFFKGFGPTMLRAAPANGATFATFELAMRLLG 306

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 77.8 bits (190), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 71/317 (22%), Positives = 136/317 (42%), Gaps = 39/317 (12%)

Query: 10  NTDHLRKGEDV---------KVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQA 60
           NT  L   E++          +   L+AG+ +G++  +++ P+D LK R+Q        A
Sbjct: 2   NTSELSIAEEIDYEALPSHAPLHSQLLAGAFAGIMEHSLMFPIDALKTRVQAA-GLNKAA 60

Query: 61  PSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQ-----FSSYSFYNNLFGETSD 115
            +G++  +  +   EG + + WKG     +  V+ G        F +Y F         D
Sbjct: 61  STGMISQISKISTMEGSM-ALWKG-----VQSVILGAGPAHAVYFGTYEFCKARLISPED 114

Query: 116 MNGQ--LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPG 173
           M     +++ + G +A + +  +  P D ++ R   + ++ + +++   K+I+  EG   
Sbjct: 115 MQTHQPMKTALSGTIATIAADALMNPFDTVKQRLQLDTNLRVWNVT---KQIYQNEGFAA 171

Query: 174 FFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTY 233
           F+     ++      A+  F  YES   +   ++ ++ Y   +      ISG T   +T 
Sbjct: 172 FYYSYPTTLAMNIPFAAFNFMIYESASKF---FNPQNSYNPLIHCLCGGISGATCAALTT 228

Query: 234 PLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSM 293
           PLD I+  +QVR S          +  EI +     +F R    IL   G    ++G+  
Sbjct: 229 PLDCIKTVLQVRGS--------ETVSIEIMKD--ANTFGRASRAILEVHGWKGFWRGLKP 278

Query: 294 SLCKTVPSTVVSLWAYE 310
            +   +P+T +S  AYE
Sbjct: 279 RIVANIPATAISWTAYE 295

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 87/201 (43%), Gaps = 33/201 (16%)

Query: 123 LVVGALAGMTSSFVSYPTDVLRTRFIA---NQDVALSSLSHGCKEIWNMEGIPGFFRGCT 179
           L+ GA AG+    + +P D L+TR  A   N+  +   +S   K I  MEG    ++G  
Sbjct: 27  LLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQISK-ISTMEGSMALWKGVQ 85

Query: 180 ASMFTITLSASILFGTYESIKIYCDE--YSKESDYTNYLRYSASS--ISGVTSKMVTYPL 235
           + +     + ++ FGTYE    +C     S E   T+    +A S  I+ + +  +  P 
Sbjct: 86  SVILGAGPAHAVYFGTYE----FCKARLISPEDMQTHQPMKTALSGTIATIAADALMNPF 141

Query: 236 DTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSL 295
           DT+++R+Q+  ++ V +     +  +IYQ+                EG  + Y     +L
Sbjct: 142 DTVKQRLQLDTNLRVWN-----VTKQIYQN----------------EGFAAFYYSYPTTL 180

Query: 296 CKTVPSTVVSLWAYETVMRLY 316
              +P    +   YE+  + +
Sbjct: 181 AMNIPFAAFNFMIYESASKFF 201

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 86/196 (43%), Gaps = 19/196 (9%)

Query: 18  EDVKVSQSL---VAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILN 74
           ED++  Q +   ++G+++ + A  ++ P DT+K RLQL  +        +  + K +  N
Sbjct: 113 EDMQTHQPMKTALSGTIATIAADALMNPFDTVKQRLQLDTNLR------VWNVTKQIYQN 166

Query: 75  EGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSS 134
           E G  +F+        M + +    F  Y   +  F   +  N  +  L  G ++G T +
Sbjct: 167 E-GFAAFYYSYPTTLAMNIPFAAFNFMIYESASKFFNPQNSYNPLIHCL-CGGISGATCA 224

Query: 135 FVSYPTDVLRT--RFIANQDVAL------SSLSHGCKEIWNMEGIPGFFRGCTASMFTIT 186
            ++ P D ++T  +   ++ V++      ++     + I  + G  GF+RG    +    
Sbjct: 225 ALTTPLDCIKTVLQVRGSETVSIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANI 284

Query: 187 LSASILFGTYESIKIY 202
            + +I +  YE  K +
Sbjct: 285 PATAISWTAYECAKHF 300

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 77.8 bits (190), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 128/294 (43%), Gaps = 30/294 (10%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWK 83
             L+AG+ +G++  +V+ P+D LK R+Q   + +  A   +L  +  +  +EG L + WK
Sbjct: 35  HQLIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSA-KNMLSQISHISTSEGTL-ALWK 92

Query: 84  GNVPGTMMYVLYGGAQ-----FSSYSFYNNLFGETSDMNGQ--LQSLVVGALAGMTSSFV 136
           G     +  V+ G        F +Y F      ++SD       ++ + GA A   S  +
Sbjct: 93  G-----VQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHHPFKTAISGACATTASDAL 147

Query: 137 SYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTY 196
             P D ++ R   N     +S+    K+I+  EG+  F+     ++      A+  F  Y
Sbjct: 148 MNPFDTIKQRIQLNTS---ASVWQTTKQIYQSEGLAAFYYSYPTTLVMNIPFAAFNFVIY 204

Query: 197 ESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVEN 256
           ES   + +     ++Y   +     SISG T   +T PLD I+  +Q+R S         
Sbjct: 205 ESSTKFLNP---SNEYNPLIHCLCGSISGSTCAAITTPLDCIKTVLQIRGS--------Q 253

Query: 257 KIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
            +  EI +  K  +F +    I +  G    ++G    +   +P+T +S  AYE
Sbjct: 254 TVSLEIMR--KADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYE 305

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 84/205 (40%), Gaps = 39/205 (19%)

Query: 121 QSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSS------LSHGCKEIWNMEGIPGF 174
             L+ GA AG+    V +P D L+TR  +    +LS+      +SH    I   EG    
Sbjct: 35  HQLIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAKNMLSQISH----ISTSEGTLAL 90

Query: 175 FRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGV----TSKM 230
           ++G  + +     + ++ FGTYE    +C +   +S  T       ++ISG      S  
Sbjct: 91  WKGVQSVILGAGPAHAVYFGTYE----FCKKNLIDSSDTQTHHPFKTAISGACATTASDA 146

Query: 231 VTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQG 290
           +  P DTI++RIQ+  S  V    +     +IYQS                EGL + Y  
Sbjct: 147 LMNPFDTIKQRIQLNTSASVWQTTK-----QIYQS----------------EGLAAFYYS 185

Query: 291 VSMSLCKTVPSTVVSLWAYETVMRL 315
              +L   +P    +   YE+  + 
Sbjct: 186 YPTTLVMNIPFAAFNFVIYESSTKF 210

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 89/211 (42%), Gaps = 24/211 (11%)

Query: 4   IDDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSG 63
           ID     T H  K        + ++G+ +   +  ++ P DT+K R+QL  S      + 
Sbjct: 120 IDSSDTQTHHPFK--------TAISGACATTASDALMNPFDTIKQRIQLNTS------AS 165

Query: 64  LLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSL 123
           + +  K +  +E GL +F+       +M + +    F  Y         +++ N  +  L
Sbjct: 166 VWQTTKQIYQSE-GLAAFYYSYPTTLVMNIPFAAFNFVIYESSTKFLNPSNEYNPLIHCL 224

Query: 124 VVGALAGMTSSFVSYPTDVLRT--RFIANQDVALS------SLSHGCKEIWNMEGIPGFF 175
             G+++G T + ++ P D ++T  +   +Q V+L       + S     I+ + G  GF+
Sbjct: 225 -CGSISGSTCAAITTPLDCIKTVLQIRGSQTVSLEIMRKADTFSKAASAIYQVYGWKGFW 283

Query: 176 RGCTASMFTITLSASILFGTYESIKIYCDEY 206
           RG    +     + +I +  YE  K +   Y
Sbjct: 284 RGWKPRIVANMPATAISWTAYECAKHFLMTY 314

 Score = 31.2 bits (69), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 40/96 (41%), Gaps = 16/96 (16%)

Query: 215 YLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRM 274
           Y +  A + +G+    V +P+D ++ RIQ  N+                +S    + +  
Sbjct: 34  YHQLIAGAFAGIMEHSVMFPIDALKTRIQSANA----------------KSLSAKNMLSQ 77

Query: 275 GLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
             +I   EG L+L++GV   +    P+  V    YE
Sbjct: 78  ISHISTSEGTLALWKGVQSVILGAGPAHAVYFGTYE 113

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 77.4 bits (189), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 127/287 (44%), Gaps = 23/287 (8%)

Query: 29  GSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP-----SGLLKMMKGMILNEGGLRSFWK 83
           G VS  +++T  AP++ +K+ +Q +     Q       +G++   K    +EG + SFW+
Sbjct: 16  GGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRTAASEG-VISFWR 74

Query: 84  GNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQ----SLVVGALAGMTSSFVSYP 139
           GN    + Y       F+       +FG   +++G  +    +L  G  AG  S    Y 
Sbjct: 75  GNTANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYAKWFAGNLASGGAAGGLSLLFVYS 134

Query: 140 TDVLRTRFIANQDVA-------LSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASIL 192
            D  RTR  A+   A        + L    K+    +GI G +RG   S+  I +   + 
Sbjct: 135 LDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVVYRGLY 194

Query: 193 FGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQH 252
           FG Y+S+K      + ES +        +  +G ++   +YPLDT+RRR+ + +   V++
Sbjct: 195 FGMYDSLKPLLLTGNLESSFIASFLLGWAVTTGAST--ASYPLDTVRRRMMMTSGQAVKY 252

Query: 253 NVENKIVTEIYQSYKGASFIR-MGLNILR---QEGLLSLYQGVSMSL 295
           +       +I  +    S  +  G NILR     G++SLY  + + L
Sbjct: 253 DGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGVISLYDQLQLVL 299

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 74/176 (42%), Gaps = 11/176 (6%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMI------LNEGGL 78
           +L +G  +G L+   +  LD  + RL    + +  A  G  +   G++      L   G+
Sbjct: 117 NLASGGAAGGLSLLFVYSLDYARTRL---AADSKSAKKGGERQFNGLVDVYKKTLASDGI 173

Query: 79  RSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSY 138
              ++G +P  +  V+Y G  F  Y     L    +  +  + S ++G      +S  SY
Sbjct: 174 AGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGNLESSFIASFLLGWAVTTGASTASY 233

Query: 139 PTDVLRTRFI--ANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASIL 192
           P D +R R +  + Q V         ++I   EG+   F+GC A++      A ++
Sbjct: 234 PLDTVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGVI 289

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 77.0 bits (188), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 130/304 (42%), Gaps = 32/304 (10%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP--------SGLLKMMKGMILNEGG 77
            ++G+V+G+   TV+ PLD +K R QL  +    A         +G++  +K ++  EG 
Sbjct: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75

Query: 78  LRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQ--SLVVGALAGMTSSF 135
            R  ++G     +M       +F+    Y  +F    + N   Q  S+  GA AGMT + 
Sbjct: 76  SR-LYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIAAGASAGMTEAA 134

Query: 136 VSYPTDVLRTRFIANQDVALSSLSH-GC-KEIWNMEGIPGFFRGCTASMFTITLSASILF 193
           V  P ++++ R    QDV  S L    C K+    EGI G ++G  ++M+   L     F
Sbjct: 135 VIVPFELIKIRM---QDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYF 191

Query: 194 GT-YESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQH 252
           G  Y+         +K     N L   A +I G    M+  P D ++ RIQ  ++V    
Sbjct: 192 GVIYQVRNSMPVAKTKGQKTRNDL--IAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAV 249

Query: 253 NVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETV 312
              N  +  +             L I R+EG  +LY+G    +C+  P   + L  +  +
Sbjct: 250 KKYNWCLPSL-------------LVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGM 296

Query: 313 MRLY 316
           M  +
Sbjct: 297 MNFF 300

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/210 (20%), Positives = 85/210 (40%), Gaps = 40/210 (19%)

Query: 113 TSDMNGQ----LQSLVVGALAGMTSSFVSYPTDVLRTRF-----------IANQDVALSS 157
           +SD N +    +   + GA+AG++   V YP DV++TRF           +  Q    + 
Sbjct: 2   SSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNG 61

Query: 158 LSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLR 217
           +    K+I   EG    +RG ++ M       +  F   +  +         ++ T  + 
Sbjct: 62  VIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS 121

Query: 218 YSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLN 277
            +A + +G+T   V  P + I+ R+Q                 ++  SY G   +     
Sbjct: 122 IAAGASAGMTEAAVIVPFELIKIRMQ-----------------DVKSSYLGP--MDCLKK 162

Query: 278 ILRQEGLLSLYQGVSMSLCKTVPSTVVSLW 307
            ++ EG++ LY+G+  ++ +       +LW
Sbjct: 163 TIKNEGIMGLYKGIESTMWRN------ALW 186

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 79/177 (44%), Gaps = 15/177 (8%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQ-LRPSYTGQAPSGLLKMMKGMILNEGGLRSFWK 83
           S+ AG+ +G+    VI P + +KIR+Q ++ SY G      +  +K  I NE G+   +K
Sbjct: 121 SIAAGASAGMTEAAVIVPFELIKIRMQDVKSSYLGP-----MDCLKKTIKNE-GIMGLYK 174

Query: 84  GNVPGTMMYVLYGGAQFSS-YSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDV 142
           G         L+ G  F   Y   N++    +        L+ GA+ G   + ++ P DV
Sbjct: 175 GIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDV 234

Query: 143 LRTRFIANQDVALSSLS--HGCKE----IWNMEGIPGFFRGCTASMFTITLSASILF 193
           +++R I + D   S++   + C      I+  EG    ++G    +  +    S++ 
Sbjct: 235 VKSR-IQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLML 290

 Score = 35.0 bits (79), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 45/104 (43%), Gaps = 21/104 (20%)

Query: 9   HNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQ-------LRPSYTGQAP 61
            N+  + K +  K    L+AG++ G +   +  P D +K R+Q           Y    P
Sbjct: 198 RNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLP 257

Query: 62  SGLLKMMKGMILNEGGLRSFWKGNVP--------GTMMYVLYGG 97
           S L+      I  E G R+ +KG VP        G++M V++ G
Sbjct: 258 SLLV------IYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTG 295

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/297 (20%), Positives = 130/297 (43%), Gaps = 31/297 (10%)

Query: 21  KVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRS 80
           + ++ ++ GS++G + + +  P DT+K+RLQ +P++        +K       NEG  R 
Sbjct: 5   EAAKDILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTTWSCIKFTYD---NEGLWRG 61

Query: 81  FWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPT 140
           F++G         L     F S++    L    S ++   +++  GA AG  +SFV  P 
Sbjct: 62  FYQGIGSPLAGAALENAVLFVSFNQAKRLLDVESLLSPLSKTVWAGAFAGACASFVLTPV 121

Query: 141 DVLRTRFIANQDVALSSLSH-----GCKEIWNMEGIPGFFRGCTASMFTITLSASILFGT 195
           ++++ +   + +++ +  SH       K + +  G  G ++G + +    +   +  F T
Sbjct: 122 ELIKCKLQVS-NLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTT 180

Query: 196 YESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVE 255
           YE +K Y     +    T +   ++ + +G+      +P DTI+  +Q        H   
Sbjct: 181 YEVVKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQ------TDHIDL 234

Query: 256 NKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETV 312
           +    +IY                 ++G+   Y+G+ ++L + VP+     + YET+
Sbjct: 235 SSATRKIYA----------------RQGIAGFYRGLGITLIRAVPANAAIFYTYETL 275

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 78/323 (24%), Positives = 144/323 (44%), Gaps = 39/323 (12%)

Query: 12  DHLRKGEDVKVSQ--SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP---SGLLK 66
           D ++K    KVS+  S  AG ++  +A TV  P++ +KIR+QL+           +   +
Sbjct: 6   DKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQ 65

Query: 67  MMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGET---SDMNGQLQSL 123
            M G++    G+R   KG V   +  +   G++   Y     +  +T      + ++QS+
Sbjct: 66  AM-GVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSV 124

Query: 124 VV----GALAGMTSSFVSYPTDVLRTRFIA-NQDVALSSLSH------GCKEIWNMEGIP 172
            +    GA +G+  + +  P  +++TR  + +  + +   +H      G K I+  EG+ 
Sbjct: 125 GINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVK 184

Query: 173 GFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVT 232
           G FRG  A++      +S+    Y + K +        D  + L  +AS+ISG+   +V 
Sbjct: 185 GLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPS-LHLTASTISGLGVAVVM 243

Query: 233 YPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVS 292
            P D I  RI         +N +  +       YKG   I   +  ++ EG+ +LY+G  
Sbjct: 244 NPWDVILTRI---------YNQKGDL-------YKGP--IDCLVKTVKIEGITALYKGFE 285

Query: 293 MSLCKTVPSTVVSLWAYETVMRL 315
             + +  P T++ L   E  M+L
Sbjct: 286 AQVFRIGPHTILCLTFLEQTMKL 308

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 76/323 (23%), Positives = 135/323 (41%), Gaps = 48/323 (14%)

Query: 22  VSQSLVAGSVSGLLARTVIAPLDTLKIRLQL-RPSYTGQAPS--GLLKMMKGMILNEGGL 78
           + +S +AG ++G  A+T++APLD +KI  Q   P +   A S  GL++  K  I+   G 
Sbjct: 19  IVKSGLAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASK-YIMAHDGP 77

Query: 79  RSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSY 138
           R F++G+    +    Y   +F +Y    ++   T       + L+ G+LAG+ S FV+Y
Sbjct: 78  RGFFQGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESHWRRLLSGSLAGLCSVFVTY 137

Query: 139 PTDVLRTR--FIANQDVALSSLSHGC------KEIWNMEGIP-------GFFRGCTASMF 183
           P D++R R  ++  +  A       C       E      IP        F+RG T ++ 
Sbjct: 138 PLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQWFAHWSNFYRGYTPTVI 197

Query: 184 TITLSASILFGTYESIK-IY---------------CDEYSKESDYTNYLRYSASSISGVT 227
            +   A + F  ++  + I+                  Y +      + +  A  ++G+ 
Sbjct: 198 GMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQLVAGGLAGMA 257

Query: 228 SKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSL 287
           S+   YP + IRRR+QV           + I     + + G +   +   I  + G    
Sbjct: 258 SQTAAYPFEIIRRRLQV-----------SAITDPTRRHFVGIN--EIAKIIYTEGGWRGF 304

Query: 288 YQGVSMSLCKTVPSTVVSLWAYE 310
           + G+S+   K  P    S + YE
Sbjct: 305 FVGLSIGYIKVTPMVACSFFIYE 327

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 90/217 (41%), Gaps = 42/217 (19%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNE---GGLR- 79
           + L++GS++GL +  V  PLD +++RL    +Y  +     ++ +   I NE     LR 
Sbjct: 120 RRLLSGSLAGLCSVFVTYPLDLVRVRL----AYVTERHDAKVRKIMACIYNERPSEALRK 175

Query: 80  -----------SFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF-------------GETS- 114
                      +F++G  P  +  + Y G  F ++    ++F             G +S 
Sbjct: 176 WYIPQWFAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSA 235

Query: 115 -DMNGQLQS---LVVGALAGMTSSFVSYPTDVLRTRFIANQDV-----ALSSLSHGCKEI 165
            D    L++   LV G LAGM S   +YP +++R R   +            ++   K I
Sbjct: 236 YDRTVPLKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKII 295

Query: 166 WNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIY 202
           +   G  GFF G +     +T   +  F  YE  K Y
Sbjct: 296 YTEGGWRGFFVGLSIGYIKVTPMVACSFFIYERTKWY 332

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 38/95 (40%), Gaps = 16/95 (16%)

Query: 220 ASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGA--SFIRMGLN 277
           A  I+G  +K +  PLD I+   Q  N  + Q              + G+    +R    
Sbjct: 25  AGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQ--------------FAGSMGGLVRASKY 70

Query: 278 ILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETV 312
           I+  +G    +QG S +L +  P   +   AYE +
Sbjct: 71  IMAHDGPRGFFQGHSATLLRIFPYAAIKFIAYEQI 105

 Score = 31.6 bits (70), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 20  VKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRP--SYTGQAPSGLLKMMKGMILNEGG 77
           +K    LVAG ++G+ ++T   P + ++ RLQ+      T +   G+ ++ K +I  EGG
Sbjct: 242 LKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAK-IIYTEGG 300

Query: 78  LRSFWKG 84
            R F+ G
Sbjct: 301 WRGFFVG 307

>Kwal_27.12481
          Length = 304

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 81/294 (27%), Positives = 128/294 (43%), Gaps = 38/294 (12%)

Query: 29  GSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP-----SGLLKMMKGMILNEGGLRSFWK 83
           G VS  +++T  AP++ +K+ +Q +     Q       +G+ +  K    NEG + SFW+
Sbjct: 17  GGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIGECFKRTAANEG-IASFWR 75

Query: 84  GNVPGTMMYVLYGGAQFSSYSFYNNLFGETSD------MNGQLQSLVVGALAGMTSSFVS 137
           GN    + Y       F+       +FG   +        G L S   GA  G++  FV 
Sbjct: 76  GNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLAS--GGAAGGLSLMFV- 132

Query: 138 YPTDVLRTRFIANQDVA-------LSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSAS 190
           Y  D  RTR  A+   A        + L    K+    +GI G +RG   S+  I +   
Sbjct: 133 YSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVVYRG 192

Query: 191 ILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYV 250
           + FG Y+S+K      S E  +        +  +G ++   +YPLDT+RRR+ + +   V
Sbjct: 193 LYFGGYDSLKPLLLTGSLEGSFLASFLLGWAVTTGAST--ASYPLDTVRRRMMMTSGQAV 250

Query: 251 QHN----VENKIVTE--IYQSYKGASFIRMGLNILR---QEGLLSLYQGVSMSL 295
           ++N       KIV    I   +KG      G NILR     G++S+Y  + M L
Sbjct: 251 KYNGAFDAFRKIVAAEGIKSLFKGC-----GANILRGVAGAGVISMYDQLQMIL 299

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 74/176 (42%), Gaps = 11/176 (6%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMI------LNEGGL 78
           +L +G  +G L+   +  LD  + RL    + +  A  G  +   G++      L   G+
Sbjct: 117 NLASGGAAGGLSLMFVYSLDYARTRL---AADSKGAKKGGERQFNGLVDVYKKTLASDGI 173

Query: 79  RSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSY 138
              ++G +P  +  V+Y G  F  Y     L    S     L S ++G      +S  SY
Sbjct: 174 AGLYRGFLPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSFLASFLLGWAVTTGASTASY 233

Query: 139 PTDVLRTRFI--ANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASIL 192
           P D +R R +  + Q V  +      ++I   EGI   F+GC A++      A ++
Sbjct: 234 PLDTVRRRMMMTSGQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVI 289

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 75.9 bits (185), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 73/315 (23%), Positives = 131/315 (41%), Gaps = 52/315 (16%)

Query: 22  VSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSF 81
           V   LV+G   GL +   + PLD LK RLQ       QA S     ++ ++      R  
Sbjct: 8   VPAHLVSGFFGGLASVCALQPLDLLKTRLQ-----QAQASS-----LRSVLREVRTTREL 57

Query: 82  WKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQ---------LQSLVVGALAGMT 132
           W+G +P  +   +      S  ++  +     S+   +          Q+L+ GAL+   
Sbjct: 58  WRGTLPSALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAA 117

Query: 133 SSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASIL 192
              V+ P  V++ R+  +   A + L+   + IW  EG  GFF+G  A+       A + 
Sbjct: 118 VGLVTMPITVIKVRY-ESTLYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLY 176

Query: 193 FGTYESIK-----------IYCDEYSKESDYTNYLRYSASS-ISGVTSKMVTYPLDTIRR 240
              YE  K           +  DE  K +   + +    S+ +S   +  +T P DTI+ 
Sbjct: 177 VLLYEQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLATTLTAPFDTIKT 236

Query: 241 RIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVP 300
           R+Q+++     H V                F++   +I+ +E   +L+ G+S+ LC+   
Sbjct: 237 RMQLQS-----HPV---------------GFVQTLRHIVCEERARTLFDGLSLRLCRKAM 276

Query: 301 STVVSLWAYETVMRL 315
           S  ++   YE +++L
Sbjct: 277 SACIAWGIYEELLKL 291

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/317 (23%), Positives = 131/317 (41%), Gaps = 51/317 (16%)

Query: 34  LLARTVIAPLDTLKIRLQLRPSYTG---QAPSGLLK-------------MMKGM--ILNE 75
           +++RT  AP D +K+ L  R   +      P  LL              ++K    +  +
Sbjct: 187 VVSRTCTAPFDRIKVFLIARTDLSSPLLHTPEQLLHHNPRADPAKIRSPLVKAATSLYRQ 246

Query: 76  GGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF------GETSDMNGQLQSLVVGALA 129
           GGLR+F+ GN    +        +F S+     +       GET +++ +L + V G L 
Sbjct: 247 GGLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELS-RLSTYVAGGLG 305

Query: 130 GMTSSFVSYPTDVLRTRF----IANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTI 185
           G+ + F  YP D L+ R     +  +   L  L    K+++   G+  F+RG    +  +
Sbjct: 306 GIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLGVGILGV 365

Query: 186 TLSASILFGTYESIKIY--------CDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDT 237
              A++  GT+ ++K +              E   +N +     + SG     V YP++ 
Sbjct: 366 FPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGATVVYPINL 425

Query: 238 IRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCK 297
           +R R+Q + +    H             Y G  F  +    +++EGL  LY+G+  +L K
Sbjct: 426 LRTRLQAQGTYAHPHR------------YDG--FQDVFRKTVQREGLPGLYKGLVPTLAK 471

Query: 298 TVPSTVVSLWAYETVMR 314
             P+  +S   YE + R
Sbjct: 472 VCPAVAISYLCYENLKR 488

 Score = 71.6 bits (174), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 97/201 (48%), Gaps = 18/201 (8%)

Query: 17  GEDVKVSQ--SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTG-QAPSGLLKMMKGMIL 73
           GE  ++S+  + VAG + G++A+  + P+DTLK R+Q  P  T  +    L+K  K M  
Sbjct: 288 GETGELSRLSTYVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMY- 346

Query: 74  NEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYN--------NLFG--ETSDMNGQLQSL 123
            EGGLR F++G   G +    Y      ++S           N  G  E   +   L  L
Sbjct: 347 REGGLRLFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVL 406

Query: 124 VVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIW----NMEGIPGFFRGCT 179
            +GA +G   + V YP ++LRTR  A    A      G ++++      EG+PG ++G  
Sbjct: 407 PMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLV 466

Query: 180 ASMFTITLSASILFGTYESIK 200
            ++  +  + +I +  YE++K
Sbjct: 467 PTLAKVCPAVAISYLCYENLK 487

 Score = 32.3 bits (72), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 47/252 (18%), Positives = 94/252 (37%), Gaps = 54/252 (21%)

Query: 101 SSYSFYNNLFGE-------TSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDV 153
           ++YS+Y +           T+D        + G  AG+ S   + P D ++   IA  D+
Sbjct: 150 TAYSYYASEDLSSEGDMTLTNDFVRGFGFFLAGGFAGVVSRTCTAPFDRIKVFLIARTDL 209

Query: 154 A----------------------LSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASI 191
           +                       S L      ++   G+  F+ G   ++  +   +++
Sbjct: 210 SSPLLHTPEQLLHHNPRADPAKIRSPLVKAATSLYRQGGLRAFYLGNGLNVIKVFPESAM 269

Query: 192 LFGTYESIKIY------CDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVR 245
            FG++E  K        C E  + S  + Y+   A  + G+ ++   YP+DT++ RIQ  
Sbjct: 270 KFGSFELAKRVLAGLEGCGETGELSRLSTYV---AGGLGGIMAQFSVYPIDTLKFRIQ-- 324

Query: 246 NSVYVQHNVENKIVTEIYQSYKGAS-FIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVV 304
                           +    +G    I+   ++ R+ GL   Y+G+ + +    P   +
Sbjct: 325 -------------CAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLGVGILGVFPYAAL 371

Query: 305 SLWAYETVMRLY 316
            L  +  + R Y
Sbjct: 372 DLGTFSALKRWY 383

>Kwal_33.14050
          Length = 314

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/308 (22%), Positives = 132/308 (42%), Gaps = 39/308 (12%)

Query: 19  DVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQA------PSGLLKMMKGMI 72
           +  ++  L AG+ +G++  +++ P+D +K R+Q   +  G A      PS +++ +  + 
Sbjct: 13  NAPLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARIS 72

Query: 73  LNEGGLRSFWKGNVPGTMMYVLYGGAQ-----FSSYSFYNNLFGETSDMNGQ--LQSLVV 125
             EG + + WKG     +  V+ G        F++Y    +   +  D      L++   
Sbjct: 73  TTEGSM-ALWKG-----VQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTAAS 126

Query: 126 GALAGMTSSFVSYPTDVLRTRF---IANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASM 182
           G  A + +  +  P D ++ R      ++D   S  S     I+  EG+  FF     ++
Sbjct: 127 GIAATVAADLLMNPFDTIKQRMQLRTFSKDRMWSVAS----RIYRNEGLAAFFYSYPTTI 182

Query: 183 FTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRI 242
                 A+  F  YES   +   ++ E+ Y   +      ISG T   +T PLD I+  +
Sbjct: 183 AMNIPFAAFNFAIYESATKF---FNPENTYNPLIHCLCGGISGATCAAITTPLDCIKTVL 239

Query: 243 QVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPST 302
           QVR S          +V  +++  +  +F R    I +  G    ++G+   +   +P+T
Sbjct: 240 QVRGS--------ESVVDPLFR--QADTFSRAASAISKVYGWSGFWRGLKPRIISNMPAT 289

Query: 303 VVSLWAYE 310
            +S  AYE
Sbjct: 290 AISWTAYE 297

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 87/218 (39%), Gaps = 35/218 (16%)

Query: 112 ETSDMNGQL-QSLVVGALAGMTSSFVSYPTDVLRTRF--------IANQDVAL-SSLSHG 161
           E+   N  L   L  GA AG+    + +P D ++TR          AN    L S++   
Sbjct: 8   ESLPTNAPLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQ 67

Query: 162 CKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNY--LRYS 219
              I   EG    ++G  + +     + ++ F TYE  K Y  +     D+  +  L+ +
Sbjct: 68  IARISTTEGSMALWKGVQSVILGAGPAHAVYFATYEMCKSYLID---PQDFQTHQPLKTA 124

Query: 220 ASSISG-VTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNI 278
           AS I+  V + ++  P DTI++R+Q+R                   ++       +   I
Sbjct: 125 ASGIAATVAADLLMNPFDTIKQRMQLR-------------------TFSKDRMWSVASRI 165

Query: 279 LRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
            R EGL + +     ++   +P    +   YE+  + +
Sbjct: 166 YRNEGLAAFFYSYPTTIAMNIPFAAFNFAIYESATKFF 203

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/323 (23%), Positives = 138/323 (42%), Gaps = 41/323 (12%)

Query: 4   IDDGQHNTDHLRKGEDV-KVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPS 62
           IDD +   DH   G+D  +V + L+AG+  G+    +  P DT K+RLQ     T + P+
Sbjct: 11  IDDLE---DH--PGQDNGRVVKDLLAGTAGGIAQVLIGQPFDTTKVRLQ-----TSKVPT 60

Query: 63  GLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGA----QFSSYSFYNNLF-GETSDMN 117
              +++K ++ NEG  + F+KG    T+  ++  GA    QF         F     D N
Sbjct: 61  SAAEVVKNLLKNEGP-KGFYKG----TLTPLVGVGACVSIQFGVNEAMKRFFHARNVDHN 115

Query: 118 GQL---QSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKE-IWNMEGIPG 173
             L   Q  + G   GMT+SF++ P + +R R          +   G  + I  +    G
Sbjct: 116 ATLSLSQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQKG 175

Query: 174 FFRGCTASMFTITLSASILFGTYES-IKIYCDEYSKESDYTNYLRYSASSISGVTSKMVT 232
             RG   +M          F  YE+ +    ++  K ++   +      ++SG    ++ 
Sbjct: 176 LMRGLIPTMLREGHGCGTYFLVYEALVSKQINQGLKRTEIPPWKLCLYGALSGTALWLMV 235

Query: 233 YPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVS 292
           YP+D ++  +Q  N               + +   G + I++  N+  +EGL + ++G  
Sbjct: 236 YPIDVVKSVMQTDN---------------LNKPQNGKNMIQVARNLYAREGLKAFFKGFG 280

Query: 293 MSLCKTVPSTVVSLWAYETVMRL 315
            ++ +  P+   +   +E  MRL
Sbjct: 281 PTMLRAAPANGGTFATFELAMRL 303

 Score = 29.3 bits (64), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 39/83 (46%), Gaps = 1/83 (1%)

Query: 29  GSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPG 88
           G++SG     ++ P+D +K  +Q       Q    ++++ + +   EG L++F+KG  P 
Sbjct: 224 GALSGTALWLMVYPIDVVKSVMQTDNLNKPQNGKNMIQVARNLYAREG-LKAFFKGFGPT 282

Query: 89  TMMYVLYGGAQFSSYSFYNNLFG 111
            +      G  F+++     L G
Sbjct: 283 MLRAAPANGGTFATFELAMRLLG 305

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 82/326 (25%), Positives = 143/326 (43%), Gaps = 43/326 (13%)

Query: 11  TDHLRKGEDVKVSQ--SLVAGSVSGLLARTVIAPLDTLKIRLQLRP--SYTGQAPSGLLK 66
           T    K    KVS+  S +AG ++  +A TV  P + +K R+QL+   S T Q       
Sbjct: 10  TKEHEKSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPF 69

Query: 67  MMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSY----SFYNNLFGETSDMNGQLQS 122
              G+I    G++   +G V   +  +   G++   Y    +  N  F   SD + +LQ+
Sbjct: 70  QALGVIFKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPH-KLQN 128

Query: 123 LVV----GALAGMTSSFVSYPTDVLRTRFIA-------NQDVALSSLSHGCKEIWNMEGI 171
           + V    GA +G+  + V  P  +++TR  +        +    +S+S+G   I+  EG+
Sbjct: 129 VAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGV 188

Query: 172 PGFFRGCTASMFTITLSASILFGTYESIKIYC--DEYSKESDYTNYLRYSASSISGVTSK 229
            G FRG  A++      +S+    Y + K +   ++  KE    + L   +S+++G+   
Sbjct: 189 LGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQNDIMKEGTALHLL---SSTVTGLGVG 245

Query: 230 MVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQ 289
           +V  P D +  R      VY Q             +YKG   I      ++ EG+ +LY+
Sbjct: 246 IVMNPWDVVLTR------VYNQKG----------NTYKGP--IDCMFKTIKIEGIGALYK 287

Query: 290 GVSMSLCKTVPSTVVSLWAYETVMRL 315
           G    L +  P T++ L   E  M+L
Sbjct: 288 GFGAQLFRIAPHTILCLTFMEQTMKL 313

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 77.0 bits (188), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/301 (22%), Positives = 135/301 (44%), Gaps = 36/301 (11%)

Query: 29  GSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPG 88
           GSV+G +  T++ P+D +K R+Q + S + Q  + +   +K  IL+  G+R  + G  P 
Sbjct: 550 GSVAGCIGATIVYPIDFVKTRMQAQRSLS-QYKNSIDCFLK--ILSREGIRGVYSGLGPQ 606

Query: 89  TMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTR-- 146
            +        + +   +  N   + +   G L  ++ GA AG      + P ++++ R  
Sbjct: 607 LIGVAPEKAIKLTVNDYMRNKLKDKNGKLGLLSEIISGASAGACQVIFTNPLEIVKIRLQ 666

Query: 147 ----FIAN--QDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIK 200
               ++A   ++  L++L     +I    G+PG ++G  A +      ++I F TY  +K
Sbjct: 667 VKGEYVAENAENAKLTAL-----QIIKRLGLPGLYKGAAACLLRDVPFSAIYFPTYAHLK 721

Query: 201 -----IYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVE 255
                   ++ +K S    +   SA +++G+ +  +T P D I+ R+Q          ++
Sbjct: 722 RDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQ----------ID 771

Query: 256 NKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
            K    IY+       I     ILR+E   S ++G +  + ++ P    +L AYE    +
Sbjct: 772 PKKGETIYK-----GIIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYELFHNI 826

Query: 316 Y 316
           +
Sbjct: 827 F 827

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 84/185 (45%), Gaps = 17/185 (9%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKG 84
            +++G+ +G        PL+ +KIRLQ++  Y  +      K+    I+   GL   +KG
Sbjct: 640 EIISGASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENA-KLTALQIIKRLGLPGLYKG 698

Query: 85  NVPGTMMYVLYGGAQFSSYS-FYNNLFG-ETSDMNGQ-----LQSLVVGALAGMTSSFVS 137
                +  V +    F +Y+    +LF  + +D N +      + L  GALAGM +++++
Sbjct: 699 AAACLLRDVPFSAIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLT 758

Query: 138 YPTDVLRTRFIANQ---DVALSSLSHGCKEIWNMEGIPGFFRGCTASM------FTITLS 188
            P DV++TR   +    +     + H  + I   E    FF+G  A +      F  TL+
Sbjct: 759 TPFDVIKTRLQIDPKKGETIYKGIIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLA 818

Query: 189 ASILF 193
           A  LF
Sbjct: 819 AYELF 823

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 92/202 (45%), Gaps = 30/202 (14%)

Query: 120 LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGC-KEIWNMEGIPGFFRGC 178
           L +  +G++AG   + + YP D ++TR  A + ++    S  C  +I + EGI G + G 
Sbjct: 544 LYNFSLGSVAGCIGATIVYPIDFVKTRMQAQRSLSQYKNSIDCFLKILSREGIRGVYSGL 603

Query: 179 TASMFTITLSASILFGTYESIKIYCDEY--SKESDYTNYLRYSASSISGVTSK----MVT 232
              +  +           ++IK+  ++Y  +K  D    L   +  ISG ++     + T
Sbjct: 604 GPQLIGV--------APEKAIKLTVNDYMRNKLKDKNGKLGLLSEIISGASAGACQVIFT 655

Query: 233 YPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVS 292
            PL+ ++ R+QV+   YV  N EN  +T               L I+++ GL  LY+G +
Sbjct: 656 NPLEIVKIRLQVKGE-YVAENAENAKLT--------------ALQIIKRLGLPGLYKGAA 700

Query: 293 MSLCKTVPSTVVSLWAYETVMR 314
             L + VP + +    Y  + R
Sbjct: 701 ACLLRDVPFSAIYFPTYAHLKR 722

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 45/92 (48%), Gaps = 1/92 (1%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGN 85
           L AG+++G+ A  +  P D +K RLQ+ P        G++   +  IL E   +SF+KG 
Sbjct: 744 LSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGETIYKGIIHAAR-TILREESFKSFFKGG 802

Query: 86  VPGTMMYVLYGGAQFSSYSFYNNLFGETSDMN 117
               +      G   ++Y  ++N+F   +D +
Sbjct: 803 AARVLRSSPQFGFTLAAYELFHNIFPLPNDKD 834

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 45/109 (41%), Gaps = 26/109 (23%)

Query: 207 SKESDYTNYLRY---------SASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENK 257
            +ES YTNY  Y         S  S++G     + YP+D ++ R+Q + S+         
Sbjct: 527 EEESLYTNYYFYPIFDSLYNFSLGSVAGCIGATIVYPIDFVKTRMQAQRSL--------- 577

Query: 258 IVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSL 306
                   YK +  I   L IL +EG+  +Y G+   L    P   + L
Sbjct: 578 ------SQYKNS--IDCFLKILSREGIRGVYSGLGPQLIGVAPEKAIKL 618

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/330 (22%), Positives = 133/330 (40%), Gaps = 34/330 (10%)

Query: 5   DDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQ------------- 51
           D G    D+    +   +S  L+AG+ +G++  +++ P+D LK R+Q             
Sbjct: 3   DPGIQEIDYEALPDTAPLSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASA 62

Query: 52  ---LRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNN 108
                 +  G     LL+ +  +   EG L + W+G     M         F++Y F   
Sbjct: 63  SGGAGAASGGAGAGTLLQQISRISSTEGSL-ALWRGVQSMVMGAGPAHAVYFATYEFCKE 121

Query: 109 LFGETSDMNGQ--LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIW 166
              +  D N    L++ V G  A + +  +  P D ++ R       + SS+      I+
Sbjct: 122 QLIDAKDFNTHQPLKTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFNIY 181

Query: 167 NMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGV 226
             EG   FF     ++      A++ F  YES   +   ++  + Y  ++      I+G 
Sbjct: 182 KNEGPMAFFYSYPTTLAMNIPFAALNFVIYESSTKF---FNPTNAYNPWIHCLCGGIAGA 238

Query: 227 TSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGA-SFIRMGLNILRQEGLL 285
           T   VT PLD I+  +Q+R S  V             +S+K A +F +    I +  G  
Sbjct: 239 TCAAVTTPLDCIKTVLQIRGSDTVH-----------VESFKTANTFKKAAQAIWQSYGWK 287

Query: 286 SLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
             ++G+   +   +P+T +S  +YE    L
Sbjct: 288 GFWRGLQPRVISNIPATAISWTSYEFAKHL 317

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/217 (20%), Positives = 86/217 (39%), Gaps = 45/217 (20%)

Query: 123 LVVGALAGMTSSFVSYPTDVLRTRFIANQDV-------------------ALSSLSHGCK 163
           L+ GA AG+    + +P D L+TR  A  ++                      +L     
Sbjct: 24  LIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQIS 83

Query: 164 EIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSI 223
            I + EG    +RG  + +     + ++ F TYE    +C E   ++   N  +   +++
Sbjct: 84  RISSTEGSLALWRGVQSMVMGAGPAHAVYFATYE----FCKEQLIDAKDFNTHQPLKTAV 139

Query: 224 SGVTSKMVT----YPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNIL 279
           SGV + +       P DTI++R+Q+++                      +S  RM  NI 
Sbjct: 140 SGVAATVAADALMNPFDTIKQRLQLQSKS------------------SDSSMWRMAFNIY 181

Query: 280 RQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
           + EG ++ +     +L   +P   ++   YE+  + +
Sbjct: 182 KNEGPMAFFYSYPTTLAMNIPFAALNFVIYESSTKFF 218

>Kwal_27.12599
          Length = 304

 Score = 74.7 bits (182), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/325 (23%), Positives = 139/325 (42%), Gaps = 43/325 (13%)

Query: 1   MTNIDDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQA 60
           + +ID   H++         +V + L+AG+  G+    V  P DT K+RLQ     T   
Sbjct: 11  IDDIDQQPHDSG--------RVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQ-----TSTT 57

Query: 61  PSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF-GETSDMNGQ 119
           P+  ++++K ++ NE GLR F+KG +   +        QF         F G ++D +  
Sbjct: 58  PTTAVEVVKKLVKNE-GLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKT 116

Query: 120 L---QSLVVGALAGMTSSFVSYPTDVLRTRF---IANQDVALSSLSHGCKEIWNMEGIPG 173
           L   Q  + G + G+ +SF++ P + +R R     A+  VA       C       G   
Sbjct: 117 LTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANG--A 174

Query: 174 FFRGCTASMFTITLSASILFGTYESIKIYCDEYSK---ESDYTNYLRYSASSISGVTSKM 230
             RG + ++       +  F TYE+  +  ++  K    SD   +      ++SGVT  +
Sbjct: 175 LMRGLSPTILREAQGCATYFLTYEA--LVANQIGKGIARSDVPAWKLCLFGAVSGVTLWL 232

Query: 231 VTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQG 290
             YPLD I+  +Q         N++N +        +G + I++   +  + G  S ++G
Sbjct: 233 TVYPLDVIKSLMQT-------DNLKNPV--------RGKNIIQVARLVNAKYGWKSFFKG 277

Query: 291 VSMSLCKTVPSTVVSLWAYETVMRL 315
              ++ +  P+   +   +E  MR 
Sbjct: 278 FGPTMLRAAPANGATFATFELAMRF 302

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 62/149 (41%), Gaps = 4/149 (2%)

Query: 101 SSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSH 160
           SS    +++  +  D    L+ L+ G   GM    V  P D  + R         ++   
Sbjct: 6   SSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRL--QTSTTPTTAVE 63

Query: 161 GCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLR--Y 218
             K++   EG+ GF++G    +  +    S  FG  E++K +    S +   T  L   Y
Sbjct: 64  VVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYY 123

Query: 219 SASSISGVTSKMVTYPLDTIRRRIQVRNS 247
               + GV +  +  P++ +R R+Q + +
Sbjct: 124 ICGFVGGVANSFLASPIEHVRIRLQTQTA 152

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 74.3 bits (181), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 72/305 (23%), Positives = 125/305 (40%), Gaps = 35/305 (11%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTG---QAPSGLLKMMKGMILNEGGLRSF 81
           +L+AG  +GL+      PLDT+K+R+Q+  +  G   +AP G +K    +  NEG L +F
Sbjct: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAP-GFIKTGGEIYRNEGFL-AF 70

Query: 82  WKGNVPGTMMYVLYGGAQFSSYSFYNNLF-----GETSDMNGQLQSLVVGALAGMTSSFV 136
           +KG     +        +FSSY FY  L      G+ S  N    + + G  AG+T + V
Sbjct: 71  YKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGN----TFIAGVGAGITEAVV 126

Query: 137 SYPTDVLRTRFIANQDV-------ALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSA 189
                 +    +  Q +          +    C  I   EG    +RG + +      + 
Sbjct: 127 VVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186

Query: 190 SILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVY 249
              F  Y  +K +   Y  +    ++       ISG        PLDTI+ R+Q   S  
Sbjct: 187 GANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTK 246

Query: 250 VQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAY 309
               ++   +              +G  ++++EG  +LY+G++  + +  P   V+  AY
Sbjct: 247 NMSGLKRITI--------------IGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAY 292

Query: 310 ETVMR 314
           E + +
Sbjct: 293 EFIRK 297

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 45/105 (42%), Gaps = 15/105 (14%)

Query: 207 SKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQV-RNSVYVQHNVENKIVTEIYQS 265
           SK+      +   A   +G+   +  +PLDTI+ R+Q+ +N+V                 
Sbjct: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAV--------------GSG 48

Query: 266 YKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
            K   FI+ G  I R EG L+ Y+G+   +    P   +   +YE
Sbjct: 49  VKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYE 93

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 45/100 (45%), Gaps = 6/100 (6%)

Query: 6   DGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLL 65
            G HN + L   E      SL+ G +SG +     APLDT+K RLQ   S    +    +
Sbjct: 201 QGYHNQEMLPSWET-----SLI-GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRI 254

Query: 66  KMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSF 105
            ++   ++ E G R+ +KG  P  M         F++Y F
Sbjct: 255 TIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEF 294

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 74.7 bits (182), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 82/343 (23%), Positives = 134/343 (39%), Gaps = 69/343 (20%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQL-RPSYTGQAPS--GLLKMMKGM-ILNEGGLR 79
           +S +AG V+G  A+T+IAPLD +KI  Q   P Y   A S  GLL    G+ I +   LR
Sbjct: 55  KSGLAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLN--AGVHIWSRDRLR 112

Query: 80  SFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYP 139
             ++G+    +    Y   +F +Y    N+   + +     + L  G+LAG+ S F +YP
Sbjct: 113 GVFQGHSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYETHFRRLCSGSLAGLCSVFCTYP 172

Query: 140 TDVLRTR-------------------FIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTA 180
            D++R R                   +      ALSS ++  K  W  +    F+RG   
Sbjct: 173 LDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPK--WFAQWC-NFYRGYIP 229

Query: 181 SMFTITLSASILFGTYE---------------------------SIKIYCDEYSKESDYT 213
           ++  +   A + F  ++                            + +      K     
Sbjct: 230 TVIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKVDVQTTRTGKRIPLN 289

Query: 214 NYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIR 273
            +    A  ++G+ S+   YP + IRRR+QV     V + +E+K            S   
Sbjct: 290 TWAELLAGGLAGMASQTAAYPFEIIRRRLQVGA---VTNPLEHKFT----------SMSE 336

Query: 274 MGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
           M   I  + G    + G+S+   K  P    S + YE  M+ Y
Sbjct: 337 MAKIIFHERGWRGFFVGLSIGYIKVTPMVACSFFVYER-MKWY 378

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 87/201 (43%), Gaps = 18/201 (8%)

Query: 120 LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDV------ALSSLSHGCKEIWNMEGIPG 173
           L+S + G +AG  +  +  P D ++  F  +         +   L +    IW+ + + G
Sbjct: 54  LKSGLAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRG 113

Query: 174 FFRGCTASMFTITLSASILFGTYESIK---IYCDEYSKESDYTNYLRYSASSISGVTSKM 230
            F+G +A++  I   A++ F  YE I+   I   EY      T++ R  + S++G+ S  
Sbjct: 114 VFQGHSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYE-----THFRRLCSGSLAGLCSVF 168

Query: 231 VTYPLDTIRRRIQVRNSVYVQHNVEN-KIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQ 289
            TYPLD IR R+     V   H V    +V +IY      +               + Y+
Sbjct: 169 CTYPLDLIRVRLAY---VTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYR 225

Query: 290 GVSMSLCKTVPSTVVSLWAYE 310
           G   ++   +P   VS +A++
Sbjct: 226 GYIPTVIGMIPYAGVSFFAHD 246

 Score = 31.6 bits (70), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query: 3   NIDDGQHNTDHLRKGEDVKVS--QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQA 60
           + DD + +    R G+ + ++    L+AG ++G+ ++T   P + ++ RLQ+  + T   
Sbjct: 269 DADDLKVDVQTTRTGKRIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQVG-AVTNPL 327

Query: 61  PSGLLKM--MKGMILNEGGLRSFWKG 84
                 M  M  +I +E G R F+ G
Sbjct: 328 EHKFTSMSEMAKIIFHERGWRGFFVG 353

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 73.9 bits (180), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 123/286 (43%), Gaps = 22/286 (7%)

Query: 29  GSVSGLLARTVIAPLDTLKIRLQ-----LRPSYTGQAPSGLLKMMKGMILNEGGLRSFWK 83
           G VS  +A+T  +P++ +K+ +Q     L+     +  +G+L   K     EG + SFW+
Sbjct: 30  GGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEG-VISFWR 88

Query: 84  GNVPGTMMYVLYGGAQFSSYSFYNNLFG---ETSDMNGQLQSLVVGALAGMTSSFVSYPT 140
           GN    + Y       F+       +FG   E         +L  G  AG  S    Y  
Sbjct: 89  GNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGALSLLFVYSL 148

Query: 141 DVLRTRFIANQDVA-------LSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILF 193
           D  RTR  A+   +        + L    K+    +G+ G +RG   S+  I +   + F
Sbjct: 149 DYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVVYRGLYF 208

Query: 194 GTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHN 253
           G Y+S+K      S E  +           +G ++   +YPLDT+RRR+ + +   V+++
Sbjct: 209 GMYDSLKPLLLTGSLEGSFLASFLLGWVVTTGAST--CSYPLDTVRRRMMMTSGQAVKYD 266

Query: 254 VENKIVTEIYQSYK-GASFIRMGLNILR---QEGLLSLYQGVSMSL 295
                + +I  +   G+ F   G NILR     G++S+Y  + M L
Sbjct: 267 GAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGVISMYDQLQMIL 312

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 73.6 bits (179), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 75/323 (23%), Positives = 133/323 (41%), Gaps = 53/323 (16%)

Query: 17  GEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEG 76
            E  K S  L+ G V GL +  V+ P D LK RLQ     T     G LK ++       
Sbjct: 2   AERPKTSSHLIGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLW---GTLKEIRSP----- 53

Query: 77  GLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF--GETSDMNG------QL---QSLVV 125
             +  W+G +P ++   +      S+ + +      G+T  +N       QL   ++L  
Sbjct: 54  --KQLWRGALPSSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLAS 111

Query: 126 GALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTI 185
           GA       F++ P  +++ R+ +    +  SL    + I++ EGI GFF GC A++   
Sbjct: 112 GAFTRGVVGFITMPITIIKVRYESTM-YSYKSLGEATRHIYSTEGIRGFFNGCGATVMRD 170

Query: 186 TLSASILFGTYESIKIYCD--------EYSKESDYTNYLRYSASSISGVTSK----MVTY 233
              A +    YE  K+            Y +   +T Y     +SIS   S      +T 
Sbjct: 171 APYAGLYVLLYEKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTITS 230

Query: 234 PLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSM 293
           P DTI+ R+Q+  +                   K + F +  + I+ +E   +L+ G+++
Sbjct: 231 PFDTIKTRMQLDPT-------------------KFSGFYKTLVLIVSKEKFKNLFDGLTL 271

Query: 294 SLCKTVPSTVVSLWAYETVMRLY 316
            L +   S  ++   YE +++ +
Sbjct: 272 RLTRKAFSAGIAWGIYEELIKRF 294

>Kwal_23.4731
          Length = 314

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/320 (23%), Positives = 144/320 (45%), Gaps = 51/320 (15%)

Query: 22  VSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGG---- 77
           + + ++AG  +G L      PLD +K+RLQL  + T     G  +++K +I +       
Sbjct: 13  LQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHS--HGYKEVIKTIIRDSKADSNV 70

Query: 78  LRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNL---FGETSDMNGQLQS------------ 122
            R  ++G     +   +  G  F  Y F  ++   +G  + M    QS            
Sbjct: 71  FREAYRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYG-VAQMKTPTQSSFQKDKAMGPSL 129

Query: 123 -LVVGALAGMTSSFVSYPTDVLRTRFIANQDVA---LSSLSHGCKEIWNMEGIPGFFRGC 178
            L   AL+G+ ++ ++ P  V++TR ++    A     +   G ++++  EG  GF+RG 
Sbjct: 130 YLASAALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFWRGL 189

Query: 179 TASMFTITLSASILFGTYESIKIYCDEY------SKESDYTNYLRYSASSISGVTSKMVT 232
             S+F +   A I F  Y+S++    +Y      +++    N    + +S+S + S    
Sbjct: 190 VPSLFGVAQGA-IYFTIYDSLR---HQYFARRGITEDEKMGNLENIAITSVSKMLSVTAV 245

Query: 233 YPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVS 292
           YP   ++  +Q   +V            E   SY+  + ++   +I ++EGL  LY+G+S
Sbjct: 246 YPFQLLKSNLQSFAAV------------EKRDSYRFWNLVK---SIHQKEGLQGLYKGLS 290

Query: 293 MSLCKTVPSTVVSLWAYETV 312
            +L + +PST ++   YE +
Sbjct: 291 ANLLRAIPSTCITFCIYENL 310

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 90/201 (44%), Gaps = 22/201 (10%)

Query: 14  LRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGM-- 71
            +K + +  S  L + ++SGL    +  P+  +K R+    S + QA         G+  
Sbjct: 119 FQKDKAMGPSLYLASAALSGLGTAILTNPIWVIKTRIM---STSSQASERYKTTWDGIRK 175

Query: 72  ILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSY-SFYNNLF-------GETSDMN-GQLQS 122
           +    G   FW+G VP      L+G AQ + Y + Y++L        G T D   G L++
Sbjct: 176 VYAHEGFSGFWRGLVPS-----LFGVAQGAIYFTIYDSLRHQYFARRGITEDEKMGNLEN 230

Query: 123 LVVGALAGMTSSFVSYPTDVLRTR---FIANQDVALSSLSHGCKEIWNMEGIPGFFRGCT 179
           + + +++ M S    YP  +L++    F A +        +  K I   EG+ G ++G +
Sbjct: 231 IAITSVSKMLSVTAVYPFQLLKSNLQSFAAVEKRDSYRFWNLVKSIHQKEGLQGLYKGLS 290

Query: 180 ASMFTITLSASILFGTYESIK 200
           A++     S  I F  YE+++
Sbjct: 291 ANLLRAIPSTCITFCIYENLR 311

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/313 (23%), Positives = 144/313 (46%), Gaps = 47/313 (15%)

Query: 22  VSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGG---- 77
           + + +++G  +G +   V  PLD +K+RLQL  +     PS     ++ +I +  G    
Sbjct: 12  LQKEIISGLTAGTITTIVTHPLDLIKLRLQL--AAIDLKPSSYYNQVQRIIKDGSGTQQL 69

Query: 78  LRSFWKG---NVPG-TMMYVLYGGA---------QFSSYSFYNNLFGETSDMNGQLQSLV 124
           L+  ++G   N+ G  + + LY G            SS     N F     M   +  + 
Sbjct: 70  LKEAYRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVS 129

Query: 125 VGALAGMTSSFVSYPTDVLRTRFIANQDV-ALSSLSHGCKEIWNMEGIPGFFRGCTASMF 183
            GA +G+ ++ ++ P  V++TR ++ +     +S+ +    I+  EG+  F+RG   S+F
Sbjct: 130 AGA-SGLATALLTNPMWVIKTRIMSTKSSQGYTSILNAITRIYTEEGLKTFWRGLVPSLF 188

Query: 184 TITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVT--SKMVT----YPLDT 237
            +T  A + F  Y+++K+   +Y  + +     R +A    G+   SKM++    YPL  
Sbjct: 189 GVTQGA-LYFAIYDTLKL---KYLHDRNDIQERRLNAVETIGIISLSKMISVSSVYPLQL 244

Query: 238 IRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCK 297
           ++  +Q   +   +HN  +K+           S IR   +I    G+   Y+G+  +L +
Sbjct: 245 LKTNLQ---TFRTEHNENSKM----------NSLIR---SIWHTNGIAGFYKGLFANLVR 288

Query: 298 TVPSTVVSLWAYE 310
            +PST ++   YE
Sbjct: 289 AIPSTCITFGVYE 301

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 94/196 (47%), Gaps = 23/196 (11%)

Query: 19  DVKVSQS--LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEG 76
           D K++ S  LV+   SGL    +  P+  +K R+    + + Q  + +L  +   I  E 
Sbjct: 118 DRKMTSSMYLVSAGASGLATALLTNPMWVIKTRIM--STKSSQGYTSILNAIT-RIYTEE 174

Query: 77  GLRSFWKGNVP-------GTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALA 129
           GL++FW+G VP       G + + +Y   +       N++  +   +N  ++++ + +L+
Sbjct: 175 GLKTFWRGLVPSLFGVTQGALYFAIYDTLKLKYLHDRNDI--QERRLNA-VETIGIISLS 231

Query: 130 GMTSSFVSYPTDVLRT-----RFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFT 184
            M S    YP  +L+T     R   N++  ++SL    + IW+  GI GF++G  A++  
Sbjct: 232 KMISVSSVYPLQLLKTNLQTFRTEHNENSKMNSL---IRSIWHTNGIAGFYKGLFANLVR 288

Query: 185 ITLSASILFGTYESIK 200
              S  I FG YE  K
Sbjct: 289 AIPSTCITFGVYEHFK 304

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 72.4 bits (176), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/329 (22%), Positives = 148/329 (44%), Gaps = 52/329 (15%)

Query: 12  DHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGM 71
           DH       +V   L AGSV+ L    V+ PLD LK+RLQL  +   +A  G   ++K +
Sbjct: 3   DHQWTPLQKEVISGLSAGSVTTL----VVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEI 58

Query: 72  ILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDM--------------- 116
           I +           +   +   L+G A   ++  Y  L+G T ++               
Sbjct: 59  IRSSANSGRSVTNELYRGLSINLFGNA--IAWGVYFGLYGVTKELIYKSVAKPGETQLKG 116

Query: 117 ---NGQLQSLV---VGALAGMTSSFVSYPTDVLRTRFIANQ---DVALSSLSHGCKEIWN 167
              + ++ SL+    GA +G+ ++ ++ P  V++TR ++       A +S+ +G +++  
Sbjct: 117 VGNDHKMNSLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLR 176

Query: 168 MEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKES----DYTNYLRYSASSI 223
            +G  G ++G   ++F ++  A + F  Y+++K       +E+      TN      +S+
Sbjct: 177 TDGFQGLWKGLVPALFGVSQGA-LYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSL 235

Query: 224 SGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEG 283
             + S  + YP   ++  +Q   +        N+      Q ++    I++   I+  +G
Sbjct: 236 GKMVSVTLVYPFQLLKSNLQSFRA--------NE------QKFRLFPLIKL---IIANDG 278

Query: 284 LLSLYQGVSMSLCKTVPSTVVSLWAYETV 312
            + LY+G+S +L + +PST ++   YE +
Sbjct: 279 FVGLYKGLSANLVRAIPSTCITFCVYENL 307

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 80/187 (42%), Gaps = 19/187 (10%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGM--ILNEGGLRSFWK 83
           L AG+ SGL+   +  P+  +K R+    S +  A      M  G+  +L   G +  WK
Sbjct: 129 LSAGASSGLMTAILTNPIWVIKTRIM---STSKGAQGAYTSMYNGVQQLLRTDGFQGLWK 185

Query: 84  GNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNG------QLQSLVVGALAGMTSSFVS 137
           G VP  +  V  G   F+ Y             NG       L+++ + +L  M S  + 
Sbjct: 186 GLVPA-LFGVSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTLV 244

Query: 138 YPTDVLRTR---FIAN-QDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILF 193
           YP  +L++    F AN Q   L  L    K I   +G  G ++G +A++     S  I F
Sbjct: 245 YPFQLLKSNLQSFRANEQKFRLFPL---IKLIIANDGFVGLYKGLSANLVRAIPSTCITF 301

Query: 194 GTYESIK 200
             YE++K
Sbjct: 302 CVYENLK 308

>Kwal_26.7653
          Length = 325

 Score = 72.4 bits (176), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 74/318 (23%), Positives = 141/318 (44%), Gaps = 43/318 (13%)

Query: 18  EDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP---SGLLKMMKGMILN 74
           + V  + S +AG ++  +A TV  P++ +K R+QL+   +  A       ++ +K +  N
Sbjct: 20  QKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKN 79

Query: 75  EGGLRSFWKGNVPGTMMYVLYGGAQFSSY----SFYNNLFGETSDMNGQLQSLVV----G 126
           E G+R   KG     +  +   G++   Y    S  N  F    D + ++Q++ V    G
Sbjct: 80  E-GIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPH-KVQNVAVNVVSG 137

Query: 127 ALAGMTSSFVSYPTDVLRTRFIA-------NQDVALSSLSHGCKEIWNMEGIPGFFRGCT 179
           A +G+  + +  P  +++TR  +        Q    +S+ +G   I+  EG  G +RG  
Sbjct: 138 ATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVD 197

Query: 180 ASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIR 239
           A++      +S+    Y + K +  ++    + T  L   AS++SG    +V  P D I 
Sbjct: 198 AAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTG-LHLVASTVSGFGVGVVMNPWDVIL 256

Query: 240 RRIQVRNSVYVQHNVENKIVTEIYQSYKGA--SFIRMGLNILRQEGLLSLYQGVSMSLCK 297
            R+         +N +  +       YKG    F++     +R EG+ +LY+G    + +
Sbjct: 257 TRV---------YNQKGNL-------YKGPLDCFVKT----VRIEGIGALYKGFEAQIFR 296

Query: 298 TVPSTVVSLWAYETVMRL 315
             P T++ L   E  M++
Sbjct: 297 IAPHTILCLTFMEQTMKV 314

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 72.4 bits (176), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 78/330 (23%), Positives = 147/330 (44%), Gaps = 71/330 (21%)

Query: 27  VAGSVSGLLARTVIAPLDTLKIRLQL----------RP------SYTGQAPSGLLKMMKG 70
           ++G+++G LA  ++ PLD  K RLQ           RP      ++ G+  SG+   +  
Sbjct: 108 LSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTT 167

Query: 71  MILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYS----FYNNLFGETSDMNGQLQSLVVG 126
           ++ +E  +R  +KG VP  + Y       FS Y      Y   F  +  ++  + +L  G
Sbjct: 168 IVRDE-SIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLSHSMSALTAG 226

Query: 127 ALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSH------GCKEIWNMEGIPGFFRGCTA 180
           A+    S+ ++ P  V++TR +      +  ++H         +I+ +EGI  F+ G   
Sbjct: 227 AI----STTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSGLIP 282

Query: 181 SMFTITLSASILFGTYESIK--IYCDEYSKESDYT-NYLRYSASSISGVT---------- 227
           S+F + L  +I F  YE +K  ++C    + +  T N    S    +G T          
Sbjct: 283 SLFGL-LHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRLIVA 341

Query: 228 ---SKMV----TYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILR 280
              SKM+    TYP + +R R+Q+++      +++  I + I  +Y              
Sbjct: 342 SCGSKMIASTLTYPHEILRTRLQLKS------DMKPSIKSIIRTTYA------------- 382

Query: 281 QEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
           +EG+   Y G   ++ +TVP++ ++L ++E
Sbjct: 383 KEGIRGFYSGFLTNMFRTVPASAITLVSFE 412

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 71.2 bits (173), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 76/321 (23%), Positives = 136/321 (42%), Gaps = 39/321 (12%)

Query: 4   IDDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSG 63
           IDD +   D+ R      V + L+AG+  G+    V  P DT K+RLQ     T +  + 
Sbjct: 11  IDDLESPHDNTR------VIKDLLAGTAGGIAQVLVGQPFDTTKVRLQ-----TSETSTN 59

Query: 64  LLKMMKGMILNEGGLRSFWKGNVP-----GTMMYVLYGGAQFSSYSFYNNLFGETSDMNG 118
            +K++K +I NEG +  F+KG +      G  + + +G  + +   F++      S    
Sbjct: 60  AVKVIKDLIKNEGPM-GFYKGTLTPLVGVGACVSLQFGVNE-AMKRFFHTFDEAASQHLS 117

Query: 119 QLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHG---CKEIWNMEGIPGFF 175
            LQ  + G   G T+SF++ P + +R R         ++   G   C +   + G     
Sbjct: 118 LLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNG--QLM 175

Query: 176 RGCTASMFTITLSASILFGTYES-IKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYP 234
           RG T +M   +    + F TYE+ I        +  D   +      + SG     + YP
Sbjct: 176 RGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYP 235

Query: 235 LDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMS 294
           LD I+  +Q  N               +     G + + +G  I+ ++G+  L++G + +
Sbjct: 236 LDVIKSVMQTDN---------------LKTPKNGNNILTVGRTIIARQGVSGLFKGFAPT 280

Query: 295 LCKTVPSTVVSLWAYETVMRL 315
           + +  P+   +   +ET MRL
Sbjct: 281 MLRAAPANAATFATFETAMRL 301

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 71.6 bits (174), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 102/254 (40%), Gaps = 15/254 (5%)

Query: 18  EDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGG 77
           E   +    +AG V G++  + +  LDT+K R Q  P+        +L+  + M + EG 
Sbjct: 49  EHSPIWHCFLAGGVGGIIGDSAMHSLDTVKTRQQGAPNV--HKYKHMLQAYRTMFIEEGF 106

Query: 78  LRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVS 137
            R  + G     +         FS+Y F          +N     L  G L    SSFV 
Sbjct: 107 RRGLYGGYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLNDTFSHLTAGFLGDFFSSFVY 166

Query: 138 YPTDVLRTRFIA---------NQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLS 188
            P++VL+TR            N      SL +    I+  EG+   F G  A++      
Sbjct: 167 VPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLARDLPF 226

Query: 189 ASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVT----SKMVTYPLDTIRRRIQV 244
           +++ F  YE  + +      +  Y + L  S   ++G      + ++T PLD ++ R+Q 
Sbjct: 227 SALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILTTPLDVVKTRVQT 286

Query: 245 RNSVYVQHNVENKI 258
           +    +  + + KI
Sbjct: 287 QLPSQIDISTDTKI 300

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 70.9 bits (172), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 70/315 (22%), Positives = 131/315 (41%), Gaps = 36/315 (11%)

Query: 12  DHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGM 71
           D  +KG        ++ GS++G   + +  P DT+K+RLQ + S         +K     
Sbjct: 3   DSKKKGLIEGAILDIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWSCIKF---T 59

Query: 72  ILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGM 131
             NEG  R F++G     +   L     F SY+  +    + +++    Q L+ G +AG 
Sbjct: 60  YQNEGIARGFFQGIASPLVGACLENATLFVSYNQCSKFLEKHTNVFPLGQILISGGVAGS 119

Query: 132 TSSFVSYPTDVLRTRF-IANQDVALSSLSH-----GCKEIWNMEGIPGFFRGCTASMFTI 185
            +S V  P ++++ +  +AN  VA +   H       K I    G+ G ++G + +    
Sbjct: 120 CASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRE 179

Query: 186 TLSASILFGTYESIKIYC-DEYSKESDYTNYLRYSASSISGVTSKMV----TYPLDTIRR 240
           +      F TYE +K    D +S +    +  +     ISG ++ +      +P DT++ 
Sbjct: 180 SFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKS 239

Query: 241 RIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVP 300
            +Q       +H      V +I+  +                GL   Y+G+ ++L + VP
Sbjct: 240 VMQ------TEHISLTNAVKKIFGKF----------------GLKGFYRGLGITLFRAVP 277

Query: 301 STVVSLWAYETVMRL 315
           +     + +ET+  L
Sbjct: 278 ANAAVFYIFETLSAL 292

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 123/290 (42%), Gaps = 30/290 (10%)

Query: 29  GSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMI------LNEGGLRSFW 82
           G VS  +A+T  +P++ +K+ +Q +     Q    L    KG++        + G+ SFW
Sbjct: 18  GGVSAAVAKTAASPIERVKLLIQNQDEMIKQGS--LDHRYKGIVDCFQRTARQEGIISFW 75

Query: 83  KGNVPGTMMYVLYGGAQFSSYSFYNNLFG---ETSDMNGQLQSLVVGALAGMTSSFVSYP 139
           +GN    + Y       F+       +FG   E         +L  G +AG  S    Y 
Sbjct: 76  RGNTANVIRYFPTQALNFAFKDQIKAMFGFKKEEGYAKWFAGNLASGGIAGGLSLMFVYS 135

Query: 140 TDVLRTRFIANQDVALSSLSHGCKEIWNM----------EGIPGFFRGCTASMFTITLSA 189
            D  RTR  A+   A SS   G ++   +          +G+ G +RG   S+  I +  
Sbjct: 136 LDYARTRLAAD---AKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGFLPSVIGIVVYR 192

Query: 190 SILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVY 249
            + FG Y+S K      S E  +           +G ++   +YPLDT+RRR+ + +   
Sbjct: 193 GLYFGLYDSCKPLLLTGSLEGSFIASFLLGWVVTTGAST--ASYPLDTVRRRMMMTSGQA 250

Query: 250 VQHNVENKIVTEIYQSYKGASFIR-MGLNILR---QEGLLSLYQGVSMSL 295
           V++      + +I  +   +S  +  G NILR     G++SLY  + M L
Sbjct: 251 VKYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGAGVISLYDQLQMIL 300

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 79/174 (45%), Gaps = 7/174 (4%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRL--QLRPSYTG--QAPSGLLKMMKGMILNEGGLRS 80
           +L +G ++G L+   +  LD  + RL    + S  G  +  +GL+ + K  I ++G +  
Sbjct: 118 NLASGGIAGGLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDG-VAG 176

Query: 81  FWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPT 140
            ++G +P  +  V+Y G  F  Y     L    S     + S ++G +    +S  SYP 
Sbjct: 177 LYRGFLPSVIGIVVYRGLYFGLYDSCKPLLLTGSLEGSFIASFLLGWVVTTGASTASYPL 236

Query: 141 DVLRTRFI--ANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASIL 192
           D +R R +  + Q V         ++I   EG+   F+GC A++      A ++
Sbjct: 237 DTVRRRMMMTSGQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGAGVI 290

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/299 (24%), Positives = 138/299 (46%), Gaps = 35/299 (11%)

Query: 21  KVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGL-R 79
           +V   L AGSV+ L    ++ PLD  K+RLQL    T     G   +   ++ ++  L R
Sbjct: 11  EVISGLTAGSVTTL----IVHPLDLFKVRLQLL--ITSTTKKGYRNLWSEIVGSDLSLTR 64

Query: 80  SFWKGNVPGTMMYVLYGGAQFSSYSF-------YNNLFGETSDMNGQLQSLVVGALAGMT 132
             ++G     +   +  G  F+SY         YN+      D++  +  L   A +GM 
Sbjct: 65  ELYRGLTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMY-LSASASSGML 123

Query: 133 SSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASIL 192
           ++ ++ P  V++TR ++  +  L+S+    +++   +G+ G ++G   ++  ++  A + 
Sbjct: 124 TTVLTNPLWVIKTRMMSKANSDLTSM-KVLRDLIKNDGVQGLWKGLVPALVGVSQGA-LH 181

Query: 193 FGTYESIKIYCDEYSKESD-YTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQ 251
           F  Y+++K      +++SD  TN    + +S+S + S    YP   ++  +Q   S    
Sbjct: 182 FTCYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQ---SFQAS 238

Query: 252 HNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
            N            +K     +M   I  + GLL  Y+G+S +L ++VPST ++   YE
Sbjct: 239 EN-----------DFKLLPLSKM---IYSRSGLLGFYKGLSANLLRSVPSTCITFCIYE 283

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 100/203 (49%), Gaps = 21/203 (10%)

Query: 10  NTDH-LRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGL--LK 66
           N +H +R  +D+     L A + SG+L   +  PL  +K R+        +A S L  +K
Sbjct: 97  NYNHRIRNDKDLSSWMYLSASASSGMLTTVLTNPLWVIKTRMM------SKANSDLTSMK 150

Query: 67  MMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNN---LFGETSDMNGQLQSL 123
           +++ +I N+G ++  WKG VP  ++ V  G   F+ Y    +   L    SD    L+++
Sbjct: 151 VLRDLIKNDG-VQGLWKGLVPA-LVGVSQGALHFTCYDTLKHKLVLKNRDSDEITNLETI 208

Query: 124 VVGALAGMTSSFVSYPTDVLRTRFIANQ----DVALSSLSHGCKEIWNMEGIPGFFRGCT 179
            V +++ M S+   YP  +L++   + Q    D  L  LS   K I++  G+ GF++G +
Sbjct: 209 AVTSVSKMLSTSAVYPFQLLKSNLQSFQASENDFKLLPLS---KMIYSRSGLLGFYKGLS 265

Query: 180 ASMFTITLSASILFGTYESIKIY 202
           A++     S  I F  YE+ K +
Sbjct: 266 ANLLRSVPSTCITFCIYENFKSF 288

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 121/288 (42%), Gaps = 23/288 (7%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP-----SGLLKMMKGMILNEGGLRS 80
            + G VS  +A+T  AP++ +K+ +Q +     Q        G+L   K    +EG + S
Sbjct: 17  FLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEG-IVS 75

Query: 81  FWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQ----SLVVGALAGMTSSFV 136
           FW+GN    + Y       F+      +L     + +G  +    +L  G  AG  S   
Sbjct: 76  FWRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFAGNLFSGGAAGGLSLLF 135

Query: 137 SYPTDVLRTRFIANQDVALSS-------LSHGCKEIWNMEGIPGFFRGCTASMFTITLSA 189
            Y  D  RTR  A+   + S+       L    K+    +G+ G +RG   S+  I +  
Sbjct: 136 VYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLGIIVYR 195

Query: 190 SILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVY 249
            + FG Y+S K      + E  +            G ++   +YPLDT+RRR+ + +   
Sbjct: 196 GLYFGLYDSFKPVLLTGALEGSFVASFLLGWVITMGAST--ASYPLDTVRRRMMMTSGQT 253

Query: 250 VQHNVENKIVTEIYQSYKGASFIR-MGLNILR---QEGLLSLYQGVSM 293
           ++++     + +I Q     S  +  G NI R     G++SLY  + +
Sbjct: 254 IKYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAGVISLYDQLQL 301

>Scas_714.18
          Length = 305

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/317 (21%), Positives = 139/317 (43%), Gaps = 51/317 (16%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWK 83
           + ++AGS++G + + +  P DT+K+RLQ + +Y    PS     +K    NEG L  F++
Sbjct: 14  REILAGSIAGAIGKFIEYPFDTVKVRLQTQEAY--MFPS-TWSCIKYTYENEGILEGFYQ 70

Query: 84  GNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVL 143
           G     +   L     F +Y+  ++     ++ +  L  L+    AG  +SFV  P +++
Sbjct: 71  GIESPLIGAALENAILFLAYNQCSSFLNAFTEFSAFLIILISAGFAGSCASFVLTPVELI 130

Query: 144 RTRF-IANQDVAL------------------------SSLSHGCKEIWNMEGIPGFFRGC 178
           + +  I+N   +L                        + +    K I   +G+ G ++G 
Sbjct: 131 KCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLWQGQ 190

Query: 179 TASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTI 238
           +++    ++ + + F TYE +K    +   E + T  L  S ++ +G+      +P DT+
Sbjct: 191 SSTFIRESIGSVVWFATYELMKQTLRDPKSEVNTTWQLLISGAT-AGLAFNGSVFPADTV 249

Query: 239 RRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKT 298
           +  +Q           E+  + E  +S            IL ++G+   Y+G+ ++L + 
Sbjct: 250 KSIMQ----------TEHLALMETVRS------------ILERDGVAGFYRGLGITLLRA 287

Query: 299 VPSTVVSLWAYETVMRL 315
           VPS     + YE + ++
Sbjct: 288 VPSNAAVFYTYEKLSKI 304

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 91/207 (43%), Gaps = 10/207 (4%)

Query: 112 ETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGI 171
           E       L+ ++ G++AG    F+ YP D ++ R    +     S     K  +  EGI
Sbjct: 5   EEGGFGAALREILAGSIAGAIGKFIEYPFDTVKVRLQTQEAYMFPSTWSCIKYTYENEGI 64

Query: 172 -PGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKM 230
             GF++G  + +    L  +ILF  Y     + + +++ S +   L   ++  +G  +  
Sbjct: 65  LEGFYQGIESPLIGAALENAILFLAYNQCSSFLNAFTEFSAFLIIL--ISAGFAGSCASF 122

Query: 231 VTYPLDTIRRRIQVRNSVYVQHN-------VENKIVTEIYQSYKGASFIRMGLNILRQEG 283
           V  P++ I+ ++Q+ N  Y  H+        E++    +    +    I    +I++++G
Sbjct: 123 VLTPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKG 182

Query: 284 LLSLYQGVSMSLCKTVPSTVVSLWAYE 310
           L  L+QG S +  +    +VV    YE
Sbjct: 183 LFGLWQGQSSTFIRESIGSVVWFATYE 209

>Scas_718.24
          Length = 337

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 124/290 (42%), Gaps = 24/290 (8%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMI------LNEGGLR 79
            + G VS  +A+T  +P++ +K+ +Q +     Q    L    KG++        + G+ 
Sbjct: 46  FLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGT--LDTKYKGIVDCFRRTAQQEGII 103

Query: 80  SFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFG-ETSDMNGQ--LQSLVVGALAGMTSSFV 136
           SFW+GN    + Y       F+       +FG +  D  G+    +L  G  AG  S   
Sbjct: 104 SFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEDGYGKWFAGNLASGGAAGGLSLLF 163

Query: 137 SYPTDVLRTRFIANQDVA-------LSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSA 189
            Y  D  RTR  A+   +        + L    K+    +G+ G +RG   S+  I +  
Sbjct: 164 VYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIIVYR 223

Query: 190 SILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVY 249
            + FG Y+SIK      S E  +           +G ++   +YPLDT+RR++ + +   
Sbjct: 224 GLYFGLYDSIKPVLLTGSLEGSFLASFLLGWVVTTGAST--CSYPLDTVRRKMMMTSGQA 281

Query: 250 VQHNVENKIVTEIYQSYKGASFIR-MGLNILR---QEGLLSLYQGVSMSL 295
           V++        +I  +   AS  +  G NILR     G++S+Y  + M L
Sbjct: 282 VKYKGAFDCFKKIVAAEGVASLFKGCGANILRGVAGAGVISMYDQLQMIL 331

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 70.5 bits (171), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 94/196 (47%), Gaps = 18/196 (9%)

Query: 14  LRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMIL 73
           + K   +K  Q +++G+ +G        PL+ +KIRLQ+R  Y G+     L  +   I+
Sbjct: 590 MNKSRTIKWYQEILSGATAGACQVVFTNPLEIVKIRLQMRSDYVGENARPQLGAVG--II 647

Query: 74  NEGGLRSFWKGNVPGTMMYVLYGGAQFSSYS-FYNNLFG-ETSDMNGQ-----LQSLVVG 126
            + GLR  +KG     +  V +    F +Y+    ++F  + +D N +      + L+ G
Sbjct: 648 RQLGLRGLYKGAAACLLRDVPFSAIYFPTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAG 707

Query: 127 ALAGMTSSFVSYPTDVLRTRFIANQ---DVALSSLSHGCKEIWNMEGIPGFFRGCTASM- 182
            +AGM +++++ P DV++TR   +    +   + + H  + I   E I  FF+G  A + 
Sbjct: 708 GIAGMPAAYLTTPFDVIKTRLQIDPRKGETTYTGVIHAARTILKEESIKSFFKGGPARVL 767

Query: 183 -----FTITLSASILF 193
                F  TL+A  +F
Sbjct: 768 RSSPQFGFTLAAFEMF 783

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 64/300 (21%), Positives = 123/300 (41%), Gaps = 25/300 (8%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWK 83
            +   GS++G +  TV+ P+D +K R+Q + + + Q  + +  ++K  I    G+R  + 
Sbjct: 506 HNFTLGSIAGCIGATVVYPIDLVKTRMQAQRN-SVQYKNSIDCVVK--IFQTKGIRGLYS 562

Query: 84  GNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVL 143
           G  P  +        + +   F    F   S      Q ++ GA AG      + P +++
Sbjct: 563 GLGPQLIGVAPEKAIKLTVNDFMRQYFMNKSRTIKWYQEILSGATAGACQVVFTNPLEIV 622

Query: 144 RTRFIANQDVALSSLSH--GCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIK- 200
           + R     D    +     G   I    G+ G ++G  A +      ++I F TY  +K 
Sbjct: 623 KIRLQMRSDYVGENARPQLGAVGIIRQLGLRGLYKGAAACLLRDVPFSAIYFPTYAHLKK 682

Query: 201 ----IYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVEN 256
                  ++ +K +    +    A  I+G+ +  +T P D I+ R+Q+            
Sbjct: 683 DVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQID---------PR 733

Query: 257 KIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
           K  T    +Y G   I     IL++E + S ++G    + ++ P    +L A+E    L+
Sbjct: 734 KGET----TYTGV--IHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFEMFQGLF 787

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 89/196 (45%), Gaps = 19/196 (9%)

Query: 120 LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGC-KEIWNMEGIPGFFRGC 178
           + +  +G++AG   + V YP D+++TR  A ++      S  C  +I+  +GI G + G 
Sbjct: 505 IHNFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLYSGL 564

Query: 179 TASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTI 238
              +  +    +I     + ++ Y    S+   +  Y    + + +G    + T PL+ +
Sbjct: 565 GPQLIGVAPEKAIKLTVNDFMRQYFMNKSRTIKW--YQEILSGATAGACQVVFTNPLEIV 622

Query: 239 RRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKT 298
           + R+Q+R S YV  N   ++         GA      + I+RQ GL  LY+G +  L + 
Sbjct: 623 KIRLQMR-SDYVGENARPQL---------GA------VGIIRQLGLRGLYKGAAACLLRD 666

Query: 299 VPSTVVSLWAYETVMR 314
           VP + +    Y  + +
Sbjct: 667 VPFSAIYFPTYAHLKK 682

>Kwal_47.18216
          Length = 333

 Score = 68.9 bits (167), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 71/327 (21%), Positives = 127/327 (38%), Gaps = 52/327 (15%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQL--RPSYTGQAPSGLLKMMKGMILNEGGLRSFW 82
           +LVAG  +GL       PLDT+K+R+Q+  R    GQ   G +   + +   EG L + +
Sbjct: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFL-ALY 71

Query: 83  KGNVPGTMMYVLYGGAQFSSYSFYNNLFGE-TSDMNGQLQSLVVGALAGMTSS-FVSYPT 140
           KG     +  +     +F+SY F+  L  +  + +     + V G  AG+T +  V  P 
Sbjct: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPM 131

Query: 141 DVLRTRFIAN-----------------------------QDVALSSLSHGCKE----IWN 167
           +V++ R  A                              ++VA +       +    I  
Sbjct: 132 EVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYVIVK 191

Query: 168 MEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVT 227
            EG    +RG + +      +    F  Y ++K    EY +     ++       ISG  
Sbjct: 192 EEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGAL 251

Query: 228 SKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSL 287
                 PLDTI+ R+Q   S                +    +  + +G  ++R+EG  +L
Sbjct: 252 GPFSNAPLDTIKTRLQKDKST--------------SKDSGWSRILAIGRQLIREEGFRAL 297

Query: 288 YQGVSMSLCKTVPSTVVSLWAYETVMR 314
           Y+G++  + +  P   V+   YE + +
Sbjct: 298 YKGITPRVMRVAPGQAVTFTVYELIRK 324

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 42/97 (43%), Gaps = 6/97 (6%)

Query: 9   HNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMM 68
           H TD L   E      SL+ G +SG L     APLDT+K RLQ   S +  +    +  +
Sbjct: 231 HQTDMLPSWET-----SLI-GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAI 284

Query: 69  KGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSF 105
              ++ E G R+ +KG  P  M         F+ Y  
Sbjct: 285 GRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYEL 321

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 67.8 bits (164), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 75/302 (24%), Positives = 133/302 (44%), Gaps = 35/302 (11%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP--SGLLKMMKGMILNEGGLRSFWK 83
            +AG+V+G+    V+ PLD +K  +QL+ S  G  P   G+   +K +   EG  R  +K
Sbjct: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVS-GGSGPQYKGVFDCLKQIAAKEGPSR-LYK 70

Query: 84  GNVPGTMMYVLYGGAQFSS----YSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYP 139
           G     +M       +F+        Y +LFG  ++   Q  S++ GA AG+  SFV  P
Sbjct: 71  GISSPILMEAPKRATKFACNDEFQKIYKDLFG--AEKLTQPLSILSGASAGICESFVVVP 128

Query: 140 TDVLRTRFIANQDVA--LSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYE 197
            ++++ R    QDV+   +S     K I   EGI   + G  ++M+   +  +  FG   
Sbjct: 129 FELVKIRL---QDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIF 185

Query: 198 SIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQ---VRNSVYVQHNV 254
            ++    + S +S+ T      A ++ G  S +++ P D ++ R+Q   V   V  ++N 
Sbjct: 186 QVRALLPKASTKSEQTRN-DLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNW 244

Query: 255 ENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMR 314
               +  IY                ++EG  +LY+G    + +  P   + L  +  VM 
Sbjct: 245 SWPALATIY----------------KEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMD 288

Query: 315 LY 316
            +
Sbjct: 289 FF 290

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 43/104 (41%), Gaps = 22/104 (21%)

Query: 217 RYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGL 276
           ++ A +++GV+  +V YPLD ++  +Q++ S                  YKG        
Sbjct: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVS------------GGSGPQYKGV------F 53

Query: 277 NILRQ----EGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
           + L+Q    EG   LY+G+S  +    P         +   ++Y
Sbjct: 54  DCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIY 97

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 110/254 (43%), Gaps = 23/254 (9%)

Query: 8   QHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQL-RPSYTGQAPSGLLK 66
           +H TD  R  E++K   +LVAG V G+ A     P D +K+R Q  +   T  A S +LK
Sbjct: 12  EHKTDAFR--ENMK---ALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILK 66

Query: 67  MMKGMILNEGGL----------RSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDM 116
             + +    G L          + F+KG +P  +         F  Y     L       
Sbjct: 67  EARSLSTVNGSLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTWKQAS 126

Query: 117 NGQL---QSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPG 173
           +  L   Q    G ++ + ++ V+ PT+ ++     N +    S     K I +  G+  
Sbjct: 127 DAPLTTAQMATAGFISAIPTTLVTAPTERIKVVLQTNSEFK-GSFIKAAKHIVSTGGVKS 185

Query: 174 FFRGCTASMFTITLSASILFGTYESIKIYCDE--YSKESDYTNYLRYS-ASSISGVTSKM 230
            F G  A++      +++ F +YE  K + ++    K+ D  N      A  I+G++  +
Sbjct: 186 LFNGSLATLARDGPGSALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWL 245

Query: 231 VTYPLDTIRRRIQV 244
           V +P+DTI+ R+QV
Sbjct: 246 VVFPIDTIKTRLQV 259

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 96/220 (43%), Gaps = 35/220 (15%)

Query: 107 NNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDV----ALSSLSHGC 162
           N L  +T      +++LV G + G+ +    +P D+++ R  +NQ      A+S +    
Sbjct: 9   NILEHKTDAFRENMKALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEA 68

Query: 163 KEIWNMEG-----------IPGFFRGCTASMFTITLSASILFGTYE-SIKIYCDEYSKES 210
           + +  + G           + GF++G    +  +T   ++ F  Y+   ++   + + ++
Sbjct: 69  RSLSTVNGSLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTWKQASDA 128

Query: 211 DYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGAS 270
             T     +A  IS + + +VT P + I+        V +Q N E          +KG S
Sbjct: 129 PLTTAQMATAGFISAIPTTLVTAPTERIK--------VVLQTNSE----------FKG-S 169

Query: 271 FIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
           FI+   +I+   G+ SL+ G   +L +  P + +   +YE
Sbjct: 170 FIKAAKHIVSTGGVKSLFNGSLATLARDGPGSALYFASYE 209

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 45/96 (46%), Gaps = 5/96 (5%)

Query: 15  RKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILN 74
           +  ++V ++   +AG ++G+    V+ P+DT+K RLQ+        P  +++  K + + 
Sbjct: 222 KDKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTRLQV-----ATTPISMVQATKDIYIQ 276

Query: 75  EGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF 110
            GG++ F+ G  P  +       A F      +  F
Sbjct: 277 RGGIKGFFPGLGPALLRSFPANAATFLGVELTHAFF 312

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 44/113 (38%), Gaps = 7/113 (6%)

Query: 205 EYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQ 264
           E+  ++   N     A  + GV + +  +P D I+ R Q       Q       V+ I +
Sbjct: 12  EHKTDAFRENMKALVAGGVGGVCAVLTGHPFDLIKVRCQSN-----QAKSTMDAVSIILK 66

Query: 265 SYKGASFIRMGL--NILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
             +  S +   L  ++  +  +   Y+GV   L    P   VS W Y+   RL
Sbjct: 67  EARSLSTVNGSLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRL 119

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/292 (21%), Positives = 112/292 (38%), Gaps = 29/292 (9%)

Query: 29  GSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPG 88
           G   G++A     PLD  K+RLQ  P     AP   L  M   IL   G+   + G    
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAP-----APKPTLVRMASQILRNEGVPGLYSGLTAA 69

Query: 89  TMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFI 148
            +    Y  A+F  Y F    +     +N  L  L     +G     +  P DV+  R  
Sbjct: 70  ILRQCTYTTARFGVYDFVKERYIPKEYLNSMLYLLPCSMFSGAVGGLIGNPADVVNIRMQ 129

Query: 149 ANQDVALS------SLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIY 202
            +  +         + + G  +I + EG+   F G   ++    L  S    TY+  K Y
Sbjct: 130 NDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVTYDIAKNY 189

Query: 203 CDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEI 262
             +            +++S ++G+ +  V  P D I+ R+   N+    H+         
Sbjct: 190 LVQNVGLDKDNKSTHFASSLLAGLVATTVCSPADVIKTRVM--NAHKHSHD--------- 238

Query: 263 YQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMR 314
                  S +R+ L+ ++QEG   +++G   S  +  P+T++     E + +
Sbjct: 239 -------SAVRILLDAVKQEGPSFMFRGWLPSFVRLGPNTILIFLTVEQLRK 283

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 37/92 (40%), Gaps = 19/92 (20%)

Query: 225 GVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGL 284
           G+ + + T+PLD  + R+Q   +                      + +RM   ILR EG+
Sbjct: 19  GIVACVATHPLDLAKVRLQTAPA-------------------PKPTLVRMASQILRNEGV 59

Query: 285 LSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
             LY G++ ++ +    T      Y+ V   Y
Sbjct: 60  PGLYSGLTAAILRQCTYTTARFGVYDFVKERY 91

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 67.4 bits (163), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 77/318 (24%), Positives = 138/318 (43%), Gaps = 59/318 (18%)

Query: 39  VIAPLDTLKIRLQ---LRPSYTGQA------------PSGLLKMMK-----GMILNEGGL 78
           V  P D +K RLQ    R  Y   A               LL   +     G +  + G 
Sbjct: 67  VTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGF 126

Query: 79  RSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQS---LVVGALAGMTSSF 135
           RS +KG  P  +  +      F +Y    +++  T + NGQ      L+  A AG  +S 
Sbjct: 127 RSLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLN-NGQEAPWIHLLAAATAGWATST 185

Query: 136 VSYPTDVLRTRF-IANQDVALSSLSHGC-KEIWNMEGIPGFFRGCTASMFTITLSASILF 193
           V+ P  +++TR  +          S  C K +   EG+ G ++G +AS +  ++   + +
Sbjct: 186 VTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSAS-YLGSVEGILQW 244

Query: 194 GTYESIK-------------IYCDEYSKESDYTNYLRYSASS-ISGVTSKMVTYPLDTIR 239
             YE +K             I+ D  S       + + S S+ ++   + +VTYP + +R
Sbjct: 245 ILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFVASIVTYPHEVVR 304

Query: 240 RRIQVRNSVYVQHNVENKIV--TEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCK 297
            R++       Q   EN  +  T + QS++          I+++EGL+S+Y G++  L +
Sbjct: 305 TRLR-------QAPTENGKLKYTGLVQSFR---------VIIKEEGLVSMYSGLTPHLLR 348

Query: 298 TVPSTVVSLWAYETVMRL 315
           TVP++++    +E V++L
Sbjct: 349 TVPNSIIMFGTWELVIKL 366

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 10/94 (10%)

Query: 231 VTYPLDTIRRRIQ--VRNSVYVQHNVENK------IVTEIYQSYKGASFIRMGLNILRQE 282
           VT P D ++ R+Q  V  + Y    ++N        V+     +K  +F  +G N+ RQE
Sbjct: 67  VTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFK-ETFGIIG-NVYRQE 124

Query: 283 GLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
           G  SL++G+  +L   +P+  ++   Y T   +Y
Sbjct: 125 GFRSLFKGLGPNLVGVIPARSINFLTYGTTKDIY 158

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 71/310 (22%), Positives = 134/310 (43%), Gaps = 49/310 (15%)

Query: 23  SQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILN---EGGL- 78
           ++SL AG+V G+ A     P D LK+R Q     + QA SG +  ++ +++    + GL 
Sbjct: 48  AKSLAAGAVGGVCAVLTGHPFDLLKVRCQ-----SNQA-SGTVDAVRKILVEARAQSGLS 101

Query: 79  -----RSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGET----SDMNGQL---QSLVVG 126
                R F+KG +P      L G     + SF+    G+     +D +G+L   Q    G
Sbjct: 102 AVNMMRGFYKGVIP-----PLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLTTAQLATAG 156

Query: 127 ALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTIT 186
            ++ + ++ V  PT+ ++   +  Q  +  SL    K I    G+   FRG  A++    
Sbjct: 157 FISAIPTTLVMAPTERVK---VVLQTQSNHSLGSAAKHILATGGVRSLFRGSLATLARDG 213

Query: 187 LSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRN 246
             +++ F +YE+ K Y +  S  ++ +      A  ++GV+  +  +P+DTI+  +Q  N
Sbjct: 214 PGSALYFASYEATKAYLNARSGTNELSIKNVCLAGGMAGVSMWVGVFPIDTIKTELQSSN 273

Query: 247 SVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSL 306
           +         K    IY +               + G+   + G+  +L ++ P+   + 
Sbjct: 274 TRQTMMEATRK----IYNT---------------RGGIKGFFPGIGPALLRSFPANAATF 314

Query: 307 WAYETVMRLY 316
              E    L+
Sbjct: 315 LGVELTHSLF 324

 Score = 35.4 bits (80), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 46/119 (38%), Gaps = 11/119 (9%)

Query: 197 ESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVEN 256
           E   ++       + Y N    +A ++ GV + +  +P D ++ R Q   +      V  
Sbjct: 30  EEPSVHVGTPKSNALYENAKSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGTVDAVRK 89

Query: 257 KIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
            +V    QS   A      +N++R       Y+GV   L    P   VS W Y+   +L
Sbjct: 90  ILVEARAQSGLSA------VNMMR-----GFYKGVIPPLLGVTPIFAVSFWGYDVGKKL 137

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 42/92 (45%), Gaps = 5/92 (5%)

Query: 19  DVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGL 78
           ++ +    +AG ++G+     + P+DT+K  LQ   S T Q    +++  + +    GG+
Sbjct: 238 ELSIKNVCLAGGMAGVSMWVGVFPIDTIKTELQ--SSNTRQT---MMEATRKIYNTRGGI 292

Query: 79  RSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF 110
           + F+ G  P  +       A F      ++LF
Sbjct: 293 KGFFPGIGPALLRSFPANAATFLGVELTHSLF 324

>Scas_718.5
          Length = 324

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 76/332 (22%), Positives = 139/332 (41%), Gaps = 44/332 (13%)

Query: 1   MTNIDDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQA 60
           M +  +  + + H    +  +V + ++AG+  G+    V  P DT K+R+Q     T   
Sbjct: 18  MASNGNDNNGSSHSMAKDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQ-----TSAK 72

Query: 61  PSGLLKMMKGMILNEGGLRSFWKGN-VP----GTMMYVLYGGAQFSSYSF--YNNLFGET 113
             G L +++ ++ NE G+ +F+KG+ +P    G  + V +G  +     F  +N   G T
Sbjct: 73  SVGALDIIRKLVKNE-GVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRG-T 130

Query: 114 SDMNGQL---QSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKE-IWNME 169
              +G L   Q  + G   G+ +SF++ P + +R R              G  + I  + 
Sbjct: 131 QHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLV 190

Query: 170 GIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRY---SASSISGV 226
                 RG    M          F TYE+  +  +E  K  D +    +   S  S+SGV
Sbjct: 191 KEKSLMRGLRPMMLRAGHGLGCYFLTYEA--LIANEIKKGKDRSEIASWKLCSYGSLSGV 248

Query: 227 TSKMVTYPLDTIRRRIQ---VRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEG 283
              +  YPLD ++  IQ   +RN  +   N    ++  +Y                R++G
Sbjct: 249 VLWLAIYPLDVVKSMIQTDTLRNPRF--KNSMKNVINHLY----------------REQG 290

Query: 284 LLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
           + + ++G + ++ +  P    +   +E VMRL
Sbjct: 291 ISAFFKGFAPTMLRAAPVNGATFVTFELVMRL 322

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 72/326 (22%), Positives = 133/326 (40%), Gaps = 45/326 (13%)

Query: 4   IDDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSG 63
           IDD + +  H    ++ +V + L+AG+  G+    V  P DT K+RLQ     T   P+ 
Sbjct: 11  IDDLEEHPQH----DNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQ-----TSSTPTT 61

Query: 64  LLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGA----QFSSYSFYNNLFGE-TSDMNG 118
            +++++ ++ NEG  R F+K    GT+  ++  GA    QF         F    +DM+ 
Sbjct: 62  AMEVVRKLLANEGP-RGFYK----GTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSS 116

Query: 119 QL---QSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKE-IWNMEGIPGF 174
            L   Q    G   G+ +SF++ P + +R R         ++   G  E I  +      
Sbjct: 117 TLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKAL 176

Query: 175 FRGCTASMFTITLSASILFGTYESIKIYCDEYSK-----ESDYTNYLRYSASSISGVTSK 229
            RG T ++          F  YE+  +  ++ +K       D   +      ++SG    
Sbjct: 177 LRGLTPTILREGHGCGTYFLVYEA--LIANQMNKRRGLERKDIPAWKLCIFGALSGTALW 234

Query: 230 MVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQ 289
           ++ YPLD I+  +Q  N               + +   G S   +   +    G+ + ++
Sbjct: 235 LMVYPLDVIKSVMQTDN---------------LQKPKFGNSISSVAKTLYANGGIGAFFK 279

Query: 290 GVSMSLCKTVPSTVVSLWAYETVMRL 315
           G   ++ +  P+   +   +E  MRL
Sbjct: 280 GFGPTMLRAAPANGATFATFELAMRL 305

 Score = 31.2 bits (69), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 46/98 (46%), Gaps = 9/98 (9%)

Query: 18  EDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQL----RPSYTGQAPSGLLKMMKGMIL 73
           +D+   +  + G++SG     ++ PLD +K  +Q     +P + G + S + K +     
Sbjct: 215 KDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKF-GNSISSVAKTLYA--- 270

Query: 74  NEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFG 111
             GG+ +F+KG  P  +      GA F+++     L G
Sbjct: 271 -NGGIGAFFKGFGPTMLRAAPANGATFATFELAMRLLG 307

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 66.6 bits (161), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 67/306 (21%), Positives = 133/306 (43%), Gaps = 40/306 (13%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEG---GLRS 80
            S +AGS++G +  ++  P +  K RLQL    +  + + L+     +I N G   G+ S
Sbjct: 92  HSFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLV-----LIYNTGKNYGISS 146

Query: 81  FWKGNVPGTMMYVLYGGAQFSSYSFYNNLF--GETSDMNGQLQSLVVGALAGMTSSFVSY 138
            + G     +      G +F  +    NL    +T +++G  + +V G  AG+  S V+ 
Sbjct: 147 IYVGCPAFIVGNTAKAGIRFLGFDTIKNLLRDKKTGELSG-FRGVVAGLGAGLLESVVAV 205

Query: 139 -PTDVLRTRFIANQDVALSSLSHGCK-------EIWNMEGIPGFFRGCTASMFTITLSAS 190
            P + ++T  I ++  A+    +  K       ++ + +G  G +RG          + +
Sbjct: 206 TPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQA 265

Query: 191 ILFGTYESIKIYCDEYS---KESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNS 247
           +  G Y  IK    +Y+   K+   ++ L +   + SG+ +   T P+DT++ R+Q  N 
Sbjct: 266 VRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQSLN- 324

Query: 248 VYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLW 307
                            + + +S I     I ++EGL + ++G +  L + + S  +   
Sbjct: 325 -----------------AGQYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGIVFT 367

Query: 308 AYETVM 313
            YE V+
Sbjct: 368 IYEKVL 373

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 4/84 (4%)

Query: 120 LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNME---GIPGFFR 176
             S + G++AG   + ++YP +  +TR +   D A  +  +    I+N     GI   + 
Sbjct: 91  FHSFLAGSIAGAIEASITYPFEFAKTR-LQLVDKASKASRNPLVLIYNTGKNYGISSIYV 149

Query: 177 GCTASMFTITLSASILFGTYESIK 200
           GC A +   T  A I F  +++IK
Sbjct: 150 GCPAFIVGNTAKAGIRFLGFDTIK 173

>Scas_667.4
          Length = 308

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 124/287 (43%), Gaps = 28/287 (9%)

Query: 29  GSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP-----SGLLKMMKGMILNEGGLRSFWK 83
           G VS  +A+T  +P++ +K+ +Q +     Q        G+++  +     EG + +FW+
Sbjct: 20  GGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGIIECFQRTAKTEG-IIAFWR 78

Query: 84  GNVPGTMMYVLYGGAQFSSYSFYNNLFG-ETSDMNGQ--LQSLVVGALAGMTSSFVSYPT 140
           GN    + Y       F+       +FG +  +  G+    +L  G  AG  S    Y  
Sbjct: 79  GNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYGKWFAGNLASGGAAGGLSLLFVYSL 138

Query: 141 DVLRTRFIANQDVALSSLSHGC----------KEIWNMEGIPGFFRGCTASMFTITLSAS 190
           D  RTR  A+   A SS   G           K+    +G+ G +RG   S+  I +   
Sbjct: 139 DYARTRLAAD---AKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGFLPSVVGIIVYRG 195

Query: 191 ILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYV 250
           + FG Y+S+K      S E  +           +G ++   +YPLDT+RRR+ + +   V
Sbjct: 196 LYFGLYDSLKPAVLTGSLEGSFLASFLLGWIVTTGAST--ASYPLDTVRRRMMMTSGQAV 253

Query: 251 QHNVENKIVTEIYQSYKGASFIR-MGLNILR---QEGLLSLYQGVSM 293
           +++       ++  +   +S  +  G NILR     G++S+Y  + M
Sbjct: 254 KYDGAFDCFRKVVAAEGVSSLFKGCGANILRGVAGAGVISMYDQLQM 300

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 66.6 bits (161), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 130/300 (43%), Gaps = 35/300 (11%)

Query: 29  GSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPS--GLLKMMKGMILNEGGLRSFWKGNV 86
           GSV+G +   V+ P+D +K R+Q +  ++    S   LLK     IL++ G+R  + G  
Sbjct: 531 GSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLK-----ILSKEGVRGLYSGLG 585

Query: 87  PGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQ---SLVVGALAGMTSSFVSYPTDVL 143
           P  +        +    +  +++    +  +G+L     ++ GA AG      + P +++
Sbjct: 586 PQLIGVAPEKAIKL---TVNDHMRATLAGRDGKLSLPCEIISGATAGACQVVFTNPLEIV 642

Query: 144 RTRFIANQDVALSSLSHGCKEIWNME--GIPGFFRGCTASMFTITLSASILFGTYESIKI 201
           + R     D    +  +    I  ++  G+ G +RG  A +      ++I F TY  IK 
Sbjct: 643 KIRLQVKSDYVADAARNSVNAISVIKNLGLIGLYRGAGACLLRDIPFSAIYFPTYAHIKS 702

Query: 202 YCDEYS-KESDYTNYLR----YSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVEN 256
               +  K+SD  N L       +  ++G+ +  +T P D I+ R+Q          ++ 
Sbjct: 703 NVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQ----------IDP 752

Query: 257 KIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
           K    +Y     A+       IL++EG+ S ++G    + ++ P    +L AYE    L+
Sbjct: 753 KKGESVYNGIWDAA-----RTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEIFHNLF 807

 Score = 65.9 bits (159), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 96/204 (47%), Gaps = 23/204 (11%)

Query: 11  TDHLRK---GEDVKVSQ--SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLL 65
            DH+R    G D K+S    +++G+ +G        PL+ +KIRLQ++  Y   A    +
Sbjct: 602 NDHMRATLAGRDGKLSLPCEIISGATAGACQVVFTNPLEIVKIRLQVKSDYVADAARNSV 661

Query: 66  KMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYS-FYNNLFG---ETSDMNGQL- 120
             +   ++   GL   ++G     +  + +    F +Y+   +N+F    + SD   +L 
Sbjct: 662 NAIS--VIKNLGLIGLYRGAGACLLRDIPFSAIYFPTYAHIKSNVFNFDPKDSDKRNKLN 719

Query: 121 --QSLVVGALAGMTSSFVSYPTDVLRTRFIANQ---DVALSSLSHGCKEIWNMEGIPGFF 175
             Q LV G LAGM ++F++ P DV++TR   +    +   + +    + I   EGI  FF
Sbjct: 720 TWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVYNGIWDAARTILKEEGIKSFF 779

Query: 176 RGCTASM------FTITLSASILF 193
           +G  A +      F  TL+A  +F
Sbjct: 780 KGGPARVLRSSPQFGFTLAAYEIF 803

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 57/124 (45%), Gaps = 4/124 (3%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWK 83
           Q LV+G ++G+ A  +  P D +K RLQ+ P       +G+    +  IL E G++SF+K
Sbjct: 722 QLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVYNGIWDAAR-TILKEEGIKSFFK 780

Query: 84  GNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLV---VGALAGMTSSFVSYPT 140
           G     +      G   ++Y  ++NLF      +          VGALA +  +  ++  
Sbjct: 781 GGPARVLRSSPQFGFTLAAYEIFHNLFPAPRYDDSTTHRPTREPVGALAPINKTVSAFFP 840

Query: 141 DVLR 144
           D L 
Sbjct: 841 DQLE 844

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/196 (21%), Positives = 84/196 (42%), Gaps = 27/196 (13%)

Query: 122 SLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGC-KEIWNMEGIPGFFRGCTA 180
           +  +G++AG   + V YP D+++TR  A +D +    S  C  +I + EG+ G + G   
Sbjct: 527 NFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEGVRGLYSGLGP 586

Query: 181 SMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSK----MVTYPLD 236
            +  +    +I     + ++      +  +     L      ISG T+     + T PL+
Sbjct: 587 QLIGVAPEKAIKLTVNDHMR------ATLAGRDGKLSLPCEIISGATAGACQVVFTNPLE 640

Query: 237 TIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLC 296
            ++ R+QV+ S YV     N +                 +++++  GL+ LY+G    L 
Sbjct: 641 IVKIRLQVK-SDYVADAARNSV---------------NAISVIKNLGLIGLYRGAGACLL 684

Query: 297 KTVPSTVVSLWAYETV 312
           + +P + +    Y  +
Sbjct: 685 RDIPFSAIYFPTYAHI 700

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 65.1 bits (157), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 64/316 (20%), Positives = 131/316 (41%), Gaps = 53/316 (16%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYT-GQAPSGLLKMMKGMILNEGGLRSFW 82
           + ++ GS++G L + +  P DT+K+RLQ +  +      S +    K    NEG ++ F+
Sbjct: 15  RDILYGSIAGALGKVIEYPFDTVKVRLQTQGRHVFPDTWSCITYTYK----NEGIIKGFF 70

Query: 83  KGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDV 142
           +G         +   A F SY+  +      ++++     L+ GA AG  +SFV  P ++
Sbjct: 71  QGIASPLAGAAIENAALFLSYNQCSKFLQHYTNVSDLTNILISGAFAGSCASFVLTPVEL 130

Query: 143 LRTRFIANQDVALSSLSHGC-----------------KEIWNMEGIPGFFRGCTASMFTI 185
           ++ +    Q   L SL  G                  + +    G  G ++G + +    
Sbjct: 131 IKCKL---QVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRE 187

Query: 186 TLSASILFGTYESIKIY------CDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIR 239
           +      F TYE +K Y       ++ S  +D   +   ++ + +G+      +P DT++
Sbjct: 188 SFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADTVK 247

Query: 240 RRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTV 299
             +Q       +H      + +I+                 ++GL   Y+G+ ++L + +
Sbjct: 248 SMMQ------TEHLGLKTAIKKIFV----------------EKGLRGFYRGLGITLIRAI 285

Query: 300 PSTVVSLWAYETVMRL 315
           P+     + YET+ +L
Sbjct: 286 PANATVFYVYETLSKL 301

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 85/207 (41%), Gaps = 10/207 (4%)

Query: 112 ETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEG- 170
           ET  +    + ++ G++AG     + YP D ++ R                   +  EG 
Sbjct: 6   ETQWLAAAFRDILYGSIAGALGKVIEYPFDTVKVRLQTQGRHVFPDTWSCITYTYKNEGI 65

Query: 171 IPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKM 230
           I GFF+G  + +    +  + LF +Y     +   Y+  SD TN L   + + +G  +  
Sbjct: 66  IKGFFQGIASPLAGAAIENAALFLSYNQCSKFLQHYTNVSDLTNIL--ISGAFAGSCASF 123

Query: 231 VTYPLDTIRRRIQVRNSVYVQHNVE-NKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQ 289
           V  P++ I+ ++QV N   +   V     VTE     +    I     +++  G + L+Q
Sbjct: 124 VLTPVELIKCKLQVSNLQSLPLGVAGGNTVTE-----RHTRIIPTIQAVIKNRGFIGLWQ 178

Query: 290 GVSMSLCKTVPSTVVSLWAYETVMRLY 316
           G S +  +     V     YE +M+ Y
Sbjct: 179 GQSGTFIRESFGGVAWFATYE-LMKKY 204

 Score = 32.3 bits (72), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 8/77 (10%)

Query: 8   QHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKM 67
           +HN +      D K  + L +G+ +GL     I P DT+K  +Q    + G      LK 
Sbjct: 208 RHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADTVKSMMQTE--HLG------LKT 259

Query: 68  MKGMILNEGGLRSFWKG 84
               I  E GLR F++G
Sbjct: 260 AIKKIFVEKGLRGFYRG 276

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 65.1 bits (157), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 89/190 (46%), Gaps = 14/190 (7%)

Query: 22  VSQSLVAGSVSGLLARTVIAPLDTLKIRLQLR-PSYTGQAPSGLLKMMKGMILNEGGLRS 80
           V+  L+A + +  LA  ++ P + +K++ Q   P +      G     K M    GG+++
Sbjct: 109 VTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGW----KKMYAESGGMKA 164

Query: 81  FWKGNVPGTMMYVLYGGAQFSSYS-----FYNNLFGETSDMNGQLQ---SLVVGALAGMT 132
           F+KG VP     + Y   +F+S+       Y+ L  +  +MN   Q   S V G LAG+ 
Sbjct: 165 FYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGIL 224

Query: 133 SSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASIL 192
            + VS+P DV+ ++ I ++  A  S+S   K I+   G  G + G    +  I    S  
Sbjct: 225 CAAVSHPADVMVSK-INSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQ 283

Query: 193 FGTYESIKIY 202
           +  Y+S K Y
Sbjct: 284 WLIYDSFKAY 293

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 95/233 (40%), Gaps = 18/233 (7%)

Query: 40  IAPLDTLKIRLQLRPS-YTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGA 98
           I PLD +K RLQ+ P  YT       L+  + +I NE G +  + G     + Y L G  
Sbjct: 36  ITPLDLVKCRLQVNPKLYTSN-----LQGFRKIIANE-GWKKVYTGFGATFVGYSLQGAG 89

Query: 99  QFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSL 158
           ++  Y ++ +L+       G    L+  A A   +  +  P + ++ +         +++
Sbjct: 90  KYGGYEYFKHLYSSWLS-PGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNV 148

Query: 159 SHGCKEIWNME-GIPGFFRGCTASMFTITLSASILFGTYESI--KIYCDEYSKESDYTNY 215
             G K+++    G+  F++G               F ++E I  KIY     K+ +    
Sbjct: 149 VDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNAL 208

Query: 216 LRYSASSI----SGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQ 264
            + S S +    +G+    V++P D +  +I          +V +K    IYQ
Sbjct: 209 QQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASK---RIYQ 258

>Scas_640.25
          Length = 306

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/305 (23%), Positives = 138/305 (45%), Gaps = 36/305 (11%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPS------GLLKMMKGMILNEGGLR 79
            +AG+++G+    V+ PLD +K R+QL+ S TG A +      G++  +  ++  EG + 
Sbjct: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVS-TGAAGASATHYKGVIDCLSQIVKKEGPMH 75

Query: 80  SFWKGNVPGTMMYVLYGGAQFSS----YSFYNNLFGETSDMNGQLQSLVVGALAGMTSSF 135
             +KG     +M       +F+S       + ++FG T  +  Q+ S++ GA AG+T + 
Sbjct: 76  -MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFG-TKQLTQQI-SVLSGASAGITEAL 132

Query: 136 VSYPTDVLRTRFIANQDV--ALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILF 193
           V  P ++++ R    QDV           K I   +G+ G + G  ++++   +  +  F
Sbjct: 133 VIVPFELVKIRL---QDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189

Query: 194 GT-YESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQH 252
           G  ++  ++     SK+    N L   A  + G    M   P D ++ RIQ         
Sbjct: 190 GVIFQVRELLPVAKSKQEKTRNDL--CAGFVGGTFGVMFNTPFDVVKSRIQSDG------ 241

Query: 253 NVENKIVTEIYQ-SYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYET 311
              N+I+  + + ++   S ++    I  +EG  +LY+G    + +  P   V L  +  
Sbjct: 242 ---NEIINGVRKYNWTWPSVMK----IYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTN 294

Query: 312 VMRLY 316
           VM ++
Sbjct: 295 VMNVF 299

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 49/100 (49%), Gaps = 10/100 (10%)

Query: 217 RYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGL 276
           ++ A +I+G++  MV YPLD ++ R+Q++        V           YKG   I    
Sbjct: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQ--------VSTGAAGASATHYKGV--IDCLS 65

Query: 277 NILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
            I+++EG + +Y+G+S  +    P   V   + +  ++L+
Sbjct: 66  QIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLW 105

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 34/183 (18%), Positives = 75/183 (40%), Gaps = 14/183 (7%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQ-LRPSYTGQAPSGLLKMMKGMILNEGGLRSFWK 83
           S+++G+ +G+    VI P + +KIRLQ +   + G  P  +LK     I+ + GL+  + 
Sbjct: 119 SVLSGASAGITEALVIVPFELVKIRLQDVNSKFKG--PVEVLK----HIIKQDGLKGLYS 172

Query: 84  GNVPGTMMYVLYGGAQFSS-YSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDV 142
           G         ++    F   +     L    S        L  G + G      + P DV
Sbjct: 173 GVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDV 232

Query: 143 LRTRFIANQDVALSSLSH------GCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTY 196
           +++R  ++ +  ++ +           +I++ EG    ++G    +  +    ++L   +
Sbjct: 233 VKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292

Query: 197 ESI 199
            ++
Sbjct: 293 TNV 295

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 43/104 (41%), Gaps = 12/104 (11%)

Query: 16  KGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLK-------MM 68
           K +  K    L AG V G        P D +K R+Q   S   +  +G+ K       +M
Sbjct: 203 KSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQ---SDGNEIINGVRKYNWTWPSVM 259

Query: 69  KGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGE 112
           K  I +E G R+ +KG VP  +     G      ++   N+F E
Sbjct: 260 K--IYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFRE 301

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 68/316 (21%), Positives = 136/316 (43%), Gaps = 40/316 (12%)

Query: 14  LRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMIL 73
           + + + V  S+S +AG ++G +  +V  P +  K RLQL    +  + + L+     +I 
Sbjct: 1   MSQSKQVDPSKSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLV-----LIY 55

Query: 74  NEG---GLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF--GETSDMNGQLQSLVVGAL 128
           N     G+ S + G     +      G +F  +    NL    +T +++G  + ++ G  
Sbjct: 56  NTAKTQGIGSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLRDPKTGELSGP-RGVIAGLG 114

Query: 129 AGMTSSFVSY-PTDVLRTRFIANQDVALSSLSHGCK-------EIWNMEGIPGFFRGCTA 180
           AG+  S V+  P + ++T  I ++  A     +  K        +   +G+ G +RG   
Sbjct: 115 AGLLESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLP 174

Query: 181 SMFTITLSASILFGTYESIKIYCDEYS---KESDYTNYLRYSASSISGVTSKMVTYPLDT 237
                  + ++  G Y  IK+   +Y+   K+   ++ L +   + SG+ +   T P+DT
Sbjct: 175 VSMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDT 234

Query: 238 IRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCK 297
           ++ R+Q  +S                + Y  +S I     I ++EGL + ++G +  L +
Sbjct: 235 VKTRMQSLDS----------------KRY--SSTINCFTTIFKEEGLKAFWKGATPRLGR 276

Query: 298 TVPSTVVSLWAYETVM 313
              S  +    YE V+
Sbjct: 277 LFLSGGIVFTVYEKVL 292

>Kwal_47.17321
          Length = 881

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 94/205 (45%), Gaps = 18/205 (8%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKG 84
            +++G+ +G        PL+ +KIRLQ+R  Y    P   L  +   ++   GLR  +KG
Sbjct: 597 EIISGAAAGACQVIFTNPLEIVKIRLQVRSEYADSLPKSQLTALG--VVKSLGLRGLYKG 654

Query: 85  NVPGTMMYVLYGGAQFSSYS-FYNNLFG-ETSDMNGQL-----QSLVVGALAGMTSSFVS 137
            V   M  V +    F +Y+    ++F  +  D N +      + L  G LAGM +++++
Sbjct: 655 LVACLMRDVPFSAIYFPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLT 714

Query: 138 YPTDVLRTRFIANQ---DVALSSLSHGCKEIWNMEGIPGFFRGCTASM------FTITLS 188
            P DV++TR   +    +   + + H  + I   E    FF+G  A +      F  TL+
Sbjct: 715 TPFDVIKTRLQIDPRKGETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLA 774

Query: 189 ASILFGTYESIKIYCDEYSKESDYT 213
           A  +F     ++   +  S+E++ T
Sbjct: 775 AYEIFQNMFPLQHSENNESRETNDT 799

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 57/303 (18%), Positives = 124/303 (40%), Gaps = 33/303 (10%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKG 84
           + + GSV+G +  T + P+D +K R+Q + +++ Q  + +   +K  I +  G+R  + G
Sbjct: 503 NFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFS-QYKNSIDCFVK--IFSREGIRGIYSG 559

Query: 85  NVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLR 144
             P  +        + +   +   L  + ++       ++ GA AG      + P ++++
Sbjct: 560 LGPQLVGVAPEKAIKLTVNDYVRKLLMDENNRLTLPLEIISGAAAGACQVIFTNPLEIVK 619

Query: 145 TRFIANQDVALSSLSHGCKEIWNME--GIPGFFRGCTASMFTITLSASILFGTYESIKIY 202
            R     + A S        +  ++  G+ G ++G  A +      ++I F TY  +K  
Sbjct: 620 IRLQVRSEYADSLPKSQLTALGVVKSLGLRGLYKGLVACLMRDVPFSAIYFPTYAHLKRD 679

Query: 203 CDEY-----SKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENK 257
              Y     +K +    +   +A  ++G+ +  +T P D I+ R+Q+             
Sbjct: 680 IFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQI------------- 726

Query: 258 IVTEIYQSYKGAS----FIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVM 313
                    KG +     +     IL++E   S ++G    + ++ P    +L AYE   
Sbjct: 727 ------DPRKGETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYEIFQ 780

Query: 314 RLY 316
            ++
Sbjct: 781 NMF 783

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 54/113 (47%), Gaps = 2/113 (1%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGN 85
           L AG ++G+ A  +  P D +K RLQ+ P       +G+L   +  IL E   +SF+KG 
Sbjct: 700 LTAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYTGILHAAR-TILKEERFKSFFKGG 758

Query: 86  VPGTMMYVLYGGAQFSSYSFYNNLFG-ETSDMNGQLQSLVVGALAGMTSSFVS 137
               +      G   ++Y  + N+F  + S+ N   ++     + GM S+F+ 
Sbjct: 759 GARVLRSSPQFGFTLAAYEIFQNMFPLQHSENNESRETNDTPIVTGMFSNFLE 811

>Kwal_26.8669
          Length = 296

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 72/299 (24%), Positives = 125/299 (41%), Gaps = 29/299 (9%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP--SGLLKMMKGMILNEGGLRSFWK 83
             AG+V+G+    V+ PLD +K R+QL+ S  G  P   G++  +K ++  EG  R  +K
Sbjct: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVS-GGLGPQYKGVVDCIKQIVAKEGASR-LYK 70

Query: 84  GNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVV--GALAGMTSSFVSYPTD 141
           G     +M       +F+    +  ++     +    QSL +  GA AG   +FV  P +
Sbjct: 71  GISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFE 130

Query: 142 VLRTRFIANQDVALSSLSHG----CKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYE 197
           +++ R    QDV  SS   G     ++I   EG+   + G  ++++   +  +  FG   
Sbjct: 131 LVKIRL---QDV--SSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIF 185

Query: 198 SIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENK 257
            ++    E   +S  T      A SI G    +++ P D ++ RIQ    V       N 
Sbjct: 186 QVRALLPEAKSKSQQTRN-DLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNW 244

Query: 258 IVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
               I+  YK             +EG  +LY+G    + +  P   + L  +   M  +
Sbjct: 245 SWPSIFTIYK-------------EEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/102 (21%), Positives = 47/102 (46%), Gaps = 14/102 (13%)

Query: 215 YLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRM 274
           + +++A +++G++  +V YPLD ++ R+Q++ S              +   YKG   +  
Sbjct: 10  FYQFAAGAVAGISEILVMYPLDVVKTRMQLQVS------------GGLGPQYKGV--VDC 55

Query: 275 GLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
              I+ +EG   LY+G+S  +    P         +   ++Y
Sbjct: 56  IKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIY 97

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 34/82 (41%), Gaps = 13/82 (15%)

Query: 16  KGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQA-------PSGLLKMM 68
           K +  +    L+AGS+ G +   +  P D +K R+Q      G A       PS      
Sbjct: 195 KSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIF---- 250

Query: 69  KGMILNEGGLRSFWKGNVPGTM 90
              I  E G R+ +KG VP  +
Sbjct: 251 --TIYKEEGFRALYKGFVPKVL 270

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 70/316 (22%), Positives = 137/316 (43%), Gaps = 44/316 (13%)

Query: 18  EDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQL-RPSYTGQAPSGLLKMMKGMI---L 73
           E++K   S VAG V G+ A     P D +K+R Q  + + T  A + ++K  K  +   L
Sbjct: 34  ENIK---SFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTL 90

Query: 74  NEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSF------YNNLFGETSDMN-GQLQSLVVG 126
               ++ F+KG +P  +         F  Y        +NN  G ++++  GQ+ +   G
Sbjct: 91  FTNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAA--AG 148

Query: 127 ALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTIT 186
            ++ + ++ V+ PT+ ++   +  Q  +  S     K I    GI   F+G  A++    
Sbjct: 149 FISAIPTTLVTAPTERVK---VVLQTSSKGSFIQAAKTIVKEGGIASLFKGSLATLARDG 205

Query: 187 LSASILFGTYESIKIYCDEYSKESDY-----TNYLRYS-ASSISGVTSKMVTYPLDTIRR 240
             +++ F +YE  K Y +      D       N L    A  I+G++  +  +P+DTI+ 
Sbjct: 206 PGSALYFASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKT 265

Query: 241 RIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVP 300
           ++Q  ++   + N+ +    EIY               L++ G+   + G+  +L ++ P
Sbjct: 266 KLQASST---RQNMLSA-TKEIY---------------LQRGGIKGFFPGLGPALLRSFP 306

Query: 301 STVVSLWAYETVMRLY 316
           +   +    E    L+
Sbjct: 307 ANAATFLGVEMTHSLF 322

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 5/95 (5%)

Query: 16  KGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNE 75
           K E V +    +AG ++G+     + P+DT+K +LQ   S T Q    +L   K + L  
Sbjct: 233 KDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQA--SSTRQ---NMLSATKEIYLQR 287

Query: 76  GGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF 110
           GG++ F+ G  P  +       A F      ++LF
Sbjct: 288 GGIKGFFPGLGPALLRSFPANAATFLGVEMTHSLF 322

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 80/321 (24%), Positives = 142/321 (44%), Gaps = 73/321 (22%)

Query: 42  PLDTLKIRLQ---LRPSYTGQAPS-------GLLKMMK--GMILN---EGGLRSFWKGNV 86
           P D +K RLQ      +Y  QA +       GL+   +  G+I N   + G RS +KG  
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 87  PGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQS---------LVVGALAGMTSSFVS 137
           P      L G     S +F+   +G T D   +L +          + GA AG  +S  +
Sbjct: 129 PN-----LVGVIPARSINFFT--YGVTKDTASRLLNDGQEAPWIHFLAGATAGWATSTAT 181

Query: 138 YPTDVLRTRFIANQDVALSSLSHGCKEIWNM-------EGIPGFFRGCTASMFTITLSAS 190
            P  +++TR     D A    S   K  W+        EGI G ++G +AS +  ++ + 
Sbjct: 182 NPIWLVKTRL--QLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSAS-YLGSVESI 238

Query: 191 ILFGTYESIKIYCDEYS-------KESDYTNYL-------RYSASSISGVTSKMVTYPLD 236
           + +  YE +K    + S        E + T Y+       R  ++  + + + ++TYP +
Sbjct: 239 LQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHE 298

Query: 237 TIRRRIQVRNSVYVQHNVENKIV--TEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMS 294
            +R R++       Q   EN  +  T ++QS+           I+++EG  S+Y G++  
Sbjct: 299 VVRTRLR-------QAPKENGKLKYTGLFQSFS---------LIIKEEGFASMYSGLTPH 342

Query: 295 LCKTVPSTVVSLWAYETVMRL 315
           L +TVP++++    +E V++L
Sbjct: 343 LMRTVPNSIIMFGTWELVIKL 363

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 13/85 (15%)

Query: 232 TYPLDTIRRRIQ--VRNSVY-VQHNVENKIVTEIYQSYKGASFIRMGLNILR----QEGL 284
           T P D ++ R+Q  V +  Y  Q      +V      Y+G    R  + I++    QEG 
Sbjct: 67  TCPFDVVKTRLQSDVFHGAYKTQATARTNVV------YQGLMHFRETVGIIQNVYTQEGF 120

Query: 285 LSLYQGVSMSLCKTVPSTVVSLWAY 309
            SL++G+  +L   +P+  ++ + Y
Sbjct: 121 RSLFKGLGPNLVGVIPARSINFFTY 145

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/295 (21%), Positives = 127/295 (43%), Gaps = 36/295 (12%)

Query: 29  GSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPG 88
           GS++G +  TV+ P+D +K R+Q + S   Q  + +  ++K  I++  G++  + G  P 
Sbjct: 537 GSIAGCIGATVVYPIDFIKTRMQAQRS-LAQYKNSIDCLLK--IISREGIKGLYSGLGPQ 593

Query: 89  TMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQ---SLVVGALAGMTSSFVSYPTDVLRT 145
            +        + +   F  N     +D NG+L     ++ GA AG      + P ++++ 
Sbjct: 594 LIGVAPEKAIKLTVNDFMRN---RLTDKNGKLSLFPEIISGASAGACQVIFTNPLEIVKI 650

Query: 146 RFIANQDVALSSLSHGCK---EIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIK-- 200
           R     D    ++    +   +I    G+ G + G  A +      ++I F TY  +K  
Sbjct: 651 RLQVQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPTYAHLKKD 710

Query: 201 ---IYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQV--RNSVYVQHNVE 255
                 ++ +K +    +   +A +I+G+ +  +T P D I+ R+Q+  R      + + 
Sbjct: 711 LFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGETKYNGIF 770

Query: 256 NKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
           + I T                 IL++E   S ++G    + ++ P    +L AYE
Sbjct: 771 HAIRT-----------------ILKEESFRSFFKGGGARVLRSSPQFGFTLAAYE 808

 Score = 60.5 bits (145), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 87/194 (44%), Gaps = 29/194 (14%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTG----QAPSGLLKMMKGMILNEGGLRS 80
            +++G+ +G        PL+ +KIRLQ++  Y G    QA     +++K +     GLR 
Sbjct: 627 EIISGASAGACQVIFTNPLEIVKIRLQVQSDYVGENIQQANETATQIVKKL-----GLRG 681

Query: 81  FWKGNVPGTMMYVLYGGAQFSSYS-FYNNLFGETSDMNGQLQS--------LVVGALAGM 131
            + G     M  V +    F +Y+    +LF    D N + +         L  GA+AGM
Sbjct: 682 LYNGVAACLMRDVPFSAIYFPTYAHLKKDLFD--FDPNDKTKRNRLKTWELLTAGAIAGM 739

Query: 132 TSSFVSYPTDVLRTRFIANQ---DVALSSLSHGCKEIWNMEGIPGFFRGCTASM------ 182
            ++F++ P DV++TR   +    +   + + H  + I   E    FF+G  A +      
Sbjct: 740 PAAFLTTPFDVIKTRLQIDPRKGETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQ 799

Query: 183 FTITLSASILFGTY 196
           F  TL+A  LF  +
Sbjct: 800 FGFTLAAYELFKGF 813

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 94/202 (46%), Gaps = 30/202 (14%)

Query: 120 LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGC-KEIWNMEGIPGFFRGC 178
           L +  +G++AG   + V YP D ++TR  A + +A    S  C  +I + EGI G + G 
Sbjct: 531 LYNFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSGL 590

Query: 179 TASMFTITLSASILFGTYESIKIYCDEYSKE--SDYTNYLRYSASSISGVTSK----MVT 232
              +  +           ++IK+  +++ +   +D    L      ISG ++     + T
Sbjct: 591 GPQLIGV--------APEKAIKLTVNDFMRNRLTDKNGKLSLFPEIISGASAGACQVIFT 642

Query: 233 YPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVS 292
            PL+ ++ R+QV+ S YV  N++        Q+ + A+       I+++ GL  LY GV+
Sbjct: 643 NPLEIVKIRLQVQ-SDYVGENIQ--------QANETAT------QIVKKLGLRGLYNGVA 687

Query: 293 MSLCKTVPSTVVSLWAYETVMR 314
             L + VP + +    Y  + +
Sbjct: 688 ACLMRDVPFSAIYFPTYAHLKK 709

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 1/69 (1%)

Query: 16  KGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNE 75
           K   +K  + L AG+++G+ A  +  P D +K RLQ+ P       +G+   ++  IL E
Sbjct: 721 KRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGETKYNGIFHAIR-TILKE 779

Query: 76  GGLRSFWKG 84
              RSF+KG
Sbjct: 780 ESFRSFFKG 788

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 43/107 (40%), Gaps = 26/107 (24%)

Query: 209 ESDYTNYLRY---------SASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIV 259
           ES Y NY  Y         S  SI+G     V YP+D I+ R+Q + S+           
Sbjct: 516 ESLYINYYFYPIFDSLYNFSLGSIAGCIGATVVYPIDFIKTRMQAQRSL----------- 564

Query: 260 TEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSL 306
                 YK +  I   L I+ +EG+  LY G+   L    P   + L
Sbjct: 565 ----AQYKNS--IDCLLKIISREGIKGLYSGLGPQLIGVAPEKAIKL 605

>Kwal_33.12988
          Length = 303

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/315 (21%), Positives = 129/315 (40%), Gaps = 36/315 (11%)

Query: 12  DHLRKGEDVKVS-QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKG 70
           D L    D++ + + + AG+  G+    V  P D  K+RLQ     T   P+  L++++ 
Sbjct: 12  DDLTDKSDIRRTLKDITAGTTGGIAQVLVGQPFDITKVRLQ-----TSSTPTTALRVVQD 66

Query: 71  MILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSL----VVG 126
           ++ NEG LR F+KG     +   L   +QF +       F + ++       L      G
Sbjct: 67  LVKNEG-LRGFYKGTTLPLIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPEYYACG 125

Query: 127 ALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHG---CKEIWNMEGIPGFFRGCTASMF 183
            ++G  ++F++ P + +R            +   G   C +    EG     RG T ++ 
Sbjct: 126 FVSGCANAFLATPIEHVRILLQVQTKSRADAEYQGAMDCIKKLLKEG--KLMRGFTPTIL 183

Query: 184 TITLSASILFGTYESIKIYCDEYSK---ESDYTNYLRYSASSISGVTSKMVTYPLDTIRR 240
             +    + F +YE++   C E  K     D   +      + SG     + YP D I+ 
Sbjct: 184 RTSHGFGVYFTSYEAM--ICSEQRKGIARKDIPAWKLCLYGAFSGSLLWAMVYPFDVIKS 241

Query: 241 RIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVP 300
            +Q            +K+ T +Y    G +  ++  NI  + G  +  +G   ++ +++P
Sbjct: 242 VMQ-----------SDKLRTPVY----GTNVFQVAKNIYNERGPKAFVKGFGPTMLRSLP 286

Query: 301 STVVSLWAYETVMRL 315
               +  A+E  MR+
Sbjct: 287 VNGATFTAFEMAMRI 301

>Scas_645.9
          Length = 391

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 98/215 (45%), Gaps = 31/215 (14%)

Query: 12  DHLRKGEDVKVS----QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSG---- 63
           ++LR    +  S      L+ G+++ +LA + +APL+ LK +LQ  P  +    S     
Sbjct: 171 EYLRDNSPLATSSPTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVK 230

Query: 64  -LLKMMKGMILNEGGLRSFWKG-------NVPGTMMYVLYGGAQFSSYSFYNNLFGETSD 115
            LLK  +  +   G   + +KG       +VP + +Y  +G  +F     + +     S+
Sbjct: 231 ELLKETRQEMRISGASNALFKGLEITLWRDVPFSAIY--WGSYEFCKTHLWMDTSKSHSN 288

Query: 116 MNGQLQSLVVGALAGMTSSFVSYPTDVLRTR----FIANQDVAL---------SSLSHGC 162
           +   + S + G+++G  ++ V++P DV +TR    F+ N D ++          ++    
Sbjct: 289 LTFFINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFL 348

Query: 163 KEIWNMEGIPGFFRGCTASMFTITLSASILFGTYE 197
           + IW +EG    + G    M  I  S +I+  +YE
Sbjct: 349 RNIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYE 383

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 119/255 (46%), Gaps = 24/255 (9%)

Query: 77  GLRSFWKGNVPGTMMYVLYGGAQFSSYSFY--NNLFGETSDMNGQLQSLVVGALAGMTSS 134
           G+ + W+G     +M +      F+ Y +   N+    +S        L+ GA+A + ++
Sbjct: 144 GITTLWRGISINLLMAIPANIVYFTGYEYLRDNSPLATSSP---TFNPLMCGAIARILAA 200

Query: 135 FVSYPTDVLRTRFIANQDVALSSLS-----HGCKEIWNMEGIPG----FFRGCTASMFTI 185
               P ++L+T+  +   V+ S+ S        KE      I G     F+G   +++  
Sbjct: 201 STVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRISGASNALFKGLEITLWRD 260

Query: 186 TLSASILFGTYESIK--IYCDEYSKESDYTNYLR-YSASSISGVTSKMVTYPLDTIRRRI 242
              ++I +G+YE  K  ++ D     S+ T ++  +   SISG  + +VT+P D  + R 
Sbjct: 261 VPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFINSFIGGSISGTIAALVTHPFDVGKTRW 320

Query: 243 QVRNSVYVQHNVENKIVT-EIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPS 301
           Q+    ++ +N ++ + + +I Q+     F+R   NI + EG  +LY G+   + K  PS
Sbjct: 321 QIS---FMGNNDKSVVKSPDIEQTKNMFKFLR---NIWKLEGWGALYTGLVPRMVKIAPS 374

Query: 302 TVVSLWAYETVMRLY 316
             + + +YE   RL+
Sbjct: 375 CAIMISSYELSKRLF 389

 Score = 33.1 bits (74), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 30/166 (18%), Positives = 67/166 (40%), Gaps = 22/166 (13%)

Query: 150 NQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKE 209
           N  V  +       +IW +EGI   +RG + ++     +  + F  YE ++   D     
Sbjct: 124 NSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLR---DNSPLA 180

Query: 210 SDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGA 269
           +    +      +I+ + +     PL+ ++ ++Q               +  + +S    
Sbjct: 181 TSSPTFNPLMCGAIARILAASTVAPLELLKTKLQS--------------IPRVSKSTTSW 226

Query: 270 SFIRMGLNILRQEGLLS-----LYQGVSMSLCKTVPSTVVSLWAYE 310
             ++  L   RQE  +S     L++G+ ++L + VP + +   +YE
Sbjct: 227 MMVKELLKETRQEMRISGASNALFKGLEITLWRDVPFSAIYWGSYE 272

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 38/102 (37%), Gaps = 19/102 (18%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLK-----MMKGMILNEGGL 78
            S + GS+SG +A  V  P D  K R Q+  S+ G     ++K       K M      L
Sbjct: 294 NSFIGGSISGTIAALVTHPFDVGKTRWQI--SFMGNNDKSVVKSPDIEQTKNMF---KFL 348

Query: 79  RSFWK---------GNVPGTMMYVLYGGAQFSSYSFYNNLFG 111
           R+ WK         G VP  +          SSY     LF 
Sbjct: 349 RNIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKRLFN 390

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 130/297 (43%), Gaps = 39/297 (13%)

Query: 29  GSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP-----SGLLKMMKGMILNEGGLRSFWK 83
           G VS  +++T  AP++ +K+ +Q +     Q       +G+++  K    +EG + SFW+
Sbjct: 17  GGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRTAADEG-VASFWR 75

Query: 84  GNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLV-----VGALAGMTSSFVSY 138
           GN    + Y       F+       +FG   +  G  +         G   G++  FV Y
Sbjct: 76  GNTANVIRYFPTQALNFAFKDKIKAMFGFKKE-EGYAKWFAGNLASGGLAGGLSLLFV-Y 133

Query: 139 PTDVLRTRFIANQDVA-------LSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASI 191
             D  RTR  A+   A        + L    K+    +G+ G +RG   S+  I +   +
Sbjct: 134 SLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIVVYRGL 193

Query: 192 LFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQ 251
            FG Y+S+K      S E+ +        +  +G ++   +YPLDT+RRR+ + +   V+
Sbjct: 194 YFGLYDSLKPLLLTGSLENSFLASFLLGWAVTTGAST--ASYPLDTVRRRMMMTSGQAVK 251

Query: 252 HNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPST-VVSLW 307
           ++         + +++          I+  EG+ SL++G   ++ + V    V+S++
Sbjct: 252 YD-------GAFDAFR---------KIVAAEGIKSLFKGCGANILRGVAGAGVISMY 292

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 81/318 (25%), Positives = 141/318 (44%), Gaps = 59/318 (18%)

Query: 39  VIAPLDTLKIRLQ---LRPSYTGQAPS-----------GL--LKMMKGMILN---EGGLR 79
           V  P D +K RLQ    + +Y   A S           G+   K   G+I N     G R
Sbjct: 69  VTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFR 128

Query: 80  SFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQ---SLVVGALAGMTSSFV 136
           S +KG  P  +  +      F +Y     ++ +T + NGQ      L+  A AG  +S  
Sbjct: 129 SLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKTLN-NGQEAVWIHLMAAATAGWATSTA 187

Query: 137 SYPTDVLRTRFIANQDVALSSL--SHGC-KEIWNMEGIPGFFRGCTASMFTITLSASILF 193
           + P  +++TR   ++         S  C K +   EGI G ++G +AS +  ++   + +
Sbjct: 188 TNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLSAS-YLGSVEGILQW 246

Query: 194 GTYESIKIYCDEYSKE------------SDYTNYL--RYSASSISGVTSKMVTYPLDTIR 239
             YE +K    + S E            SD       R  ++ ++   + ++TYP + +R
Sbjct: 247 VLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAKFVASIITYPHEVVR 306

Query: 240 RRIQVRNSVYVQHNVENKIV--TEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCK 297
            R++       Q  +EN  +  T + QS      IR+   I+++EGL S+Y G++  L +
Sbjct: 307 TRLR-------QAPLENGKLKYTGLVQS------IRV---IIKEEGLASMYGGLTPHLLR 350

Query: 298 TVPSTVVSLWAYETVMRL 315
           TVP++++    +E V+RL
Sbjct: 351 TVPNSIIMFGTWELVIRL 368

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 11/95 (11%)

Query: 230 MVTYPLDTIRRRIQ--VRNSVYVQH------NVENKIVTEIYQSYKGASFIRMGLNILRQ 281
           +VT P D ++ R+Q  V  + Y  H      N  N I   +    +    I    N+ R 
Sbjct: 68  VVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIIS---NVYRN 124

Query: 282 EGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
           EG  SL++G+  +L   +P+  ++ + Y T   +Y
Sbjct: 125 EGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIY 159

>Kwal_27.11419
          Length = 298

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 74/317 (23%), Positives = 128/317 (40%), Gaps = 56/317 (17%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGN 85
            + G V GL +  ++ P D LK RLQ   S      S LL +++  I   G L   WKG 
Sbjct: 11  FIGGFVGGLTSAVILQPFDLLKTRLQQNKS------SNLLDVVRS-IETPGQL---WKGT 60

Query: 86  VPGTMMYVLYGGAQFSSYSFYNNLFGE-----------TSDMNGQL---QSLVVGALAGM 131
           +P  +   +      S+ +   +   +           +S    QL   ++L+ GA+   
Sbjct: 61  LPSALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRA 120

Query: 132 TSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASI 191
                + P  VL+ RF +       SL      I+  EGI G F GC A++      A +
Sbjct: 121 AVGVATMPITVLKVRFESTM-YNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAGL 179

Query: 192 LFGTYESIK--------IYCDEYSKESDYTNYLRYSASSISGVTSK----MVTYPLDTIR 239
               YE  K        ++  E+++   ++       +SI+  +S      +T P DTI+
Sbjct: 180 YVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASLATTITSPFDTIK 239

Query: 240 RRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTV 299
            R+Q+  S Y                     FI+   +I+R E   +L+ G+S+ L +  
Sbjct: 240 TRMQLNPSQYY-------------------GFIQTFKSIIRYERPRNLFDGLSLRLSRKA 280

Query: 300 PSTVVSLWAYETVMRLY 316
            S  ++   YE +++ +
Sbjct: 281 LSAGIAWGIYEELVKKF 297

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 8   QHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPS 55
           +HN   +   +   +  S+ A S S  LA T+ +P DT+K R+QL PS
Sbjct: 201 EHNESGVFSTKTSTIINSIAAFS-SASLATTITSPFDTIKTRMQLNPS 247

>Scas_697.47
          Length = 328

 Score = 62.4 bits (150), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 68/312 (21%), Positives = 131/312 (41%), Gaps = 45/312 (14%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGL--LKMM---------KGMI 72
           +SLVAG V G+ A     P D +K+R Q     +GQA S +  +K++           M+
Sbjct: 38  KSLVAGGVGGVCAVLTGHPFDLIKVRCQ-----SGQASSTIHAIKIILKDARAIPTSNML 92

Query: 73  LNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQL---QSLVVGALA 129
           +N   ++ F+KG +P  +         F  Y     +   +   + QL   Q    G ++
Sbjct: 93  VNS--VKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSSSAQLTMGQMAAAGFIS 150

Query: 130 GMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSA 189
            + ++ V+ PT+ ++         + +S     K I    G+   F+G  A++      +
Sbjct: 151 AIPTTLVTAPTERIKVVLQTAGANSKTSFIGAAKNIVKDGGVKSLFKGSLATLARDGPGS 210

Query: 190 SILFGTYE-SIKIYCDEYSKESDYTNYLRYS----ASSISGVTSKMVTYPLDTIRRRIQV 244
           ++ F +YE S K   D  +     T  +  +    A  I+G++  +V +P+DTI+ ++Q 
Sbjct: 211 ALYFASYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQ- 269

Query: 245 RNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVV 304
            +S   Q  V      EIY               +++ G+   + G+  +L ++ P+   
Sbjct: 270 -SSSGSQSMVA--ATREIY---------------VKRGGIKGFFPGLGPALLRSFPANAA 311

Query: 305 SLWAYETVMRLY 316
           +    E    L+
Sbjct: 312 TFLGVELTHSLF 323

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 85/204 (41%), Gaps = 33/204 (16%)

Query: 119 QLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIW-NMEGIP----- 172
            L+SLV G + G+ +    +P D+++ R  + Q    SS  H  K I  +   IP     
Sbjct: 36  NLKSLVAGGVGGVCAVLTGHPFDLIKVRCQSGQ---ASSTIHAIKIILKDARAIPTSNML 92

Query: 173 -----GFFRGCTASMFTITLSASILFGTYE-SIKIYCDEYSKESDYTNYLRYSASSISGV 226
                GF++G    +  +T   ++ F  Y+   KI     S  +  T     +A  IS +
Sbjct: 93  VNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSSSAQLTMGQMAAAGFISAI 152

Query: 227 TSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLS 286
            + +VT P + I                  K+V +   +    SFI    NI++  G+ S
Sbjct: 153 PTTLVTAPTERI------------------KVVLQTAGANSKTSFIGAAKNIVKDGGVKS 194

Query: 287 LYQGVSMSLCKTVPSTVVSLWAYE 310
           L++G   +L +  P + +   +YE
Sbjct: 195 LFKGSLATLARDGPGSALYFASYE 218

 Score = 36.2 bits (82), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 47/103 (45%), Gaps = 5/103 (4%)

Query: 8   QHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKM 67
             N     K  +V ++   +AG ++G+    V+ P+DT+K +LQ   S +G     ++  
Sbjct: 226 DRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQ---SSSGS--QSMVAA 280

Query: 68  MKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF 110
            + + +  GG++ F+ G  P  +       A F      ++LF
Sbjct: 281 TREIYVKRGGIKGFFPGLGPALLRSFPANAATFLGVELTHSLF 323

>Kwal_23.4354
          Length = 343

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 80/361 (22%), Positives = 146/361 (40%), Gaps = 78/361 (21%)

Query: 12  DHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQ---LRPSYTGQAPSGLLKMM 68
           D  +KG  + + + L++  V  LL   ++ P+D ++IRLQ   + P    +  +GL    
Sbjct: 3   DEKQKG--IGLKERLLSAVVGSLLTSLILTPMDVVRIRLQQQKMLPDCGCETDAGLTSRA 60

Query: 69  K------------------------------GMILNEGGLRSFWKGNVPGTMMYVLYGGA 98
                                          G I    G++S W+G    ++  ++   A
Sbjct: 61  SSKGVFWQDICFEDVRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGL---SITLLMAAPA 117

Query: 99  QFSSYSFYNNLFGET--SDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALS 156
               +  Y +L  ++   D    L  L+ GALA + ++    P ++ RTR    Q +  S
Sbjct: 118 NMVYFIGYESLRDKSRLQDKYPTLNPLMCGALARVLAATTVAPLELFRTRL---QSIPRS 174

Query: 157 S------------LSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYE----SIK 200
           S            +     EI  + G    FRG   +++     +SI +G YE    ++ 
Sbjct: 175 SPKSTTAMMIKDLIKESRYEISKV-GYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVS 233

Query: 201 IYCDEYSKESDYTNYLRYSAS----SISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVEN 256
           I  ++    S  +N+  +  S    S  G  + ++T+P D  + R+Q+    Y+   +E 
Sbjct: 234 IDSEKSIVNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQI---TYLNSTLEK 290

Query: 257 KIVTEIYQSYKGASFIRMGLNILRQ-EGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
           K    +++           LN +R+ EGL +LY G+   + K  PS  + +  YE   RL
Sbjct: 291 KPSKNMFKY----------LNQMRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEVCKRL 340

Query: 316 Y 316
           +
Sbjct: 341 F 341

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 67/313 (21%), Positives = 128/313 (40%), Gaps = 46/313 (14%)

Query: 21  KVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRS 80
           +V + + AG++ G+    V  P DT K+RLQ     T +   G++++++ ++ NEG L +
Sbjct: 25  RVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQ-----TSKTKIGVIEVVQNLLRNEGAL-A 78

Query: 81  FWKGNVPGTMMYVLYG---------GAQFSSYSFYNNLFGETSDMNGQL-----QSLVVG 126
           F+KG     M+  L G         G   S   F+     +  D    +     Q  + G
Sbjct: 79  FYKG-----MLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCG 133

Query: 127 ALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKE-IWNMEGIPGFFRGCTASMFTI 185
              G+ +SF++ P + +R R              G  + I  +       RG   +M   
Sbjct: 134 LTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRA 193

Query: 186 TLSASILFGTYESIKIYCDEYSKESDYTNYLRY---SASSISGVTSKMVTYPLDTIRRRI 242
                  F  YE++ +   E+ K +       +   S  ++SG    +  YP+D ++   
Sbjct: 194 GHGLGTYFAAYEALVV--KEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVK--- 248

Query: 243 QVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPST 302
               SV    ++EN         YK  S I+    + +Q G+ + ++G   ++ +  P+ 
Sbjct: 249 ----SVLQTDSIENP-------KYKN-SIIKATRALYKQHGIPAFFKGFVPTMIRAAPAN 296

Query: 303 VVSLWAYETVMRL 315
             +  ++E  MR+
Sbjct: 297 AATFVSFEMTMRV 309

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 86/199 (43%), Gaps = 15/199 (7%)

Query: 9   HNTDHL--RKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLK 66
           +N D +  +K   + + Q  + G   G++   + AP++ ++IRLQ   + T Q      K
Sbjct: 111 YNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQ---TQTSQGNERQFK 167

Query: 67  MMKGMILNEGGLRSFWKGNVPGTMMYVLYG-GAQFSSYSFYNNLFGETSDMNGQLQSLVV 125
                I      ++  +G +P TM+   +G G  F++Y        E      Q+ +  +
Sbjct: 168 GPFDCIKKLAKAKALMRGLLP-TMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKL 226

Query: 126 ---GALAGMTSSFVSYPTD----VLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGC 178
              GAL+G       YP D    VL+T  I N     +S+    + ++   GIP FF+G 
Sbjct: 227 CSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYK-NSIIKATRALYKQHGIPAFFKGF 285

Query: 179 TASMFTITLSASILFGTYE 197
             +M     + +  F ++E
Sbjct: 286 VPTMIRAAPANAATFVSFE 304

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 40/98 (40%), Gaps = 22/98 (22%)

Query: 220 ASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKI-VTEIYQSYKGASFIRMGLNI 278
           A ++ GV   +V  P DT + R+Q   +         KI V E+ Q            N+
Sbjct: 32  AGTMGGVAQVLVGQPFDTTKVRLQTSKT---------KIGVIEVVQ------------NL 70

Query: 279 LRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
           LR EG L+ Y+G+   L        V     E++ R +
Sbjct: 71  LRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFF 108

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/321 (21%), Positives = 131/321 (40%), Gaps = 52/321 (16%)

Query: 18  EDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGG 77
           E  + +  L+ G   GL++  ++ P D LK RLQ          S L K +K +      
Sbjct: 3   EQRRATTHLIGGFSGGLVSAIILQPFDLLKTRLQ------QDKTSTLWKTLKSIETPS-- 54

Query: 78  LRSFWKGNVP-------GTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQL---QSLVVGA 127
               W+G +P       G+ MY+    +   + S   N     S    QL   +++  GA
Sbjct: 55  --QLWRGALPSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGA 112

Query: 128 LAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITL 187
           +    +  ++ P  V++ R+  +     +SL +    I+  EG+ GFFRG  A+      
Sbjct: 113 VTRALTGLITMPITVIKVRY-ESTLYQYTSLRYATSHIFRTEGLRGFFRGFGATALRDAP 171

Query: 188 SASILFGTYESIKIYC-----DEYSKESDYTNYLRYSASSISG-------VTSKMVTYPL 235
            A +    Y+ +K+           K +    Y  Y+++ I+G       V +  +T P 
Sbjct: 172 YAGLYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITAPF 231

Query: 236 DTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSL 295
           DT++ R+Q+                   +  K  SF     +I  +E + +L+ G+S+ L
Sbjct: 232 DTVKTRMQL-------------------EPAKFHSFTSTFWHIATKESVRNLFAGISLRL 272

Query: 296 CKTVPSTVVSLWAYETVMRLY 316
            +   S  ++   YE +++ +
Sbjct: 273 TRKAFSAGIAWGIYEEIVKKF 293

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 59.3 bits (142), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 80/175 (45%), Gaps = 23/175 (13%)

Query: 23  SQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFW 82
           S + +AG V+G ++RTV++P + +KI LQ++ S T     G++  + G +  E G+   +
Sbjct: 12  SIAFIAGGVAGAVSRTVVSPFERVKILLQVQSS-TSAYNHGIINAV-GQVYKEEGVAGLF 69

Query: 83  KGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQ-----LQSLVVGALAGMTSSFVS 137
           +GN    +    Y   QF  Y +            G+      Q L  GAL G  S   +
Sbjct: 70  RGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLAT 129

Query: 138 YPTDVLRTRFIANQDVALSSLSHGCKE-------IWNM--------EGIPGFFRG 177
           YP D++RTR ++ Q   L+ LS    +       +W +         GI G +RG
Sbjct: 130 YPLDLVRTR-LSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRG 183

 Score = 55.1 bits (131), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 63/133 (47%), Gaps = 9/133 (6%)

Query: 122 SLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHG----CKEIWNMEGIPGFFRG 177
           + + G +AG  S  V  P +  R + +     + S+ +HG      +++  EG+ G FRG
Sbjct: 14  AFIAGGVAGAVSRTVVSPFE--RVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRG 71

Query: 178 CTASMFTITLSASILFGTYESIK---IYCDEYSKESDYTNYLRYSASSISGVTSKMVTYP 234
              +   I   +++ F  YE  K    + D    +    N+ R SA ++ G  S + TYP
Sbjct: 72  NGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYP 131

Query: 235 LDTIRRRIQVRNS 247
           LD +R R+ ++ +
Sbjct: 132 LDLVRTRLSIQTA 144

 Score = 31.6 bits (70), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 10/74 (13%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQ----------APSGLLKMMKGMIL 73
           Q L AG++ G ++     PLD ++ RL ++ +   +           P G+ +++     
Sbjct: 113 QRLSAGALCGGMSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFK 172

Query: 74  NEGGLRSFWKGNVP 87
            EGG+R  ++G  P
Sbjct: 173 EEGGIRGLYRGIYP 186

 Score = 31.2 bits (69), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 20/95 (21%), Positives = 43/95 (45%), Gaps = 16/95 (16%)

Query: 216 LRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMG 275
           + + A  ++G  S+ V  P + ++  +QV++S    +   + I+  + Q YK        
Sbjct: 13  IAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYN---HGIINAVGQVYK-------- 61

Query: 276 LNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
                +EG+  L++G  ++  +  P + V    YE
Sbjct: 62  -----EEGVAGLFRGNGLNCVRIFPYSAVQFVVYE 91

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 91/196 (46%), Gaps = 18/196 (9%)

Query: 14  LRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMIL 73
           + K  ++K    +++G+ +G        PL+ +KIRLQ+R  Y G      +  +   ++
Sbjct: 604 MDKHANLKWYFEILSGACAGACQVVFTNPLEVVKIRLQVRSEYAGDVLKSQVTALG--VI 661

Query: 74  NEGGLRSFWKGNVPGTMMYVLYGGAQFSSYS-FYNNLFG---ETSDMNGQLQS---LVVG 126
            + G++  +KG     M  V +    F +Y+    ++F    +      +L++   LV G
Sbjct: 662 KQLGIKGLYKGIAACLMRDVPFSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAG 721

Query: 127 ALAGMTSSFVSYPTDVLRTRFIANQ---DVALSSLSHGCKEIWNMEGIPGFFRGCTASM- 182
            LAGM +++++ P DV++TR   +    +     + H  + I   E    FF+G +A + 
Sbjct: 722 GLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYEGIFHAARTILKEESFKSFFKGGSARVL 781

Query: 183 -----FTITLSASILF 193
                F  TL+A  +F
Sbjct: 782 RSSPQFGFTLAAYEIF 797

 Score = 61.2 bits (147), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/298 (22%), Positives = 127/298 (42%), Gaps = 31/298 (10%)

Query: 29  GSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPG 88
           GS++G +  TV+ P+D +K R+Q + S++ Q  + +    K  I +  G+R  + G  P 
Sbjct: 525 GSIAGCIGATVVYPIDLVKTRMQAQRSFS-QYKNSIDCFAK--IFSREGIRGIYSGLGPQ 581

Query: 89  TMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQ---SLVVGALAGMTSSFVSYPTDVLRT 145
            +        + +   +   + G   D +  L+    ++ GA AG      + P +V++ 
Sbjct: 582 LIGVAPEKAIKLTVNDY---MRGRLMDKHANLKWYFEILSGACAGACQVVFTNPLEVVKI 638

Query: 146 RFIANQDVALSSLSHGCKEIWNME--GIPGFFRGCTASMFTITLSASILFGTYESIKIYC 203
           R     + A   L      +  ++  GI G ++G  A +      ++I F TY  +K   
Sbjct: 639 RLQVRSEYAGDVLKSQVTALGVIKQLGIKGLYKGIAACLMRDVPFSAIYFPTYAHLKKDV 698

Query: 204 DEYS-KESDYTNYLR----YSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKI 258
            +Y  K+    N L+      A  ++G+ +  +T P D I+ R+Q+            K 
Sbjct: 699 FKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQID---------PRKG 749

Query: 259 VTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
            T     Y+G         IL++E   S ++G S  + ++ P    +L AYE    ++
Sbjct: 750 ETR----YEG--IFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYEIFQNMF 801

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/229 (20%), Positives = 104/229 (45%), Gaps = 39/229 (17%)

Query: 93  VLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQD 152
           +++G + +S++ FY         +   + +  +G++AG   + V YP D+++TR  A + 
Sbjct: 500 LIHGESWYSNFYFY--------PIFDSIYNFTLGSIAGCIGATVVYPIDLVKTRMQAQRS 551

Query: 153 VALSSLSHGC-KEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEY----- 206
            +    S  C  +I++ EGI G + G    +  +           ++IK+  ++Y     
Sbjct: 552 FSQYKNSIDCFAKIFSREGIRGIYSGLGPQLIGV--------APEKAIKLTVNDYMRGRL 603

Query: 207 -SKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQS 265
             K ++   Y    + + +G    + T PL+ ++ R+QVR S Y    +++++       
Sbjct: 604 MDKHANLKWYFEILSGACAGACQVVFTNPLEVVKIRLQVR-SEYAGDVLKSQVT------ 656

Query: 266 YKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMR 314
                     L +++Q G+  LY+G++  L + VP + +    Y  + +
Sbjct: 657 ---------ALGVIKQLGIKGLYKGIAACLMRDVPFSAIYFPTYAHLKK 696

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 55/124 (44%), Gaps = 5/124 (4%)

Query: 15  RKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILN 74
           ++   +K  + LVAG ++G+ A  +  P D +K RLQ+ P        G+    +  IL 
Sbjct: 707 KQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYEGIFHAAR-TILK 765

Query: 75  EGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSS 134
           E   +SF+KG     +      G   ++Y  + N+F     +  +  +        +TSS
Sbjct: 766 EESFKSFFKGGSARVLRSSPQFGFTLAAYEIFQNMFP----LKREESTFTKDDTPAVTSS 821

Query: 135 FVSY 138
           F ++
Sbjct: 822 FTAF 825

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 131/299 (43%), Gaps = 39/299 (13%)

Query: 28  AGSVSGLLARTVIAPLDTLKIRLQLR------PSYTGQAPSGLLKMMKGMILNEGGLRSF 81
           AG+V+G+    V+ PLD +K R+QL+      P YT     G++  +K ++  EG  R  
Sbjct: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYT-----GVVDCLKKIVAGEGVGR-L 70

Query: 82  WKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMN--GQLQSLVVGALAGMTSSFVSYP 139
           +KG     +M       +F+    +  L+ +   +    Q  S++ GA AG   +FV  P
Sbjct: 71  YKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVP 130

Query: 140 TDVLRTRFIANQDVALSSLSHG----CKEIWNMEGIPGFFRGCTASMFTITLSASILFG- 194
            ++++ R    QD   SS   G     ++I   EG+   + G  ++++   L     FG 
Sbjct: 131 FELVKIRL---QDA--SSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGI 185

Query: 195 TYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNV 254
            +++  +    ++K    TN L   + SI      M++ P D ++ RIQ           
Sbjct: 186 IFQARALLPAAHNKTQCITNDL--ISDSIGCSIGCMLSTPFDVVKSRIQ----------- 232

Query: 255 ENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVM 313
              ++  + + Y  +  +   L I R+EG  +LY+G    + +  P   + L  +  V+
Sbjct: 233 NTAVIPGVVRKYNWS--LPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVL 289

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 78/181 (43%), Gaps = 25/181 (13%)

Query: 120 LQSLVVGALAGMTSSFVSYPTDVLRTRF-IANQDVA---LSSLSHGCKEIWNMEGIPGFF 175
           L     GA+AG++   V YP DV++TR  +  Q  A    + +    K+I   EG+   +
Sbjct: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71

Query: 176 RGCTASMFTITLSASILFGTYESI-KIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYP 234
           +G ++ +       +  F   +   K+Y   +  E   +  L   A + +G     V  P
Sbjct: 72  KGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEK-LSQPLSMLAGASAGCVEAFVVVP 130

Query: 235 LDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMS 294
            + ++ R+Q  +S                 SYKG   + +   I+ +EG+L++Y G+  +
Sbjct: 131 FELVKIRLQDASS-----------------SYKGP--VDVVRKIVAREGVLAMYNGLEST 171

Query: 295 L 295
           L
Sbjct: 172 L 172

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 82/206 (39%), Gaps = 43/206 (20%)

Query: 21  KVSQ--SLVAGSVSGLLARTVIAPLDTLKIRLQ-LRPSYTGQ--------APSGLLKMMK 69
           K+SQ  S++AG+ +G +   V+ P + +KIRLQ    SY G         A  G+L M  
Sbjct: 107 KLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYN 166

Query: 70  GMILNEGGL--RSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGA 127
           G+   E  L   + W G          Y G  F + +       +T  +   L S  +G 
Sbjct: 167 GL---ESTLWRHALWNGG---------YFGIIFQARALLPAAHNKTQCITNDLISDSIGC 214

Query: 128 LAGMTSSFVSYPTDVLRTRFIANQDV----------ALSSLSHGCKEIWNMEGIPGFFRG 177
             G     +S P DV+++R I N  V          +L SL      I+  EG    ++G
Sbjct: 215 SIG---CMLSTPFDVVKSR-IQNTAVIPGVVRKYNWSLPSLL----TIYREEGFRALYKG 266

Query: 178 CTASMFTITLSASILFGTYESIKIYC 203
               +  +     IL   +  +  +C
Sbjct: 267 FVPKVLRLGPGGGILLVVFTGVLDFC 292

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 44/100 (44%), Gaps = 14/100 (14%)

Query: 217 RYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGL 276
           ++ A +++GV+  +V YPLD ++ R+Q++    VQ        T +    K         
Sbjct: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQ----VQGGAGPHY-TGVVDCLK--------- 59

Query: 277 NILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
            I+  EG+  LY+G+S  +    P         +   +LY
Sbjct: 60  KIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY 99

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 68/323 (21%), Positives = 129/323 (39%), Gaps = 24/323 (7%)

Query: 13  HLRKG---EDV-KVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMM 68
           H ++G   ED+  +   +V+G + G +  + +  LDT+K R Q  P+   +    ++   
Sbjct: 40  HKKRGDSDEDLSPIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQGAPNV--KKYRNMISAY 97

Query: 69  KGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGAL 128
           + + L EG  R  + G +   +         F +Y +      E   +N  +  L  G L
Sbjct: 98  RTIWLEEGVRRGLYGGYMAAMLGSFPSAAIFFGTYEYTKRTMIEDWQINDTITHLSAGFL 157

Query: 129 AGMTSSFVSYPTDVLRTRF---------IANQDVALSSLSHGCKEIWNMEGIPGFFRGCT 179
               SSFV  P++VL+TR                  S+L +  K +   EG    F G  
Sbjct: 158 GDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYK 217

Query: 180 ASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVT----SKMVTYPL 235
           A++      +++ F  YE  +    +  ++      L      ++G      + ++T P+
Sbjct: 218 ATLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAGIITTPM 277

Query: 236 DTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASF---IRMGLNILRQ-EGLLSLYQGV 291
           D ++ R+Q +     Q N    +      + + A+    I + L  + Q EG+L  + GV
Sbjct: 278 DVVKTRVQTQQPP-SQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGV 336

Query: 292 SMSLCKTVPSTVVSLWAYETVMR 314
                 T   + + L  Y+  +R
Sbjct: 337 GPRFVWTSVQSSIMLLLYQMTLR 359

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 89/204 (43%), Gaps = 15/204 (7%)

Query: 115 DMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVA-LSSLSHGCKEIWNMEGIP- 172
           D++     +V G + G       +  D ++TR     +V    ++    + IW  EG+  
Sbjct: 49  DLSPIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRR 108

Query: 173 GFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVT 232
           G + G  A+M     SA+I FGTYE  K    E  + +D   +L  SA  +    S  V 
Sbjct: 109 GLYGGYMAAMLGSFPSAAIFFGTYEYTKRTMIEDWQINDTITHL--SAGFLGDFISSFVY 166

Query: 233 YPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLN-ILRQEGLLSLYQGV 291
            P + ++ R+Q+          + +     +QS    S +R  +  ++++EG  SL+ G 
Sbjct: 167 VPSEVLKTRLQL----------QGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGY 216

Query: 292 SMSLCKTVPSTVVSLWAYETVMRL 315
             +L + +P + +    YE   +L
Sbjct: 217 KATLARDLPFSALQFAFYEKFRQL 240

>Scas_721.27
          Length = 374

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/268 (24%), Positives = 121/268 (45%), Gaps = 40/268 (14%)

Query: 70  GMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQ---LQSLVVG 126
           G +    G RS +KG  P  +  +      F +Y     ++ +  + NGQ   L  L+  
Sbjct: 123 GNVYKREGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFN-NGQETPLIHLMSA 181

Query: 127 ALAGMTSSFVSYPTDVLRTRFIANQDVALSSL--SHGC-KEIWNMEGIPGFFRGCTASMF 183
           A AG  +S  + P  +++TR   ++         S  C K +   EGI G +RG +AS +
Sbjct: 182 ATAGWATSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRGLSAS-Y 240

Query: 184 TITLSASILFGTYESIKIYCDEYSKE-------------SDYTNYLRYSASS-ISGVTSK 229
             ++   + +  YE +K    + S E                  + + S S+ ++   + 
Sbjct: 241 LGSIEGILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKFIAS 300

Query: 230 MVTYPLDTIRRRIQVRNSVYVQHNVEN--KIVTEIYQSYKGASFIRMGLNILRQEGLLSL 287
           +VTYP + +R R++       Q  +EN     T + QS++          I+++EGL S+
Sbjct: 301 IVTYPHEVVRTRLR-------QMPMENGKPKYTGLVQSFR---------VIIKEEGLASM 344

Query: 288 YQGVSMSLCKTVPSTVVSLWAYETVMRL 315
           Y G++  L +TVP++++    +E V+RL
Sbjct: 345 YSGLTPHLMRTVPNSIIMFGTWELVIRL 372

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 80/190 (42%), Gaps = 18/190 (9%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEG------GLR 79
           L++ + +G    T   P+  +K R+QL  + T +        +K ++ +EG      GL 
Sbjct: 178 LMSAATAGWATSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRGLS 237

Query: 80  SFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGE--------TSDMNGQLQSLVVGALAGM 131
           + + G++ G + ++LY   +          FG         T  +    Q      +A  
Sbjct: 238 ASYLGSIEGILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKF 297

Query: 132 TSSFVSYPTDVLRTRF----IANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITL 187
            +S V+YP +V+RTR     + N     + L    + I   EG+   + G T  +     
Sbjct: 298 IASIVTYPHEVVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVP 357

Query: 188 SASILFGTYE 197
           ++ I+FGT+E
Sbjct: 358 NSIIMFGTWE 367

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 47/99 (47%), Gaps = 15/99 (15%)

Query: 230 MVTYPLDTIRRRIQ--VRNSVYVQHNVENKIVTEIYQSYKGASFIRMGL----------N 277
           +VT P D ++ R+Q  +  SVY     +   VT  + S    S ++ G           N
Sbjct: 68  VVTCPFDLVKTRLQSDIYQSVY---KSKAATVTAAHNSKIANSLVQAGTHFKETFGILGN 124

Query: 278 ILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
           + ++EG  SL++G+  +L   +P+  ++ + Y T   +Y
Sbjct: 125 VYKREGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIY 163

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 37/187 (19%), Positives = 73/187 (39%), Gaps = 44/187 (23%)

Query: 136 VSYPTDVLRTRF-------IANQDVALSSLSHGCK--------------------EIWNM 168
           V+ P D+++TR        +     A  + +H  K                     ++  
Sbjct: 69  VTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYKR 128

Query: 169 EGIPGFFRGCTASMFTITLSASILFGTYESIK-IYCDEYSKESDYTNYLRYSASSISGVT 227
           EG    F+G   ++  +  + SI F TY + K IY   ++   + T  +   +++ +G  
Sbjct: 129 EGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNGQE-TPLIHLMSAATAGWA 187

Query: 228 SKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSL 287
           +   T P+  I+ R+Q+  +                + YK +        +L+ EG+  L
Sbjct: 188 TSTATNPIWMIKTRVQLDKAGTT-------------RKYKNSWDCLK--TVLKSEGIYGL 232

Query: 288 YQGVSMS 294
           Y+G+S S
Sbjct: 233 YRGLSAS 239

>Kwal_26.7967
          Length = 297

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 66/308 (21%), Positives = 130/308 (42%), Gaps = 44/308 (14%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQL--RPSYTGQAPSGLL---KMMKGMILNEGGL 78
            S +AGS++G +  ++  P +  K RLQL  + S   + P  L+     ++G+     G 
Sbjct: 11  HSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKVQGLGAVYVGC 70

Query: 79  RSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGE--TSDMNGQLQSLVVGALAGMTSSFV 136
            +F  GN           G +F  +    N+  +  T +++G  + +V G  AG+  S V
Sbjct: 71  PAFIVGNTA-------KAGVRFLGFDAIKNILRDPTTGELSGP-RGIVAGLGAGLLESVV 122

Query: 137 SY-PTDVLRTRFIANQDVALSSLSHGCKEIWNM-------EGIPGFFRGCTASMFTITLS 188
           +  P + ++T  I ++  A     +  + +          +G  G +RG          +
Sbjct: 123 AVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAAN 182

Query: 189 ASILFGTYESIKIYCDEY---SKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVR 245
            ++  G Y  IK    +Y   +K+   ++ + +   + SG+ +   T P+DT++ R+Q  
Sbjct: 183 QAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQSL 242

Query: 246 NSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVS 305
           +                  S K +S I     + R+EGL + ++G +  L + + S  + 
Sbjct: 243 D------------------SSKYSSTINCFATVFREEGLKTFWKGATPRLGRLILSGGIV 284

Query: 306 LWAYETVM 313
              YE V+
Sbjct: 285 FTIYEKVL 292

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 6/94 (6%)

Query: 12  DHLRKGEDVKVSQ--SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMK 69
           D+    +D  +S   + V G+ SG++      P+DT+K R+Q   S      S  +    
Sbjct: 199 DYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQ---SLDSSKYSSTINCF- 254

Query: 70  GMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSY 103
             +  E GL++FWKG  P     +L GG  F+ Y
Sbjct: 255 ATVFREEGLKTFWKGATPRLGRLILSGGIVFTIY 288

 Score = 31.6 bits (70), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 120 LQSLVVGALAGMTSSFVSYPTDVLRTR--FIANQDVALSSLSHGCKEIWNMEGIPGFFRG 177
           L S + G+LAG   + ++YP +  +TR   +     A  +          ++G+   + G
Sbjct: 10  LHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKVQGLGAVYVG 69

Query: 178 CTASMFTITLSASILFGTYESIK 200
           C A +   T  A + F  +++IK
Sbjct: 70  CPAFIVGNTAKAGVRFLGFDAIK 92

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 68/311 (21%), Positives = 126/311 (40%), Gaps = 44/311 (14%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP-----------SGLLKMMKGMILN 74
             AG+++G+    V+ PLD +K R+QL+ +  G              +G++  +  ++  
Sbjct: 15  FTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKK 74

Query: 75  EGGLRSFWKGNVPGTMMYVLYGGAQFSS----YSFYNNLFGETSDMNGQLQSLVVGALAG 130
           E G    +KG     +M       +FS      +FY  +F   +    Q  ++  GA AG
Sbjct: 75  E-GFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAIYSGASAG 133

Query: 131 MTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWN---MEGIPGFFRGCTASMFTITL 187
              +FV  P ++++ R    QDV  S      + + N     G+   F G  A+++   L
Sbjct: 134 AVEAFVVAPFELVKIRL---QDVN-SQFKTPIEVVKNSVVKGGVLSLFNGLEATIWRHVL 189

Query: 188 SASILFGTYESIK--IYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVR 245
             +  FG    I+  +   + S E    + +   A +I G    ++  P D ++ RIQ  
Sbjct: 190 WNAGYFGIIFQIRKLLPAAKTSTEKTRNDLI---AGAIGGTVGCLLNTPFDVVKSRIQRS 246

Query: 246 NSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVS 305
           +    ++N     V  +Y                R+EG  +LY+G +  + +  P   + 
Sbjct: 247 SGPLRKYNWSLPSVLLVY----------------REEGFKALYKGFAPKVMRLAPGGGLL 290

Query: 306 LWAYETVMRLY 316
           L  +  VM  +
Sbjct: 291 LVVFTNVMDFF 301

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 47/100 (47%), Gaps = 4/100 (4%)

Query: 217 RYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGL 276
           +++A +I+GV+  +V YPLD ++ R+Q++  V  + +            Y G   +    
Sbjct: 14  QFTAGAIAGVSELLVMYPLDVVKTRMQLQ--VTTKGHPAVVAAKAAVDHYTGV--MDCLT 69

Query: 277 NILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
            I+++EG   LY+G++  +    P   +     +T    Y
Sbjct: 70  KIVKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFY 109

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 59/123 (47%), Gaps = 6/123 (4%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKG 84
           ++ +G+ +G +   V+AP + +KIRLQ   S   + P   ++++K  ++ +GG+ S + G
Sbjct: 125 AIYSGASAGAVEAFVVAPFELVKIRLQDVNSQF-KTP---IEVVKNSVV-KGGVLSLFNG 179

Query: 85  NVPGTMMYVLYGGAQFS-SYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVL 143
                  +VL+    F   +     L    +        L+ GA+ G     ++ P DV+
Sbjct: 180 LEATIWRHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVV 239

Query: 144 RTR 146
           ++R
Sbjct: 240 KSR 242

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 41/97 (42%), Gaps = 12/97 (12%)

Query: 21  KVSQSLVAGSVSGLLARTVIAPLDTLKIRLQ-----LRPSYTGQAPSGLLKMMKGMILNE 75
           K    L+AG++ G +   +  P D +K R+Q     LR  Y    PS LL      +  E
Sbjct: 214 KTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQRSSGPLR-KYNWSLPSVLL------VYRE 266

Query: 76  GGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGE 112
            G ++ +KG  P  M     GG     ++   + F E
Sbjct: 267 EGFKALYKGFAPKVMRLAPGGGLLLVVFTNVMDFFRE 303

>Kwal_56.23011
          Length = 303

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 68/313 (21%), Positives = 126/313 (40%), Gaps = 32/313 (10%)

Query: 12  DHLRKGEDVKVS-QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKG 70
           D L    D K + + +  G+V G+    V  P D  K+RLQ  P      P+   +++K 
Sbjct: 12  DDLVDTHDFKQALKDVFCGTVGGVAQVLVGQPFDITKVRLQTSP-----VPTTAAQVIKS 66

Query: 71  MILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSL----VVG 126
           ++ NE GL +F+KG +            QF         F +      Q  +L      G
Sbjct: 67  LVKNE-GLLAFYKGTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNFDQPLALRQYYACG 125

Query: 127 ALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHG---CKEIWNMEGIPGFFRGCTASMF 183
            ++G  ++F++ P + +R R       + ++  HG   C      +G     RG TA+  
Sbjct: 126 FVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLKQG--ALMRGFTATTL 183

Query: 184 TITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSA-SSISGVTSKMVTYPLDTIRRRI 242
             +    I F TYE++      +    +     +     + SG     +TYP D ++  +
Sbjct: 184 RTSHGFGIYFLTYETLIANQAHHGVLRENIPAWKVCVYGAFSGAFFWAMTYPFDVVKSVM 243

Query: 243 QVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPST 302
           Q            +K+   +Y    G + + +   I R+ G  +  +G + ++ +++P  
Sbjct: 244 QA-----------DKLKNPVY----GRNPLAVAKAIYRERGPRAFTKGFTPTMLRSLPVN 288

Query: 303 VVSLWAYETVMRL 315
             +  A+E  MRL
Sbjct: 289 GATFAAFEITMRL 301

>Scas_589.10
          Length = 316

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 62/306 (20%), Positives = 128/306 (41%), Gaps = 32/306 (10%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMK----------GMILNE 75
            ++G+V+G+    ++ PLD +K R QL+ +    A S +    +            IL E
Sbjct: 17  FISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKE 76

Query: 76  GGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMN--GQLQSLVVGALAGMTS 133
            G ++ +KG  P  +M V     +F+S   +  +  +   +       +L+ G  AG+T 
Sbjct: 77  EGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTLLAGTFAGITE 136

Query: 134 SFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILF 193
           S +  P ++++ R    Q    S +    + I   +G+ G + G  ++++  T+  +  F
Sbjct: 137 SLIVVPFELVKIRLQDAQSDYRSPI-RCTRTIIENQGLFGIYAGFESTIWRNTIWNASYF 195

Query: 194 GTYESIKIYCDEYSKESDYTNYLR-YSASSISGVTSKMVTYPLDTIRRRIQ--VRNSVYV 250
           G    +K +       + +      +   +I+G  S  ++ P D ++ R+Q   + S  +
Sbjct: 196 GLIFQVKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTRMQGSKKTSSGM 255

Query: 251 QHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
            +    + V  IY                R EG+  +Y+G+   +C+  P   + L  + 
Sbjct: 256 CYGWAWQSVFLIY----------------RTEGIKGIYKGILPIICRYGPGGGLLLVVFN 299

Query: 311 TVMRLY 316
            V  L+
Sbjct: 300 GVNELF 305

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 83/174 (47%), Gaps = 22/174 (12%)

Query: 16  KGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNE 75
           K ++V  + +L+AG+ +G+    ++ P + +KIRLQ   S   ++P   ++  + +I N+
Sbjct: 116 KLKEVTSTVTLLAGTFAGITESLIVVPFELVKIRLQDAQS-DYRSP---IRCTRTIIENQ 171

Query: 76  G------GLRS-FWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGAL 128
           G      G  S  W+     T+    Y G  F    F       T+   G     +VGA+
Sbjct: 172 GLFGIYAGFESTIWRN----TIWNASYFGLIFQVKKFIPRA-KSTTKFQGIRNDFLVGAI 226

Query: 129 AGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKE-----IWNMEGIPGFFRG 177
           AG  S F+S P DV++TR   ++  + S + +G        I+  EGI G ++G
Sbjct: 227 AGCMSCFLSVPFDVVKTRMQGSKKTS-SGMCYGWAWQSVFLIYRTEGIKGIYKG 279

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/99 (21%), Positives = 49/99 (49%), Gaps = 4/99 (4%)

Query: 217 RYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGL 276
           ++ + +++G++  ++ YPLD ++ R Q++    +           + +  + +S +    
Sbjct: 16  QFISGAVAGMSETIMMYPLDVVKTRFQLQ----INKKALATSSVAVPKQPEHSSILSCLS 71

Query: 277 NILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
            IL++EG  +LY+G+S  L   VP   V   + E   ++
Sbjct: 72  KILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQI 110

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/299 (21%), Positives = 128/299 (42%), Gaps = 34/299 (11%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGM--ILNEGGLRSFWK 83
            V+G  SG+    V  P DT+K+RLQ     T Q  +     +  +     + G+R F+ 
Sbjct: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQ-----TSQDSTRFKGPLDCVYKTFTQQGIRGFYL 118

Query: 84  GNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSL----VVGALAGMTSSFVSYP 139
           G  P  + ++L           Y  L  +    N +   L    + G +AG + SF++ P
Sbjct: 119 GFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAP 178

Query: 140 TDVLRTRFIANQDVALSSLSHGC---KEIWNMEGIPGFFRGCTASMFTITLSASILFGTY 196
            ++ + +     D   +  +      K++++  G+ G ++G T+++   T +    +G+Y
Sbjct: 179 VELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRT-NFVFWWGSY 237

Query: 197 ESIKIYCDEYSKESDYT-NYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVE 255
           E +  +  E++  SD   N+     S+  G  +    YP D I++ +           + 
Sbjct: 238 ELLTRWFKEHTNMSDTAINFWSGGFSASFGFWT--TAYPSDVIKQVV-----------LC 284

Query: 256 NKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMR 314
           N      ++S+K A+      +I R  G    ++G   S  ++ P+   +L A+E V+R
Sbjct: 285 NDKYDGTFRSWKLAA-----KDIWRTRGYRGFFKGFVPSFLRSFPANAAALAAFEFVLR 338

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 76/322 (23%), Positives = 129/322 (40%), Gaps = 64/322 (19%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGN 85
           L+ G   GL +   + PLD LK R Q       Q   G L      +     L   W+G 
Sbjct: 8   LIGGFAGGLSSAVALQPLDLLKTRFQ-------QTKGGTLWQTVKSLDTPWQL---WRGT 57

Query: 86  VP-------GTMMYV---------LYGGAQFSSYSFYNNLFGETSDMNGQL---QSLVVG 126
           +P       G+ +Y+         L    QF +    + + G++S++  QL   ++LV G
Sbjct: 58  LPSAIRTSVGSALYLSSLNLMRTALAKRKQFDTAD--SVVTGKSSNLP-QLSMYENLVTG 114

Query: 127 ALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTIT 186
           A A  T  +++ P  +++ R+  +      S++   K I   EGI GFFRG   +     
Sbjct: 115 AFARGTVGYITMPITIIKVRY-ESTLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDA 173

Query: 187 LSASILFGTYESIKIYCD--------EYSKESDYTNYLRYSASSISGVTSK----MVTYP 234
             + +    YE +K            +   E  YT Y   + +S S + S      VT P
Sbjct: 174 PYSGLYVLLYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAP 233

Query: 235 LDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMS 294
            DTI+ R+Q+  +                   K  +F      I+ QE  + ++ G+SM 
Sbjct: 234 FDTIKTRMQLEPT-------------------KFKTFWSTLTTIVTQEHPIKIFSGLSMR 274

Query: 295 LCKTVPSTVVSLWAYETVMRLY 316
           L +   S  ++   YE +++ +
Sbjct: 275 LTRKALSAGIAWGIYEELIKHF 296

>Scas_602.8
          Length = 885

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 91/196 (46%), Gaps = 20/196 (10%)

Query: 15  RKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYT-GQAPSGLLKMMKGMIL 73
           +KG ++++   +++G+ +G        PL+ +KIRLQ++  YT    P   L   +  I+
Sbjct: 586 KKG-NLQLGAEVLSGATAGACQVVFTNPLEIVKIRLQVKSEYTNAMIPKSQLTAFQ--II 642

Query: 74  NEGGLRSFWKGNVPGTMMYVLYGGAQFSSYS-FYNNLF---GETSDMNGQLQS---LVVG 126
            E  L   +KG     +  V +    F +Y+    N+F       D   +L++   L  G
Sbjct: 643 KELKLIGLYKGVGACLLRDVPFSAIYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAG 702

Query: 127 ALAGMTSSFVSYPTDVLRTRFIANQDVA---LSSLSHGCKEIWNMEGIPGFFRGCTASM- 182
           ALAG+ ++F++ P DV++TR      V     + + H  + I   E    FF+G  A + 
Sbjct: 703 ALAGVPAAFLTTPFDVIKTRLQIEPGVGETRYTGILHAVRTILKEESFRSFFKGGAARVM 762

Query: 183 -----FTITLSASILF 193
                F  TL+A  LF
Sbjct: 763 RSSPQFGFTLAAYELF 778

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 70/305 (22%), Positives = 127/305 (41%), Gaps = 44/305 (14%)

Query: 29  GSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPS--GLLKMMKGMILNEGGLRSFWKGNV 86
           GSV+G +  T++ P+D +K R+Q + S T    S   L+K     I  + G+R  + G  
Sbjct: 505 GSVAGCIGATLVYPIDFIKTRMQAQRSLTKYKNSIDCLVK-----IFGKEGIRGLYSGLG 559

Query: 87  PGTMMYVLYGGAQFSSYSFYNNLFGETS--DMNGQLQ---SLVVGALAGMTSSFVSYPTD 141
           P      L G A   +     N F   S  D  G LQ    ++ GA AG      + P +
Sbjct: 560 PQ-----LIGVAPEKAIKLTVNDFMRKSLVDKKGNLQLGAEVLSGATAGACQVVFTNPLE 614

Query: 142 VLRTRF-----IANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTY 196
           +++ R        N  +  S L+    +I     + G ++G  A +      ++I F TY
Sbjct: 615 IVKIRLQVKSEYTNAMIPKSQLT--AFQIIKELKLIGLYKGVGACLLRDVPFSAIYFPTY 672

Query: 197 ESIKIYCDEYS-KESDYTNYLR----YSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQ 251
             +K    ++   + D  + L+     +A +++GV +  +T P D I+ R+Q+   V   
Sbjct: 673 AHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPGV--- 729

Query: 252 HNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYET 311
                          +    +     IL++E   S ++G +  + ++ P    +L AYE 
Sbjct: 730 ------------GETRYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYEL 777

Query: 312 VMRLY 316
              ++
Sbjct: 778 FKNMF 782

 Score = 53.5 bits (127), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 53/108 (49%), Gaps = 1/108 (0%)

Query: 8   QHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKM 67
           Q + +   K + +K  + L AG+++G+ A  +  P D +K RLQ+ P       +G+L  
Sbjct: 681 QFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGETRYTGILHA 740

Query: 68  MKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSD 115
           ++  IL E   RSF+KG     M      G   ++Y  + N+F  + D
Sbjct: 741 VR-TILKEESFRSFFKGGAARVMRSSPQFGFTLAAYELFKNMFNISDD 787

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 88/197 (44%), Gaps = 30/197 (15%)

Query: 125 VGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGC-KEIWNMEGIPGFFRGCTASMF 183
           +G++AG   + + YP D ++TR  A + +     S  C  +I+  EGI G + G    + 
Sbjct: 504 LGSVAGCIGATLVYPIDFIKTRMQAQRSLTKYKNSIDCLVKIFGKEGIRGLYSGLGPQLI 563

Query: 184 TITLSASILFGTYESIKIYCDEYSKES--DYTNYLRYSASSISGVTSK----MVTYPLDT 237
            +           ++IK+  +++ ++S  D    L+  A  +SG T+     + T PL+ 
Sbjct: 564 GV--------APEKAIKLTVNDFMRKSLVDKKGNLQLGAEVLSGATAGACQVVFTNPLEI 615

Query: 238 IRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCK 297
           ++ R+QV+ S Y    +    +T                 I+++  L+ LY+GV   L +
Sbjct: 616 VKIRLQVK-SEYTNAMIPKSQLT--------------AFQIIKELKLIGLYKGVGACLLR 660

Query: 298 TVPSTVVSLWAYETVMR 314
            VP + +    Y  + +
Sbjct: 661 DVPFSAIYFPTYAHLKK 677

 Score = 35.4 bits (80), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 43/108 (39%), Gaps = 26/108 (24%)

Query: 208 KESDYTNY---------LRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKI 258
           KES Y NY           +S  S++G     + YP+D I+ R+Q + S+          
Sbjct: 483 KESLYRNYYFYPIFDSIFNFSLGSVAGCIGATLVYPIDFIKTRMQAQRSL---------- 532

Query: 259 VTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSL 306
                  YK +  I   + I  +EG+  LY G+   L    P   + L
Sbjct: 533 -----TKYKNS--IDCLVKIFGKEGIRGLYSGLGPQLIGVAPEKAIKL 573

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 123/297 (41%), Gaps = 30/297 (10%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGN 85
            VAG  SG+    V  P DT+K+RLQ   + T     G L  +     N+ G+R F+ G 
Sbjct: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNET--RFKGPLDCVYKTFRNQ-GIRGFYLGF 83

Query: 86  VPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSL----VVGALAGMTSSFVSYPTD 141
            P  + ++L           Y  L  +    N +   L    + G LAG + SF++ P +
Sbjct: 84  TPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIE 143

Query: 142 VLRTRFIANQDVALSSLSHG---CKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYES 198
           + + +     D   +         K+I++ +GI G ++G  +++   T      +G+YE 
Sbjct: 144 LAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRT-HFVYWWGSYEL 202

Query: 199 IKIYCDEYSKESDYTNYLRYSASSISGVTSKMVT-YPLDTIRRRIQVRNSVYVQHNVENK 257
           +  +  E +K S+    + + A   S       T YP D +++ +   +           
Sbjct: 203 LTRWFRENTKMSEAA--INFWAGGFSASFGFWTTAYPSDVVKQVVLCNDKYDGSFKSWRT 260

Query: 258 IVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMR 314
            V +IYQS                +G+   ++G   S  ++ P+   +L A+E V+R
Sbjct: 261 AVKDIYQS----------------KGINGFFKGFVPSFLRSFPANAAALAAFEFVLR 301

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 82/171 (47%), Gaps = 11/171 (6%)

Query: 18  EDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGG 77
           E + +S  +++G ++G     +  P++  K +LQ++   T     G L ++K  I +  G
Sbjct: 117 EKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIK-KIYSAQG 175

Query: 78  LRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSF-- 135
           +R  +KG +  T+++  +    + SY      F E + M+    +   G   G ++SF  
Sbjct: 176 IRGLYKGLI-STLIFRTHFVYWWGSYELLTRWFRENTKMSEAAINFWAG---GFSASFGF 231

Query: 136 --VSYPTDVLRTRFIANQ--DVALSSLSHGCKEIWNMEGIPGFFRGCTASM 182
              +YP+DV++   + N   D +  S     K+I+  +GI GFF+G   S 
Sbjct: 232 WTTAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSF 282

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/308 (21%), Positives = 127/308 (41%), Gaps = 34/308 (11%)

Query: 19  DVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGL 78
           DV    S +AGS++G     +  P +  K RLQL    +  + + L+ + K       G+
Sbjct: 9   DVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYK--TAKTQGI 66

Query: 79  RSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF--GETSDMNGQLQSLVVGALAGMTSSFV 136
            S + G     +      G +F  +    ++    ET +++G  + ++ G  AG+  S  
Sbjct: 67  GSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRDSETGELSGT-RGVIAGLGAGLLESVA 125

Query: 137 SY-PTDVLRTRFIANQDVALSSLSHGCK-------EIWNMEGIPGFFRGCTASMFTITLS 188
           +  P + ++T  I ++  A     +  +        +   +G  G +RG          +
Sbjct: 126 AVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAAN 185

Query: 189 ASILFGTYESIKIYCDEYS---KESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVR 245
            ++  G Y  IK    +Y+   K+   ++ L +   + SG+ +   T PLDT++ R+Q  
Sbjct: 186 QAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQSL 245

Query: 246 NSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVS 305
           +S                   K +S +     I ++EGL + ++G +  L + V S  + 
Sbjct: 246 DST------------------KYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIV 287

Query: 306 LWAYETVM 313
              YE V+
Sbjct: 288 FTIYEKVL 295

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 90/201 (44%), Gaps = 15/201 (7%)

Query: 12  DHLRKGEDVKVS--QSLVAGSVSGLLAR-TVIAPLDTLKIRL-----QLRPSYTGQAPSG 63
           D LR  E  ++S  + ++AG  +GLL     + P + +K  L        P Y      G
Sbjct: 96  DMLRDSETGELSGTRGVIAGLGAGLLESVAAVTPFEAIKTALIDDKQSATPKYHNNG-RG 154

Query: 64  LLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSD--MNGQLQ 121
           +++    ++ ++G     ++G +P +M        +   Y+    L  + +D   +  L 
Sbjct: 155 VVRNYSSLVRDKG-FSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLS 213

Query: 122 S---LVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGC 178
           S    +VGA +G+ + + + P D ++TR  +      SS  +    I+  EG+  F++G 
Sbjct: 214 SGLTFLVGAFSGIVTVYSTMPLDTVKTRMQSLDSTKYSSTMNCFATIFKEEGLKTFWKGA 273

Query: 179 TASMFTITLSASILFGTYESI 199
           T  +  + LS  I+F  YE +
Sbjct: 274 TPRLGRLVLSGGIVFTIYEKV 294

 Score = 35.4 bits (80), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 91/211 (43%), Gaps = 28/211 (13%)

Query: 114 SDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNM---EG 170
           SD++  L S + G+LAG   + ++YP +  +TR +   D A  +  +    I+     +G
Sbjct: 8   SDVD-PLHSFLAGSLAGAAEACITYPFEFAKTR-LQLIDKASKASRNPLVLIYKTAKTQG 65

Query: 171 IPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKM 230
           I   + GC A +   T  A I F  +++IK    +  ++S+ T  L  +   I+G+ + +
Sbjct: 66  IGSIYVGCPAFIIGNTAKAGIRFLGFDTIK----DMLRDSE-TGELSGTRGVIAGLGAGL 120

Query: 231 V-----TYPLDTIRRR-IQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGL 284
           +       P + I+   I  + S   +++   + V   Y S            ++R +G 
Sbjct: 121 LESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSS------------LVRDKGF 168

Query: 285 LSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
             LY+GV     +   +  V L  Y  +  L
Sbjct: 169 SGLYRGVLPVSMRQAANQAVRLGCYNKIKTL 199

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 91/191 (47%), Gaps = 31/191 (16%)

Query: 129 AGMTSSFVSYPTDVLRTRFIANQDVA-LSSLSHGCKEIWNMEGIPGFFRGCTASMFTITL 187
           +G+ ++ ++ P  V++TR +A        S   G  +++  EG+  F+RG   S+  ++ 
Sbjct: 123 SGIATAVLTNPIWVIKTRIMATSRAGPYKSTFDGVYKLYQTEGVLAFWRGVVPSLLGVSQ 182

Query: 188 SASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVT--SKMVT----YPLDTIRRR 241
            A I F  Y+++K +   Y   S      R S S I G+T  SKM++    YP   ++ +
Sbjct: 183 GA-IYFALYDTLKFH---YLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPFQLLKSK 238

Query: 242 IQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPS 301
           +Q   +           +T++ Q+            +  +EG+   Y+G+S +L + VP+
Sbjct: 239 LQDFGA--------PSGITQLVQT------------VYSREGIRGFYRGLSANLLRAVPA 278

Query: 302 TVVSLWAYETV 312
           T ++ + YE +
Sbjct: 279 TCITFFVYENI 289

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 89/181 (49%), Gaps = 14/181 (7%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGN 85
           L AGS SG+    +  P+  +K R+ +  S  G   S    + K  +    G+ +FW+G 
Sbjct: 118 LAAGS-SGIATAVLTNPIWVIKTRI-MATSRAGPYKSTFDGVYK--LYQTEGVLAFWRGV 173

Query: 86  VPGTMMYVLYGGAQFSSYSF--YNNLFGETSDMNGQLQ-SLVVG--ALAGMTSSFVSYPT 140
           VP +++ V  G   F+ Y    ++ L   T     +L  S ++G   ++ M S    YP 
Sbjct: 174 VP-SLLGVSQGAIYFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPF 232

Query: 141 DVLRTRFIANQDV-ALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESI 199
            +L+++    QD  A S ++   + +++ EGI GF+RG +A++     +  I F  YE+I
Sbjct: 233 QLLKSKL---QDFGAPSGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYENI 289

Query: 200 K 200
           K
Sbjct: 290 K 290

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 93/208 (44%), Gaps = 35/208 (16%)

Query: 115 DMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGF 174
           D +  L SL  GA AG ++    +P D L+TR  A         ++G        G  G 
Sbjct: 2   DSSSFLVSLASGAAAGTSTDLAFFPIDTLKTRLQAKGGF----FANG--------GYKGV 49

Query: 175 FRGCTASMFTITLSASILFGTYESIKIYCDEY-SKESDYTNYLRYS-----ASSISGVTS 228
           +RG  +++     SAS+ F +Y+S+K+Y     SK     N +  +     +SSI  V++
Sbjct: 50  YRGLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSIGEVSA 109

Query: 229 KMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLY 288
            +V  P + I++R Q   +     N   +  T+I Q+  G   +R            +LY
Sbjct: 110 CLVRVPAEVIKQRTQTHKT-----NSSWQTFTKILQNENGEGVLR------------NLY 152

Query: 289 QGVSMSLCKTVPSTVVSLWAYETVMRLY 316
           +G + ++ + +P T +    YE + + +
Sbjct: 153 RGWNTTIMREIPFTCIQFPLYEFLKKTW 180

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 59/307 (19%), Positives = 106/307 (34%), Gaps = 65/307 (21%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKG 84
           SL +G+ +G        P+DTLK RLQ                 KG     GG +  ++G
Sbjct: 9   SLASGAAAGTSTDLAFFPIDTLKTRLQ----------------AKGGFFANGGYKGVYRG 52

Query: 85  -------NVP-GTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFV 136
                  + P  ++ +V Y   +  S    +      + M   L  +   ++  +++  V
Sbjct: 53  LGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSIGEVSACLV 112

Query: 137 SYPTDVLRTRFIANQDVALSSLSHGCKEIW----------NMEGI-PGFFRGCTASMFTI 185
             P +V++ R          + +H     W          N EG+    +RG   ++   
Sbjct: 113 RVPAEVIKQR----------TQTHKTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMRE 162

Query: 186 TLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVR 245
                I F  YE +K    + + +     +      S++G  +   T PLD ++ R+ + 
Sbjct: 163 IPFTCIQFPLYEFLKKTWAKRNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRLML- 221

Query: 246 NSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVS 305
                              S+K     ++  NI  +EG    + GV            + 
Sbjct: 222 -------------------SHKSIPVAQLAKNIYAEEGFKVFFSGVGPRTMWISAGGAIF 262

Query: 306 LWAYETV 312
           L  YETV
Sbjct: 263 LGVYETV 269

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 43/87 (49%), Gaps = 8/87 (9%)

Query: 15  RKGED-VKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMIL 73
           R G+D V   Q  V GSV+G +A     PLD LK RL L  S+     + L K     I 
Sbjct: 183 RNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRLML--SHKSIPVAQLAK----NIY 236

Query: 74  NEGGLRSFWKGNVPGTMMYVLYGGAQF 100
            E G + F+ G  P T M++  GGA F
Sbjct: 237 AEEGFKVFFSGVGPRT-MWISAGGAIF 262

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 125/310 (40%), Gaps = 68/310 (21%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGN 85
           L+  + +G++   V  P+DT+  RL           S   K+  G  LN    R  +   
Sbjct: 14  LLGSASAGIMEIAVFHPVDTISKRLM----------SNHTKITSGQELNRVIFRDHFSEP 63

Query: 86  VPGTMMYVL------------------YGGAQFSSYSF-------YNNLFGETSDMNGQL 120
           + G  ++ L                  YGG  F++          ++NLFGE +     +
Sbjct: 64  L-GKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGK--AM 120

Query: 121 QSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTA 180
           +S   G+L G+    V  P DVL+ +   N +   S    G  +I   EG+   +RG   
Sbjct: 121 RSAAAGSLIGI-GEIVLLPLDVLKIKRQTNPE---SFKGRGFIKILRDEGLFNLYRGWGW 176

Query: 181 SMFTITLSASILFGTYESIKIYC---DEYSKESDYTNYLRYSASSISGVTSKM-VTYPLD 236
           +       +  LFG     K Y     +YS+ +   N++    SSI G  S + V+ PLD
Sbjct: 177 TAARNAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFI----SSIVGACSSLIVSAPLD 232

Query: 237 TIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLC 296
            I+ RIQ RN      N E              S +R+  N L+ EG+ + ++G++  L 
Sbjct: 233 VIKTRIQNRNF----DNPE--------------SGLRIVKNTLKNEGVTAFFKGLTPKLL 274

Query: 297 KTVPSTVVSL 306
            T P  V S 
Sbjct: 275 TTGPKLVFSF 284

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 4/65 (6%)

Query: 23  SQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFW 82
           SQ+ ++  V    +  V APLD +K R+Q R       P   L+++K  + NE G+ +F+
Sbjct: 211 SQNFISSIVGACSSLIVSAPLDVIKTRIQNR---NFDNPESGLRIVKNTLKNE-GVTAFF 266

Query: 83  KGNVP 87
           KG  P
Sbjct: 267 KGLTP 271

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 64/310 (20%), Positives = 128/310 (41%), Gaps = 43/310 (13%)

Query: 18  EDV-KVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEG 76
           ED  K  + L+ G V+G L + V  P DT+K+RLQ + +     P+     +      EG
Sbjct: 3   EDADKAYKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQSA--ALFPT-TWSCVSHTYKQEG 59

Query: 77  GLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLV-VGALAGMTSSF 135
             R F++G         L     F S++    +  E     G L+ +V  GA+AG  +S+
Sbjct: 60  LWRGFYQGMASPVFGAFLEHAVLFVSFNRAQAVL-ENCYSCGPLEKVVFAGAIAGACTSY 118

Query: 136 VSYPTDVLRTRFIANQDVALSSLSHGC-----KEIWNMEGIPGFFRGCTASMFTITLSAS 190
           V  P ++++ +   +    +S   +       + I    G+ G ++G + +    +   +
Sbjct: 119 VLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGGA 178

Query: 191 ILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYV 250
           + F  YE +K +       ++ T +   ++ + +G       +P DT++  +Q  +    
Sbjct: 179 VWFTAYEVLKGWLARRRGSTENTVWELLASGAGAGAAFHASIFPADTVKSTMQTEH---- 234

Query: 251 QHNVENKIVTEIYQSYKGASFIRMGL-----NILRQEGLLSLYQGVSMSLCKTVPSTVVS 305
                                  +GL      +L++ G    Y+GV ++L + +P+  V 
Sbjct: 235 -----------------------LGLGPAVRTVLKKHGPTGFYRGVGITLLRALPANAVI 271

Query: 306 LWAYETVMRL 315
            + YE++  L
Sbjct: 272 FYVYESLCGL 281

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 85/202 (42%), Gaps = 18/202 (8%)

Query: 113 TSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGC-KEIWNMEGI 171
           + D +   + L+ G +AG     V YP D ++ R +  Q  AL   +  C    +  EG+
Sbjct: 2   SEDADKAYKDLLYGGVAGSLGKLVEYPFDTVKVR-LQTQSAALFPTTWSCVSHTYKQEGL 60

Query: 172 -PGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKM 230
             GF++G  + +F   L  ++LF ++   +   +           +   A +I+G  +  
Sbjct: 61  WRGFYQGMASPVFGAFLEHAVLFVSFNRAQAVLENCYSCGPLEKVV--FAGAIAGACTSY 118

Query: 231 VTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQG 290
           V  P++ ++ ++QV N       V     T +  + +          I++Q GL  L+QG
Sbjct: 119 VLTPVELVKCKLQVSNLT----GVSGPRYTAVLPTLRA---------IVKQNGLGGLWQG 165

Query: 291 VSMSLCKTVPSTVVSLWAYETV 312
            S +  +      V   AYE +
Sbjct: 166 QSGTFIRESAGGAVWFTAYEVL 187

>Kwal_33.15446
          Length = 305

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 69/302 (22%), Positives = 129/302 (42%), Gaps = 38/302 (12%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGN 85
            V+G  SG+    V  P DT+K+RLQ     TG+    L  + + M   + G+R F+ G 
Sbjct: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQD-TGRFKGPLDCVYQTM--RQQGIRGFYLGF 78

Query: 86  VPGTMMYVLYGGAQFSSYSFYNNLFG-------ETSDMNGQLQSLVVGALAGMTSSFVSY 138
            P  + ++L           Y  L         E   ++G + S   G LAG + SF++ 
Sbjct: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILS---GVLAGWSVSFIAA 135

Query: 139 PTDVLRTRFIANQDVALSSLSHG----CKEIWNMEGIPGFFRGCTASMFTITLSASILFG 194
           P ++ + +     D A ++   G     K+++  +GI G ++G  +++   T      +G
Sbjct: 136 PVELAKAKLQVQYD-AQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRT-HFVYWWG 193

Query: 195 TYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVT-YPLDTIRRRIQVRNSVYVQHN 253
           +YE +  +    +  SD    + + A   S       T YP D I++ I           
Sbjct: 194 SYELLTRWFKANTNLSD--TAINFWAGGFSASFGFWTTAYPSDVIKQVI----------- 240

Query: 254 VENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVM 313
           + N       +S++ A+      +I R  G+   ++G   S  ++ P+   +L ++E V+
Sbjct: 241 LCNDKYDGSLRSWRNAA-----SDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVL 295

Query: 314 RL 315
           R+
Sbjct: 296 RV 297

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 87/188 (46%), Gaps = 11/188 (5%)

Query: 18  EDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGG 77
           E + +S  +++G ++G     + AP++  K +LQ++         G L ++K  +    G
Sbjct: 112 EKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIK-KVYAADG 170

Query: 78  LRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSF-- 135
           +R  +KG V  T+++  +    + SY      F   ++++    +   G   G ++SF  
Sbjct: 171 IRGMYKGLV-STLIFRTHFVYWWGSYELLTRWFKANTNLSDTAINFWAG---GFSASFGF 226

Query: 136 --VSYPTDVLRTRFIANQ--DVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASI 191
              +YP+DV++   + N   D +L S  +   +IW   GI GFF+G   S      + + 
Sbjct: 227 WTTAYPSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAA 286

Query: 192 LFGTYESI 199
              ++E +
Sbjct: 287 ALASFEFV 294

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 58/132 (43%), Gaps = 7/132 (5%)

Query: 119 QLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGC-KEIWNMEGIPGFFRG 177
           ++   V G  +G+  + V +P D ++ R   +QD         C  +    +GI GF+ G
Sbjct: 18  RMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLG 77

Query: 178 CTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTS----KMVTY 233
            T  +    L  S++ G   + ++   +Y  + +    L  S   +SGV +      +  
Sbjct: 78  FTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHE--EKLPLSGCILSGVLAGWSVSFIAA 135

Query: 234 PLDTIRRRIQVR 245
           P++  + ++QV+
Sbjct: 136 PVELAKAKLQVQ 147

>Scas_715.45
          Length = 305

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 91/205 (44%), Gaps = 19/205 (9%)

Query: 11  TDHLRKGEDV----KVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLR-PSYTGQAPSGLL 65
           + HL K E      + S  L++ + +   A  ++ P + +K++ Q   P +      G  
Sbjct: 100 STHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWK 159

Query: 66  KMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSY-----SFYNNLFGETSDMNGQL 120
           KM       + GL  F+KG  P     + Y   +F+S+     + Y  L  + S+M+   
Sbjct: 160 KMYA-----KEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQ 214

Query: 121 Q---SLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRG 177
           Q   S V G +AG+  + VS+P DV+ ++ I N+     S++   K I++  G  G + G
Sbjct: 215 QISVSFVGGYMAGILCAIVSHPADVMVSK-INNERKVNESMNVALKRIYSRIGFVGLWNG 273

Query: 178 CTASMFTITLSASILFGTYESIKIY 202
               +  I    S  +  Y+S K Y
Sbjct: 274 LPVRILMIGTLTSFQWLIYDSFKAY 298

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/248 (21%), Positives = 107/248 (43%), Gaps = 24/248 (9%)

Query: 28  AGSVSGLLA----RTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWK 83
           A ++ G++A     + + PLD +K RLQ+ P+      SG+++     IL + GL   + 
Sbjct: 18  ACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQ-----ILKKEGLGKLFT 72

Query: 84  GNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQS--------LVVGALAGMTSSF 135
           G     + Y L G  ++  Y  +  L+  T  +  +  +        L+  A A   +  
Sbjct: 73  GVGATCIGYSLQGAGKYGGYELFKRLY-STHLVKDEATAYKYRTSIYLLSSATAEFFADI 131

Query: 136 VSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGT 195
           +  P + ++ +         +++  G K+++  EG+ GF++G T             F +
Sbjct: 132 MLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTS 191

Query: 196 YESI--KIYCDEYSKESDYTNYLRYSASSI----SGVTSKMVTYPLDTIRRRIQVRNSVY 249
           +E I   IY    +K+S+ +   + S S +    +G+   +V++P D +  +I     V 
Sbjct: 192 FERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVN 251

Query: 250 VQHNVENK 257
              NV  K
Sbjct: 252 ESMNVALK 259

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/191 (21%), Positives = 80/191 (41%), Gaps = 25/191 (13%)

Query: 129 AGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLS 188
            G T S V+ P D+++ R   +  +  S+ S G  +I   EG+   F G  A+    +L 
Sbjct: 27  CGPTHSSVT-PLDLIKCRLQVDPTLYRSNTS-GIIQILKKEGLGKLFTGVGATCIGYSLQ 84

Query: 189 ASILFGTYESIK-IYCDEYSKESDYTNYLRYSASSISGVTSK----MVTYPLDTIRRRIQ 243
            +  +G YE  K +Y     K+       R S   +S  T++    ++  P + I+ + Q
Sbjct: 85  GAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQ 144

Query: 244 VRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTV 303
                +  + +E          +K          +  +EGL   Y+G++   C+ +P T+
Sbjct: 145 TTMPPWCNNVIEG---------WK---------KMYAKEGLNGFYKGITPLWCRQIPYTM 186

Query: 304 VSLWAYETVMR 314
               ++E ++ 
Sbjct: 187 CKFTSFERIVE 197

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 77/339 (22%), Positives = 141/339 (41%), Gaps = 55/339 (16%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRL---QLRPSYT--GQ--APSGLLKMMKGMILNEG 76
           + +V+ S   L+    + PLD +++RL   ++ PS T  GQ   P+G +        N G
Sbjct: 13  ERMVSASAGSLVTSLFLTPLDVVRVRLHQQEMLPSCTCTGQLSKPAGKVFWQDECFANVG 72

Query: 77  ----------------------GLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETS 114
                                 GL + W+G     +M V      FS Y    +     S
Sbjct: 73  CREPAARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEALRD----NS 128

Query: 115 DMNGQL---QSLVVGALAGMTSSFVSYPTDVLRTRFIA---NQDVA-----LSSLSHGCK 163
            +  +L     LV GA A + ++    P ++LRTR  +    +D       +  L    +
Sbjct: 129 PLASRLPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMR 188

Query: 164 EIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKI-YCDEYSKESDYTNYLRY---- 218
              ++ G    F+G   +++     ++I +GTYE  K  +   ++   + +N+  +    
Sbjct: 189 HEVSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSF 248

Query: 219 SASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNI 278
           +  S+ G  + ++T+P D  + R+Q+  +   Q  V  K  T+   S    SF    LN 
Sbjct: 249 ACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGK-ATKTDDSRGMFSF----LNA 303

Query: 279 LRQ-EGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
           +R+ EG+ +LY G+   + K  PS  + +  YE   + +
Sbjct: 304 IRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELSKKFF 342

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 95/215 (44%), Gaps = 39/215 (18%)

Query: 20  VKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPS-----GLLKMMKGMILN 74
           + V+  LV G+ + +LA T IAPL+ L+ RLQ  P       +      LL+ M+  + +
Sbjct: 134 LPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEV-S 192

Query: 75  EGGLRSFWKG-------NVPGTMMYVLYGGAQFSSYSFYNNLFG--ETSDMNGQLQSLVV 125
             G R+ +KG       +VP + +Y  +G  +F    F+         S+ +  + S   
Sbjct: 193 VMGYRALFKGLEITLWRDVPFSAIY--WGTYEFCKTQFWARHAATHNASNWDHFIGSFAC 250

Query: 126 GALAGMTSSFVSYPTDVLRTRFIANQDVALSS---LSHGCK---------------EIWN 167
           G++ G  ++ +++P DV +TR      +A++S   L+ G K                I  
Sbjct: 251 GSMGGAVAALLTHPFDVGKTRM----QIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRK 306

Query: 168 MEGIPGFFRGCTASMFTITLSASILFGTYESIKIY 202
            EGI   + G    +  I  S +I+  TYE  K +
Sbjct: 307 SEGIRALYTGLLPRVMKIAPSCAIMISTYELSKKF 341

>Scas_489.4
          Length = 297

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/309 (21%), Positives = 126/309 (40%), Gaps = 46/309 (14%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEG------G 77
            S +AG+++G +  ++  P +  K RLQL    T  A    L ++      +G      G
Sbjct: 12  HSFIAGALAGAIEASITYPFEFAKTRLQLI-DKTSTASRNPLVLIYNTAKTQGTGAIYVG 70

Query: 78  LRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGE--TSDMNGQLQSLVVGALAGMTSSF 135
             +F  GN           G +F  +    N+  +  T +++G  + +V G  AG+  S 
Sbjct: 71  CPAFIVGNT-------AKAGIRFLGFDTIKNMLRDPVTGELSGP-RGVVAGLGAGLLESV 122

Query: 136 VSY-PTDVLRTRFIANQDVALSSLSHGCK-------EIWNMEGIPGFFRGCTASMFTITL 187
           V+  P + ++T  I ++        +  +        +   +GI G +RG          
Sbjct: 123 VAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQAA 182

Query: 188 SASILFGTYESIKIYCDEYS---KESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQV 244
           + ++  G Y  IK    +Y+   K+   ++ L +   + SGV +   T P+DT++ R+Q 
Sbjct: 183 NQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQS 242

Query: 245 RNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVV 304
            ++                   K  S +     I ++EGL + ++G +  L + + S  +
Sbjct: 243 LDAT------------------KYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGI 284

Query: 305 SLWAYETVM 313
               YE V+
Sbjct: 285 VFTIYENVL 293

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 89/190 (46%), Gaps = 13/190 (6%)

Query: 24  QSLVAGSVSGLLARTV-IAPLDTLKIRL-----QLRPSYTGQAPSGLLKMMKGMILNEGG 77
           + +VAG  +GLL   V + P + +K  L      L+P Y      G+L+   G ++ + G
Sbjct: 108 RGVVAGLGAGLLESVVAVTPFEAIKTALIDDKQALKPKYQNNG-RGMLRNY-GSLVRDQG 165

Query: 78  LRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQ-----SLVVGALAGMT 132
           +   ++G +P +M        +   Y+    +  + ++           + +VGA +G+ 
Sbjct: 166 IMGLYRGVLPVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVV 225

Query: 133 SSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASIL 192
           + + + P D ++TR  +      +S  +   +I+  EG+  F++G T  +  + LS  I+
Sbjct: 226 TVYTTMPIDTVKTRMQSLDATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIV 285

Query: 193 FGTYESIKIY 202
           F  YE++ ++
Sbjct: 286 FTIYENVLVF 295

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 42/201 (20%), Positives = 81/201 (40%), Gaps = 25/201 (12%)

Query: 120 LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWN---MEGIPGFFR 176
           L S + GALAG   + ++YP +  +TR       + +S  +    I+N    +G    + 
Sbjct: 11  LHSFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTAS-RNPLVLIYNTAKTQGTGAIYV 69

Query: 177 GCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISG-----VTSKMV 231
           GC A +   T  A I F  +++IK    +       T  L      ++G     + S + 
Sbjct: 70  GCPAFIVGNTAKAGIRFLGFDTIKNMLRD-----PVTGELSGPRGVVAGLGAGLLESVVA 124

Query: 232 TYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGV 291
             P + I+  +           +++K   +      G   +R   +++R +G++ LY+GV
Sbjct: 125 VTPFEAIKTAL-----------IDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGV 173

Query: 292 SMSLCKTVPSTVVSLWAYETV 312
                +   +  V L  Y  +
Sbjct: 174 LPVSMRQAANQAVRLGCYNKI 194

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 68/317 (21%), Positives = 132/317 (41%), Gaps = 44/317 (13%)

Query: 15  RKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQL--RPSYTGQAPSGLL---KMMK 69
           +  + V  ++S VAG+++G +  ++  P +  K RLQL  + S   + P  L+      +
Sbjct: 3   KDSKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTAKTQ 62

Query: 70  GMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGE--TSDMNGQLQSLVVGA 127
           G+     G  +F  GN             +F  Y    NL  +  T +++G  + ++ G 
Sbjct: 63  GVGAIYVGCPAFIVGNTA-------KAATRFLGYDTIRNLLKDKKTGELSGP-RGVLAGL 114

Query: 128 LAGMTSSFVSY-PTDVLRTRFIANQDVALS-------SLSHGCKEIWNMEGIPGFFRGCT 179
            AG+  S V+  P + ++T  I ++            S++     +   EG  G + G  
Sbjct: 115 GAGLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVL 174

Query: 180 ASMFTITLSASILFGTYESIKIYCDEYS---KESDYTNYLRYSASSISGVTSKMVTYPLD 236
                   + ++  G Y  IK+   +Y+   K+   T+ L +   + SGV +   T P+D
Sbjct: 175 PVSMRQAANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPID 234

Query: 237 TIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLC 296
           T++ R+Q                     + K +S +     I ++EGL + ++G +  L 
Sbjct: 235 TVKTRMQS------------------LTASKYSSTLNCFTTIYKEEGLKTFWKGATPRLG 276

Query: 297 KTVPSTVVSLWAYETVM 313
           + + S  +    YE V+
Sbjct: 277 RLILSGGIVFTIYENVL 293

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 91/213 (42%), Gaps = 23/213 (10%)

Query: 6   DGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTV-IAPLDTLKIRL-----QLRPSYTGQ 59
           D   N    +K  ++   + ++AG  +GLL   V + P + +K  L      +RP Y   
Sbjct: 90  DTIRNLLKDKKTGELSGPRGVLAGLGAGLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNN 149

Query: 60  APSGLLKMMKGMI--LNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMN 117
             S    M +  I  + + G R  + G +P +M        Q      YN +     D  
Sbjct: 150 GRS----MARNYISLVKDEGFRGLYGGVLPVSMRQ---AANQAVRLGCYNKIKVLVQDYT 202

Query: 118 GQLQ--------SLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNME 169
           G  +        + +VGA +G+ + + + P D ++TR  +      SS  +    I+  E
Sbjct: 203 GAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKTRMQSLTASKYSSTLNCFTTIYKEE 262

Query: 170 GIPGFFRGCTASMFTITLSASILFGTYESIKIY 202
           G+  F++G T  +  + LS  I+F  YE++ +Y
Sbjct: 263 GLKTFWKGATPRLGRLILSGGIVFTIYENVLLY 295

>Kwal_33.15597
          Length = 305

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 80/196 (40%), Gaps = 22/196 (11%)

Query: 124 VVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMF 183
           + GA+   T+     P DV++TR      V    +    K+I + EG      G   ++ 
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLL 77

Query: 184 TITLSASILFGTYESI-KIYCDE--YSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRR 240
             +L  S  FG YE   K++ D   Y +  +Y N +   +++I+   + +   PL+  R 
Sbjct: 78  GYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRI 137

Query: 241 RIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVP 300
           R+        Q    N +V           F R    IL++EGL S Y G +  L K +P
Sbjct: 138 RL------VSQPTFANGLV---------GGFSR----ILKEEGLSSFYNGFTPILFKQIP 178

Query: 301 STVVSLWAYETVMRLY 316
             +     +E    +Y
Sbjct: 179 YNIAKFLVFERAAEVY 194

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 98/226 (43%), Gaps = 15/226 (6%)

Query: 27  VAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNV 86
           +AG++      + + P+D +K R+QL P+   +   G++   K +I +EG   +   G  
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNK---GMISSFKQIISSEGA-GALLTGFG 73

Query: 87  PGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQL---QSLVVG--ALAGMTSSFVSYPTD 141
           P  + Y L G  +F  Y  +  LF +T   +  +    S+ +G  A+A   +     P +
Sbjct: 74  PTLLGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLE 133

Query: 142 VLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYE-SIK 200
             R R ++    A + L  G   I   EG+  F+ G T  +F         F  +E + +
Sbjct: 134 ATRIRLVSQPTFA-NGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIAKFLVFERAAE 192

Query: 201 IYCDEYSKESDYTNYLRYSASSISGVT----SKMVTYPLDTIRRRI 242
           +Y      +   +       + +SG+T    + +V+ P DT+  ++
Sbjct: 193 VYFGMAGPKETLSTSTTTGLNLLSGLTAGLAAAIVSQPADTLLSKV 238

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 71/313 (22%), Positives = 131/313 (41%), Gaps = 48/313 (15%)

Query: 21  KVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRP--SYTGQAPSGLLKMMKGMILNEGGL 78
           K  + + +G+V G+    V  P D +K+RLQ  P  +   +A + L+K          G 
Sbjct: 23  KTLKDVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGNATAWEAITDLVKYE--------GF 74

Query: 79  RSFWKGNVPGTMMYVLYGGA----QFSSYSFYNNLFGETSDMNGQL-------QSLVVGA 127
             F+K    GTM  ++  GA    QF         F + +   G         Q    G 
Sbjct: 75  MGFYK----GTMAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGF 130

Query: 128 LAGMTSSFVSYPTDVLRTRFIANQDVALSSLSH----GCKEIWNMEGIPGFFRGCTASMF 183
           ++G  ++ ++ P + +R R +  Q  AL++  +     C E    +G     RG TA++ 
Sbjct: 131 VSGSANALLATPIEHVRIR-LQLQKEALANAEYKSTLDCTEKLLKQG--SLMRGFTATLM 187

Query: 184 TITLSASILFGTYES-IKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRI 242
             +    I F TYE+ I        +  D + +      ++SG     +TYP D ++  +
Sbjct: 188 RTSHGFGIYFLTYETLIASQLAHGFRREDISAWKACMFGALSGAFFWAMTYPFDVVKSVM 247

Query: 243 QVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPST 302
           Q            +K+V   Y    G + +++  NI R+ GL +  +G   ++ +++P  
Sbjct: 248 QA-----------DKLVNPAY----GTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVN 292

Query: 303 VVSLWAYETVMRL 315
             +  A+E  M++
Sbjct: 293 GATFAAFEVTMQM 305

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 49/96 (51%), Gaps = 9/96 (9%)

Query: 13  HLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQ----LRPSYTGQAPSGLLKMM 68
           H  + ED+   ++ + G++SG     +  P D +K  +Q    + P+Y     + ++++ 
Sbjct: 210 HGFRREDISAWKACMFGALSGAFFWAMTYPFDVVKSVMQADKLVNPAYG----TNVVQVA 265

Query: 69  KGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYS 104
           K  I  E GLR+F KG +P  +  +   GA F+++ 
Sbjct: 266 KN-IYRERGLRAFTKGFMPTMLRSLPVNGATFAAFE 300

>Scas_669.6
          Length = 373

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 114/296 (38%), Gaps = 29/296 (9%)

Query: 43  LDTLKIRLQ---LRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQ 99
           LDT+K R Q   + P Y       +    + + L EG  R  + G     +         
Sbjct: 72  LDTVKTRQQGAPMTPKY-----KNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIF 126

Query: 100 FSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDV------ 153
           F +Y +           N  +  L  G L    SSFV  P++VL+TR      V      
Sbjct: 127 FGTYEWCKRKMIGDLGFNDTVSHLSAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQ 186

Query: 154 ---ALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKES 210
                 SL    + I N EG+   F G  A++      +++ FG YE  +    +  K+ 
Sbjct: 187 SGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQTAFKLEKKD 246

Query: 211 DYTNYLRYS----ASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSY 266
              + L         +I+G  + ++T P+D I+ R+Q + +  +  N    +     ++ 
Sbjct: 247 ITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQAD-INPNSATTVGAISAKTN 305

Query: 267 KGASFIRMGLNILR-------QEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
           K +  I +  +I R        EG++  + GV      T   + + L  Y+  +RL
Sbjct: 306 KKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFVWTSVQSSIMLLLYQMTLRL 361

>Kwal_55.21106
          Length = 328

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 78/322 (24%), Positives = 135/322 (41%), Gaps = 77/322 (23%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRP------SYTGQAPSG-------------- 63
           +S + G+V+  LA  V+ PLD +K  +Q +       S  G  P                
Sbjct: 5   ESAITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSL 64

Query: 64  --LLKMMK--GMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQ 119
             L+K+ K  G++   G  +  W   + G +    Y    F  YS     F     + G+
Sbjct: 65  DALIKIFKTKGVL---GLYQGLWTSIIAGFLQSFSY----FFWYSIVRKSFFRYKLLRGR 117

Query: 120 L------QSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNM----- 168
           L      + L++G +A   S   + P  V+ TR    Q  + S    G +E+ +      
Sbjct: 118 LGKFSTPEELLLGIVAAAVSQIFTSPIGVISTR----QQTSTSGSKGGFREVLHQIYSEQ 173

Query: 169 EGIPGFFRGCTASMFTITLSASILFGTYESI-------KIYCDEYSKESDYTNYLRYSAS 221
             I GF+RG   S+  +T++ SI F +YE +       K   DE  +  + +  L    +
Sbjct: 174 NNITGFWRGFKVSLI-LTVNPSITFASYEKLQDIFITSKRAVDENGQLLETSGQLSPRQN 232

Query: 222 SISGVTSK----MVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLN 277
            + GV SK    ++T PL        + +  Y+Q    N      +QS++     ++ L 
Sbjct: 233 FLLGVFSKVISTLITQPL--------IVSKAYLQRTGSN------FQSFQ-----QVLLY 273

Query: 278 ILRQEGLLSLYQGVSMSLCKTV 299
           + +QEGL+SL++G++  L K +
Sbjct: 274 LYKQEGLISLWKGLAPQLSKGI 295

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 141/323 (43%), Gaps = 64/323 (19%)

Query: 39  VIAPLDTLKIRLQ---LRPSYTGQAPSGLLKMMKGMILN--------------------- 74
           V  P D +K RLQ    +  Y  QA + ++   +  I+N                     
Sbjct: 73  VTCPFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYR 132

Query: 75  EGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQS---LVVGALAGM 131
           + G RS +KG  P  +  +      F +Y    +++ +  + NGQ      L+  A AG 
Sbjct: 133 QEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFN-NGQEAPWIHLMAAATAGW 191

Query: 132 TSSFVSYPTDVLRTRFIANQDVALSSL--SHGC-KEIWNMEGIPGFFRGCTASMFTITLS 188
            ++  + P  +++TR   ++     +   S+ C K I   EGI G +RG +AS +  ++ 
Sbjct: 192 ATATATNPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSAS-YLGSVE 250

Query: 189 ASILFGTYESIKIYCDEYS-------KESDYTNY-------LRYSASSISGVTSKMVTYP 234
             + +  YE +K    + S        ES  T          R   + ++   + +VTYP
Sbjct: 251 GILQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYP 310

Query: 235 LDTIRRRIQVRNSVYVQHNVENKIV--TEIYQSYKGASFIRMGLNILRQEGLLSLYQGVS 292
            + +R R++       Q  +EN  V  T + QS++          I+++EGL S+Y G++
Sbjct: 311 HEVVRTRLR-------QSPLENGKVKYTGLVQSFRV---------IIKEEGLASMYSGLT 354

Query: 293 MSLCKTVPSTVVSLWAYETVMRL 315
             L +TVP++++    +E V++L
Sbjct: 355 PHLMRTVPNSIIMFGTWEVVIKL 377

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%)

Query: 277 NILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
           N+ RQEG  SL++G+  +L   +P+  ++ + Y T   +Y
Sbjct: 129 NVYRQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIY 168

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 82/315 (26%), Positives = 133/315 (42%), Gaps = 58/315 (18%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGN 85
           L+  + +G+L   V  P+DT+  RL    S   +  SG    +  +I  +    +F K  
Sbjct: 14  LLGSASAGILEIGVFHPVDTISKRLM---SNHTKITSG--AQLNSVIFRDHAAEAFGKRV 68

Query: 86  V---PG---TMMYVL------YGGAQFSSYSFYNNLFGET-----SDMNGQ-LQSLVVGA 127
               PG     +Y +      YGG  F++  F N  F +       D  G+ L+S   G+
Sbjct: 69  FTLFPGLGYAAVYKILQRVYKYGGQPFAN-EFLNKHFKKDFDSAFGDKTGKALRSATAGS 127

Query: 128 LAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITL 187
           L G+    V  P DVL+ +   N +   +    G  +I   EGI   +RG   +      
Sbjct: 128 LIGI-GEIVLLPLDVLKIKRQTNPE---AFKGRGFLKILKDEGIFNLYRGWGWTAARNAP 183

Query: 188 SASILFGTYESIKIYC---DEYSKESDYTNYLRYSASSISGVTSKM-VTYPLDTIRRRIQ 243
            +  LFG     K Y     +YS+ +   N++    SSI G ++ + V+ PLD I+ RIQ
Sbjct: 184 GSFALFGGNAFAKEYILGLQDYSQATWSQNFI----SSIVGASASLIVSAPLDVIKTRIQ 239

Query: 244 VRNSVYVQHNVEN--KIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPS 301
            RN      N E+  KIV                 N L+ EG  + ++G++  L  T P 
Sbjct: 240 NRNF----DNPESGFKIVK----------------NTLKNEGFTAFFKGLTPKLLTTGPK 279

Query: 302 TVVSLWAYETVMRLY 316
            V S    ++++ ++
Sbjct: 280 LVFSFALAQSLIPMF 294

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 23  SQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFW 82
           SQ+ ++  V    +  V APLD +K R+Q R       P    K++K  + NE G  +F+
Sbjct: 211 SQNFISSIVGASASLIVSAPLDVIKTRIQNR---NFDNPESGFKIVKNTLKNE-GFTAFF 266

Query: 83  KGNVP 87
           KG  P
Sbjct: 267 KGLTP 271

>Kwal_27.12081
          Length = 369

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 76/326 (23%), Positives = 134/326 (41%), Gaps = 78/326 (23%)

Query: 39  VIAPLDTLKIRLQ---LRPSYTGQA--------PSGLLKMMK--GMILNE---GGLRSFW 82
           V  P D +K RLQ    + +Y   +         SG+    +  G+I N     G RS +
Sbjct: 69  VTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSLF 128

Query: 83  KGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQS---LVVGALAGMTSSFVSYP 139
           KG  P  +  +      F +Y     ++    + NG+      L+  A AG  +S  + P
Sbjct: 129 KGLGPNLVGVIPARSINFFTYGTTKQIYSRAFN-NGEEAPWIHLISAATAGWATSTATNP 187

Query: 140 TDVLRTRFIANQ--DVALSSLSHGC-KEIWNMEGIPGFFRGCTASMF------------- 183
             +++TR   ++         S  C K I   EG  G ++G +AS               
Sbjct: 188 IWLIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLGSVEGILQWLLYE 247

Query: 184 ----TITLSASILFG--------TYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMV 231
                I + +   FG        T E IK +C             R  ++ ++   + +V
Sbjct: 248 QMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQ------------RSGSAGLAKFLASIV 295

Query: 232 TYPLDTIRRRIQVRNSVYVQHNVENKIV--TEIYQSYKGASFIRMGLNILRQEGLLSLYQ 289
           TYP + +R R++       Q  +EN  +  T + QS++          I+++EGL S+Y 
Sbjct: 296 TYPHEVVRTRLR-------QAPLENDKLKYTGLIQSFR---------VIIKEEGLASMYG 339

Query: 290 GVSMSLCKTVPSTVVSLWAYETVMRL 315
           G++  L +TVP++++    +E V++L
Sbjct: 340 GLTPHLLRTVPNSIIMFGTWELVIKL 365

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 49/93 (52%), Gaps = 10/93 (10%)

Query: 230 MVTYPLDTIRRRIQ--VRNSVY--VQHNVENKIVTEIYQSYKGASFIRMGL--NILRQEG 283
           +VT P D ++ R+Q  V  S Y  + HN  + +V+   + ++       G+  N+ + EG
Sbjct: 68  IVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRET----FGIISNLYKLEG 123

Query: 284 LLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
             SL++G+  +L   +P+  ++ + Y T  ++Y
Sbjct: 124 FRSLFKGLGPNLVGVIPARSINFFTYGTTKQIY 156

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 69/313 (22%), Positives = 122/313 (38%), Gaps = 50/313 (15%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMI------LNEGGLR 79
            VAG  SG+   TV  P DT+K+RLQ     T Q  SG     KG +      L   G+R
Sbjct: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQ-----TSQVGSGAGIQFKGPLDCVYKTLKNQGIR 67

Query: 80  SFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGE----TSDMNGQLQSLVVGALAGMTSSF 135
             + G  P    +++   A   S   Y  L  +      D       ++ G +AG T SF
Sbjct: 68  GLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSF 127

Query: 136 VSYPTDVLR-----------TRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFT 184
           ++ P ++ +           T++    DV       G      + G+   ++G  +   T
Sbjct: 128 IAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLIS---T 184

Query: 185 ITLSASILF--GTYESIKIYCDEYSK-ESDYTNYLRYSASSISGVTSKMVTYPLDTIRRR 241
           +   ++ +F  G+YE I  +  + +   +   N+     S+  G  +    YP D +++ 
Sbjct: 185 LIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTS--AYPSDVVKQV 242

Query: 242 IQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPS 301
           +   +            V++IY                RQ G+   ++G   S  ++ P+
Sbjct: 243 VLCNDKYDGSFKSWRTAVSDIY----------------RQRGIHGFFKGFLPSFLRSFPA 286

Query: 302 TVVSLWAYETVMR 314
              +L A+E V+R
Sbjct: 287 NAAALAAFEFVLR 299

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 80/178 (44%), Gaps = 17/178 (9%)

Query: 18  EDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLR-----PSYTGQAPSGLLKMMKGMI 72
           + + +S  +++G ++G     + AP++  K +LQ++       YTG          +GM 
Sbjct: 107 DKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMA 166

Query: 73  LNE--GGLRSFWKGNVPGTMM---YVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGA 127
            N   GG+RS +KG +   +    +V + G    SY      F + ++++    +   G 
Sbjct: 167 TNGILGGVRSLYKGLISTLIFRSNFVFWWG----SYELITQWFQKNTNLSAPAINFWAGG 222

Query: 128 LAGMTSSFVS-YPTDVLRTRFIANQ--DVALSSLSHGCKEIWNMEGIPGFFRGCTASM 182
           L+     + S YP+DV++   + N   D +  S      +I+   GI GFF+G   S 
Sbjct: 223 LSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSF 280

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 19/35 (54%)

Query: 209 ESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQ 243
           E  Y+  + + A   SGV    V +P DT++ R+Q
Sbjct: 4   EETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQ 38

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 99/231 (42%), Gaps = 36/231 (15%)

Query: 95  YGGAQFSSYSFYNNLFGETSDMNGQ-----LQSLVVGALAGMTSSFVSYPTDVLRTRFIA 149
           YGG  F++     N  G+     G+     L+S   G+L G+    V  P DVL+ +   
Sbjct: 90  YGGQPFANEFLNKNFKGDFDQAFGEKTGKALRSATAGSLIGI-GEIVLLPLDVLKIKRQT 148

Query: 150 NQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYC---DEY 206
           N +   S    G  +I   EG  G +RG   +       +  LFG     K Y     +Y
Sbjct: 149 NPE---SFKGRGFLKIIKDEGF-GLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDY 204

Query: 207 SKESDYTNYLRYSASSISGVTSKM-VTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQS 265
            + +   N++    SSI G ++ + V+ PLD I+ RIQ RN      N E+         
Sbjct: 205 GQATWSQNFV----SSIVGASASLIVSAPLDVIKTRIQNRNF----DNPES--------- 247

Query: 266 YKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
             G   I+   N L+ EG  + ++G++  L  T P  V S    +T++ ++
Sbjct: 248 --GFKIIK---NTLKNEGFTAFFKGLTPKLLTTGPKLVFSFALAQTLIPIF 293

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 23  SQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFW 82
           SQ+ V+  V    +  V APLD +K R+Q R       P    K++K  + NE G  +F+
Sbjct: 210 SQNFVSSIVGASASLIVSAPLDVIKTRIQNR---NFDNPESGFKIIKNTLKNE-GFTAFF 265

Query: 83  KGNVP 87
           KG  P
Sbjct: 266 KGLTP 270

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 117/303 (38%), Gaps = 51/303 (16%)

Query: 29  GSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPG 88
           G  +G+ A  V  PLD  K+RLQ  P         L +M++ ++ NE G+   + G    
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAP----MPKPTLFRMLESILANE-GVVGLYSGLSAA 74

Query: 89  TMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQ--------SLVVGALAGMTSSFVSYPT 140
            +    Y   +F +Y    +L  E      QL         S+  GA+ G+  +F     
Sbjct: 75  VLRQCTYTTVRFGAY----DLLKENVIPREQLTNMAYLLPCSMFSGAIGGLAGNFA---- 126

Query: 141 DVLRTRFIANQDVALSSLSH--------GCKEIWNME-GIPGFFRGCTASMFTITLSASI 191
           DV+  R     D AL +           G  +I+  E G+   F G   +M    L  + 
Sbjct: 127 DVVNIRM--QNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTAS 184

Query: 192 LFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQ 251
              TY+  K Y           NY   +AS ++G+ +  V  P D ++ RI   +     
Sbjct: 185 QVVTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSG---D 241

Query: 252 HNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYET 311
           H    KI+ +                 +R+EG   +++G   S  +  P T++  +A E 
Sbjct: 242 HQPALKILAD----------------AVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQ 285

Query: 312 VMR 314
           + +
Sbjct: 286 LKK 288

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 58/261 (22%), Positives = 106/261 (40%), Gaps = 29/261 (11%)

Query: 77  GLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFV 136
           GL + W+G     +M +      FS Y  + +      D    L  L  GA A M ++  
Sbjct: 112 GLATLWRGLSITLLMAIPANVVYFSGYEMFRD-HSPMRDSYPSLNPLFCGATARMVAATT 170

Query: 137 SYPTDVLRTRF---------IANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITL 187
             P ++++TR             Q +    L     EI    G    F+G   +++    
Sbjct: 171 VAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEI-RSGGYKVLFKGLEITLWRDVP 229

Query: 188 SASILFGTYESIKI--------YCDEYSKESDYTNYLR-YSASSISGVTSKMVTYPLDTI 238
            ++I +G+YE  K          C  ++   ++  ++  +   S+SG ++ ++T+P D  
Sbjct: 230 FSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGGSVSGSSAALLTHPFDVG 289

Query: 239 RRRIQVRNSVYVQHNVENKIVTEIYQSYKGAS---FIRMGLNILRQEGLLSLYQGVSMSL 295
           + R+Q+        ++ENK    +    K  S     +   NI + EG  +LY G+   +
Sbjct: 290 KTRMQI------TMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGYGALYTGLIPRV 343

Query: 296 CKTVPSTVVSLWAYETVMRLY 316
            K  PS  + +  YE   RL+
Sbjct: 344 MKIAPSCAIMISTYELSKRLF 364

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 91/219 (41%), Gaps = 36/219 (16%)

Query: 12  DHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRP-----SYTGQAPSGLLK 66
           DH    +       L  G+ + ++A T +APL+ +K RLQ  P     + T      LLK
Sbjct: 143 DHSPMRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLK 202

Query: 67  MMKGMILNEGGLRSFWKG-------NVPGTMMYVLYGGAQFSSYSFYNNL------FGET 113
             +  I   GG +  +KG       +VP + +Y  +G  +F   +F+ +       +  +
Sbjct: 203 ETRNEI-RSGGYKVLFKGLEITLWRDVPFSAIY--WGSYEFYKKNFWIDFSEQCLRWNLS 259

Query: 114 SDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQD---------------VALSSL 158
            + +  + S + G+++G +++ +++P DV +TR     D               V+   +
Sbjct: 260 PNWDFFINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGM 319

Query: 159 SHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYE 197
                 I   EG    + G    +  I  S +I+  TYE
Sbjct: 320 FKFLYNIKQTEGYGALYTGLIPRVMKIAPSCAIMISTYE 358

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 51/124 (41%), Gaps = 33/124 (26%)

Query: 219 SASSISGVTSKMVTYPLDTIRRRIQ-------------------VRNSVYVQHNVENKIV 259
           SA + S +TS  +T P+D +R R+Q                   V   V   H V NK  
Sbjct: 17  SACAGSFLTSFFLT-PMDVVRIRLQQQVMLPDCSCGAASELKGSVGTEVIYDHVVANKNS 75

Query: 260 TEIYQSYKGASFIRMGLNILR-------------QEGLLSLYQGVSMSLCKTVPSTVVSL 306
            +I+        I+   + LR              EGL +L++G+S++L   +P+ VV  
Sbjct: 76  PKIFWQDVCFQDIQCKNSALRFNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYF 135

Query: 307 WAYE 310
             YE
Sbjct: 136 SGYE 139

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 79/196 (40%), Gaps = 22/196 (11%)

Query: 124 VVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMF 183
           + GA+   T+     P DV++TR      V    +    K+I + EG      G   ++ 
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLL 77

Query: 184 TITLSASILFGTYESI-KIYCD--EYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRR 240
             +L  S  FG YE   K++ D   Y +  +Y N +   +++I+   + +   PL+  R 
Sbjct: 78  GYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRI 137

Query: 241 RIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVP 300
           R+        Q    N +V           F R    IL++EG  S Y G +  L K +P
Sbjct: 138 RL------VSQPTFANGLV---------GGFSR----ILKEEGAGSFYNGFTPILFKQIP 178

Query: 301 STVVSLWAYETVMRLY 316
             +     +E    +Y
Sbjct: 179 YNIAKFLVFERAAEVY 194

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 98/227 (43%), Gaps = 17/227 (7%)

Query: 27  VAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNV 86
           +AG++      + + P+D +K R+QL P+   +   G++   K +I +EG   +   G  
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNK---GMISSFKQIISSEGA-GALLTGFG 73

Query: 87  PGTMMYVLYGGAQFSSYSFYNNLF----GETSDMNGQLQSLVVG--ALAGMTSSFVSYPT 140
           P  + Y L G  +F  Y  +  LF    G    +N +  S+ +G  A+A   +     P 
Sbjct: 74  PTLLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYK-NSIYIGSAAIAEFFADIALCPL 132

Query: 141 DVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYE-SI 199
           +  R R ++    A + L  G   I   EG   F+ G T  +F         F  +E + 
Sbjct: 133 EATRIRLVSQPTFA-NGLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIAKFLVFERAA 191

Query: 200 KIY----CDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRI 242
           ++Y      + S  +  T  +   +   +G+ + +V+ P DT+  ++
Sbjct: 192 EVYFGMAGPKESLSTASTTGINLLSGLTAGLAAAIVSQPADTLLSKV 238

>Kwal_27.11626
          Length = 299

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 82/310 (26%), Positives = 132/310 (42%), Gaps = 50/310 (16%)

Query: 27  VAGSVS-GLLARTVIAPLDTLKIRL---QLRPSYTGQAPSGLLKMMKGMILNEGGLRSFW 82
           V GS S G+L   V  P+DT+  RL     + S + Q  S + +   G  L +  L + +
Sbjct: 13  VLGSASAGILEIGVFHPVDTVSKRLMSNHTKISSSAQLNSVIFREHAGEALGKR-LFTLF 71

Query: 83  KGNVPGTMMYVL-----YGGAQFSS-------YSFYNNLFGETSDMNGQLQSLVVGALAG 130
            G        +L     YGG  F++        + ++N FGE +     L+S   G+L G
Sbjct: 72  PGLGYAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFGEKTGK--ALRSATAGSLIG 129

Query: 131 MTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSAS 190
           +    V  P DVL+ +   N +   S    G  +I   EG  G +RG   +       + 
Sbjct: 130 I-GEIVLLPLDVLKIKRQTNPE---SFKGRGFIKILKDEGF-GLYRGWGWTAARNAPGSF 184

Query: 191 ILFGTYESIKIYC---DEYSKESDYTNYLRYSASSISGVTSKM-VTYPLDTIRRRIQVRN 246
            LFG     K Y     +YS  +   N++    SSI G ++ + V+ PLD I+ RIQ R+
Sbjct: 185 ALFGGNAFAKEYILGLKDYSSATWSQNFV----SSIVGASASLIVSAPLDVIKTRIQNRH 240

Query: 247 SVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSL 306
                 N E              S  R+  N L+ EG+ + ++G++  L  T P  V S 
Sbjct: 241 F----DNPE--------------SGFRIVQNTLKNEGITAFFKGLTPKLLTTGPKLVFSF 282

Query: 307 WAYETVMRLY 316
              ++++  +
Sbjct: 283 ALAQSLIPAF 292

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 4/65 (6%)

Query: 23  SQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFW 82
           SQ+ V+  V    +  V APLD +K R+Q R       P    ++++  + NE G+ +F+
Sbjct: 209 SQNFVSSIVGASASLIVSAPLDVIKTRIQNRHF---DNPESGFRIVQNTLKNE-GITAFF 264

Query: 83  KGNVP 87
           KG  P
Sbjct: 265 KGLTP 269

>Scas_673.17
          Length = 314

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 77/178 (43%), Gaps = 12/178 (6%)

Query: 30  SVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPGT 89
           +V+  LA   + PL+  +IRL  +P++      G  +     IL E G+ SF+ G  P  
Sbjct: 126 AVAEFLADIALCPLEATRIRLVSQPTFANGLVGGFSR-----ILKEEGVGSFYSGFTPIL 180

Query: 90  MMYVLYGGAQFSSYS----FYNNLFG--ET-SDMNGQLQSLVVGALAGMTSSFVSYPTDV 142
              + Y  A+F  +      Y  + G  ET SDM     +L+ G  AG  ++FVS P D 
Sbjct: 181 FKQIPYNIAKFLVFERASEVYYGIVGAKETLSDMTNTGINLLSGLTAGFAAAFVSQPADT 240

Query: 143 LRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIK 200
           L ++    +     S      ++    G+ G F G    +  +    S+ F  Y S+K
Sbjct: 241 LLSKVNKTKKAPGQSTIGLLAQLAKQLGVIGSFAGLPTRLIMVGTLTSLQFAIYGSLK 298

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 75/196 (38%), Gaps = 22/196 (11%)

Query: 124 VVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMF 183
           + GA+   T+     P DV++TR      V    +    K+I   EG      G   ++ 
Sbjct: 25  LAGAIGCGTTHSSLVPVDVVKTRIQLEPTVYNKGMVGSFKKIIADEGAGALLTGFGPTLL 84

Query: 184 TITLSASILFGTYESIK---IYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRR 240
             ++  +  FG YE  K   I    Y     Y N +   +++++   + +   PL+  R 
Sbjct: 85  GYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRI 144

Query: 241 RIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVP 300
           R+        Q    N +V           F R    IL++EG+ S Y G +  L K +P
Sbjct: 145 RL------VSQPTFANGLV---------GGFSR----ILKEEGVGSFYSGFTPILFKQIP 185

Query: 301 STVVSLWAYETVMRLY 316
             +     +E    +Y
Sbjct: 186 YNIAKFLVFERASEVY 201

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 96/227 (42%), Gaps = 15/227 (6%)

Query: 27  VAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNV 86
           +AG++      + + P+D +K R+QL P+   +   G++   K +I +EG   +   G  
Sbjct: 25  LAGAIGCGTTHSSLVPVDVVKTRIQLEPTVYNK---GMVGSFKKIIADEGA-GALLTGFG 80

Query: 87  PGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQ---SLVVG--ALAGMTSSFVSYPTD 141
           P  + Y + G  +F  Y  +  L  +T      +    S+ +G  A+A   +     P +
Sbjct: 81  PTLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLE 140

Query: 142 VLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYE--SI 199
             R R ++    A + L  G   I   EG+  F+ G T  +F         F  +E  S 
Sbjct: 141 ATRIRLVSQPTFA-NGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASE 199

Query: 200 KIYCDEYSKE--SDYTNY-LRYSASSISGVTSKMVTYPLDTIRRRIQ 243
             Y    +KE  SD TN  +   +   +G  +  V+ P DT+  ++ 
Sbjct: 200 VYYGIVGAKETLSDMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVN 246

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/300 (23%), Positives = 114/300 (38%), Gaps = 42/300 (14%)

Query: 38  TVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGG 97
           +V+  LDT+K R Q  P         ++   + + L EG  R  + G          YG 
Sbjct: 69  SVMHSLDTVKTRQQGAPGEVKY--RHMISAYRTLALEEGVRRGLYGG----------YGA 116

Query: 98  AQFSSYSFYNNLFGETSDMNGQL----------QSLVVGALAGMTSSFVSYPTDVLRTRF 147
           A   S+      FG    +  Q+            L  G L  + SS V  P++VL+TR 
Sbjct: 117 AMLGSFPSAAVFFGTYEWVKRQMINEWQIHETYSHLAAGFLGDLFSSVVYVPSEVLKTRL 176

Query: 148 -----IANQDVA----LSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYES 198
                  N+          LS   + I   EG+   F G  A++      +++ F  YE 
Sbjct: 177 QLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYER 236

Query: 199 IKIYCDEYSKESDYTNYLRYSASSISGVTSK----MVTYPLDTIRRRIQVRNSVYVQHNV 254
            + +     ++     +L ++A  ++G ++     ++T PLD ++ RIQ       Q   
Sbjct: 237 FRKWAFLLERKP-VDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQT------QPRG 289

Query: 255 ENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMR 314
                     +    S  R  L +LR EGL   + GV      T   + + L  Y+T +R
Sbjct: 290 SAGTPDASAPARLNGSIFRSLLVVLRYEGLGGAFSGVGPRFIWTSIQSSIMLLLYQTALR 349

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 15  RKGEDVKVS--QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP 61
           RK  D  +S    +V G+ +G LA  +  PLD +K R+Q +P  +   P
Sbjct: 246 RKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTP 294

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/263 (21%), Positives = 119/263 (45%), Gaps = 37/263 (14%)

Query: 77  GLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNG---QLQSLVVGALAGMTS 133
           G+ + W+G     +M +      F+ Y +      + S +NG    +  L+ GA A   +
Sbjct: 125 GVTTLWRGISITLLMAIPANVVYFTGYEYVR----DRSPLNGLYPTINPLICGAFARTLA 180

Query: 134 SFVSYPTDVLRTRFIANQDVALSSLSHGC----KEIWN-------MEGIP-GFFRGCTAS 181
           +    P ++++T+    Q +  SS+ +G     ++++N       M G+    F+G   +
Sbjct: 181 ATSVAPLELIKTKL---QSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGVAQTMFKGLEIT 237

Query: 182 MFTITLSASILFGTYESIKI---YCDEYSKESDYTNYLRYSASS----ISGVTSKMVTYP 234
           ++     ++I + +YE  K    Y    + + + +N+  ++ S     ISG  + + T+P
Sbjct: 238 LWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGGFISGSLAAICTHP 297

Query: 235 LDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQ-EGLLSLYQGVSM 293
            D  + R Q+         V +K +      Y  ++ +   LN +R+ EG+ +LY G++ 
Sbjct: 298 FDVGKTRQQI-------SLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEGIGALYTGLAP 350

Query: 294 SLCKTVPSTVVSLWAYETVMRLY 316
            + K  PS  + + +YE   RL+
Sbjct: 351 RVAKIAPSCAIMISSYELTKRLF 373

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 87/201 (43%), Gaps = 26/201 (12%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPS-----GLLKMMKGMILNEGGLRS 80
           L+ G+ +  LA T +APL+ +K +LQ  PS + +  S      L   +K  I   G  ++
Sbjct: 170 LICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGVAQT 229

Query: 81  FWKGNVPGTMMYVLYGGAQFSSYSFYNN----LFGETSDMNGQ-----LQSLVVGALAGM 131
            +KG        V +    ++SY FY      L   T D N         S + G ++G 
Sbjct: 230 MFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGGFISGS 289

Query: 132 TSSFVSYPTDVLRTR----FIANQDVALSSLSHGCKE--------IWNMEGIPGFFRGCT 179
            ++  ++P DV +TR     + ++ +A S+L +G           I   EGI   + G  
Sbjct: 290 LAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEGIGALYTGLA 349

Query: 180 ASMFTITLSASILFGTYESIK 200
             +  I  S +I+  +YE  K
Sbjct: 350 PRVAKIAPSCAIMISSYELTK 370

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%)

Query: 278 ILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETV 312
           I + EG+ +L++G+S++L   +P+ VV    YE V
Sbjct: 120 IAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYV 154

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 10/37 (27%), Positives = 22/37 (59%)

Query: 15 RKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQ 51
          R    + + + +++ +V  LL   ++ P+D ++IRLQ
Sbjct: 4  RPPATLTIQERMMSATVGSLLTSVILTPMDVVRIRLQ 40

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 87/202 (43%), Gaps = 28/202 (13%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNE--------GG 77
           L  G+++ + A T IAPL+ +K +LQ  P  +    +    MM   +LNE        G 
Sbjct: 162 LFCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTW---MMVKDLLNETRQEMKMVGP 218

Query: 78  LRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFG------ETSDMNGQ--LQSLVVGALA 129
            R+ +KG        V +    +SSY               + D N    + S   G ++
Sbjct: 219 SRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFINSFASGCIS 278

Query: 130 GMTSSFVSYPTDVLRTRF----IANQDVALSSLSHG----CKEIWNMEGIPGFFRGCTAS 181
           GM ++  ++P DV +TR+    + N D    + S       + IW  EG+   + G  A 
Sbjct: 279 GMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGLAALYTGLAAR 338

Query: 182 MFTITLSASILFGTYE-SIKIY 202
           +  I  S +I+  +YE S K++
Sbjct: 339 VIKIRPSCAIMISSYEISKKVF 360

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 59/265 (22%), Positives = 120/265 (45%), Gaps = 46/265 (17%)

Query: 77  GLRSFWKG-------NVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALA 129
           G+ S W+G        +P  M+Y       FS Y +  ++    +     L  L  GA+A
Sbjct: 117 GITSLWRGISLTLLMAIPANMVY-------FSGYEYIRDV-SPIASTYPTLNPLFCGAIA 168

Query: 130 GMTSSFVSYPTDVLRTRFIANQDVALSSLSHG----CKEIWN-------MEGIP-GFFRG 177
            + ++    P ++++T+    Q +  SS S       K++ N       M G     F+G
Sbjct: 169 RVFAATSIAPLELVKTKL---QSIPRSSKSTKTWMMVKDLLNETRQEMKMVGPSRALFKG 225

Query: 178 CTASMFTITLSASILFGTYESIK--IYCDE---YSKESDYTNYLR-YSASSISGVTSKMV 231
              +++     ++I + +YE  K  ++ D     SK++++ +++  +++  ISG+ + + 
Sbjct: 226 LEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFINSFASGCISGMIAAIC 285

Query: 232 TYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGV 291
           T+P D  + R Q+     + +N + K        +K   F+     I R EGL +LY G+
Sbjct: 286 THPFDVGKTRWQIS----MMNNSDPKGGNRSRNMFK---FLE---TIWRTEGLAALYTGL 335

Query: 292 SMSLCKTVPSTVVSLWAYETVMRLY 316
           +  + K  PS  + + +YE   +++
Sbjct: 336 AARVIKIRPSCAIMISSYEISKKVF 360

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 32/152 (21%), Positives = 65/152 (42%), Gaps = 22/152 (14%)

Query: 164 EIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSI 223
           +I ++EGI   +RG + ++     +  + F  YE I+   D     S Y         +I
Sbjct: 111 KIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIR---DVSPIASTYPTLNPLFCGAI 167

Query: 224 SGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEG 283
           + V +     PL+ ++ ++Q               +    +S K    ++  LN  RQE 
Sbjct: 168 ARVFAATSIAPLELVKTKLQS--------------IPRSSKSTKTWMMVKDLLNETRQEM 213

Query: 284 LL-----SLYQGVSMSLCKTVPSTVVSLWAYE 310
            +     +L++G+ ++L + VP + +   +YE
Sbjct: 214 KMVGPSRALFKGLEITLWRDVPFSAIYWSSYE 245

 Score = 28.5 bits (62), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 21/31 (67%)

Query: 282 EGLLSLYQGVSMSLCKTVPSTVVSLWAYETV 312
           EG+ SL++G+S++L   +P+ +V    YE +
Sbjct: 116 EGITSLWRGISLTLLMAIPANMVYFSGYEYI 146

>Scas_613.24
          Length = 177

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 74/168 (44%), Gaps = 22/168 (13%)

Query: 21  KVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRS 80
           K S  LV+G + GL +   + PLD LK R+Q    + G      +K +K  I        
Sbjct: 7   KTSVHLVSGFIGGLSSAVTLQPLDLLKTRIQ---QHKGATLWSAIKDIKDPI-------Q 56

Query: 81  FWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMN--------GQL---QSLVVGALA 129
           FW+G +P  +   +      S  +            +         QL   ++L+ GA+A
Sbjct: 57  FWRGTLPSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMA 116

Query: 130 GMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRG 177
                +++ P  +L+ R+  +   +  S++   K+I+ MEGI GFF+G
Sbjct: 117 RGLVGYITMPITILKVRY-ESTYYSYKSMNEAIKDIYKMEGISGFFKG 163

>Scas_558.2
          Length = 289

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 89/202 (44%), Gaps = 41/202 (20%)

Query: 120 LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCT 179
           + SL+ GA AG ++  V +P D L+TR  A                +   G  G +RG  
Sbjct: 7   VMSLLSGAAAGTSTDLVFFPIDTLKTRLQAKGG------------FFQNGGYHGIYRGLG 54

Query: 180 ASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYS----------ASSISGVTSK 229
           +++     SAS+ F TY+S+K+    + +    ++  R            ASS+  + + 
Sbjct: 55  SAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMGELAAC 114

Query: 230 MVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLL-SLY 288
           +V  P + I++R QV ++               +Q++      R  L    QEG++ +LY
Sbjct: 115 LVRVPAEVIKQRTQVHST------------NSSWQTF------RTILKNENQEGIIRNLY 156

Query: 289 QGVSMSLCKTVPSTVVSLWAYE 310
           +G S ++ + +P T +    YE
Sbjct: 157 RGWSTTIMREIPFTCIQFPLYE 178

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 50/257 (19%), Positives = 96/257 (37%), Gaps = 51/257 (19%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKG 84
           SL++G+ +G     V  P+DTLK RLQ                 KG     GG    ++G
Sbjct: 9   SLLSGAAAGTSTDLVFFPIDTLKTRLQ----------------AKGGFFQNGGYHGIYRG 52

Query: 85  -------NVP-GTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQ----LQSLVVGALAGMT 132
                  + P  ++ +V Y   +         +   +   +      +  ++  ++  + 
Sbjct: 53  LGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMGELA 112

Query: 133 SSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIW----------NMEG-IPGFFRGCTAS 181
           +  V  P +V++ R          +  H     W          N EG I   +RG + +
Sbjct: 113 ACLVRVPAEVIKQR----------TQVHSTNSSWQTFRTILKNENQEGIIRNLYRGWSTT 162

Query: 182 MFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYS-ASSISGVTSKMVTYPLDTIRR 240
           +        I F  YE +K     Y  E  +    + +   SI+G  +   T PLD ++ 
Sbjct: 163 IMREIPFTCIQFPLYEFMKKEWALYDNEVGHLKPWKGAICGSIAGGIAAATTTPLDFLKT 222

Query: 241 RIQV-RNSVYVQHNVEN 256
           R+ + ++S+ ++  + N
Sbjct: 223 RLMLNKDSIPIKSLIRN 239

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 46/104 (44%), Gaps = 16/104 (15%)

Query: 20  VKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLR 79
           +K  +  + GS++G +A     PLD LK RL L         S  +K +   I  E G +
Sbjct: 194 LKPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKD------SIPIKSLIRNIYKEEGFK 247

Query: 80  SFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSL 123
            F+ G  P T M++  GGA F          G    M+  LQSL
Sbjct: 248 IFFSGIYPRT-MWISAGGAIF---------LGVYETMHFMLQSL 281

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 67/286 (23%), Positives = 115/286 (40%), Gaps = 23/286 (8%)

Query: 43  LDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQF-S 101
           LDT+K R Q  PS        ++   + +IL EG LR    G   G M+      A F +
Sbjct: 76  LDTVKTRQQGAPSTVKY--KNMIGAYRTIILEEG-LRKGLYGGYSGAMLGSFPSAAIFFA 132

Query: 102 SYSFYN-NLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRF---------IANQ 151
           +Y +    + GE   +N     L  G L    SSFV  P++VL+TR              
Sbjct: 133 TYEYTKRKMIGEWG-INETFSHLTAGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPFFRS 191

Query: 152 DVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIK---IYCDEYSK 208
                +L+     I   EG P  F G  A++      + + F  YE  +      +  + 
Sbjct: 192 GYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAVENKTF 251

Query: 209 ESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKG 268
           + D +        + +G  + ++T PLD ++ RIQ +     +++ +N     + Q    
Sbjct: 252 DEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQN-----LKQQTLT 306

Query: 269 ASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMR 314
            S  +  + + + EGL  L+ GV      T   + + L  Y+  ++
Sbjct: 307 NSITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLYQVALK 352

 Score = 32.0 bits (71), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 32/147 (21%), Positives = 64/147 (43%), Gaps = 19/147 (12%)

Query: 173 GFFRGCTASMFTITLSASILFGTYESIK-IYCDEYSKESDYTNYLRYSASSISGVTSKMV 231
           G + G + +M     SA+I F TYE  K     E+     +++    +A  +    S  V
Sbjct: 111 GLYGGYSGAMLGSFPSAAIFFATYEYTKRKMIGEWGINETFSHL---TAGFLGDFISSFV 167

Query: 232 TYPLDTIRRRIQVR---NSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLY 288
             P + ++ R+Q++   N+ + +     K +T+   +            I+R+EG  +L+
Sbjct: 168 YVPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTT------------IVRREGWPTLF 215

Query: 289 QGVSMSLCKTVPSTVVSLWAYETVMRL 315
            G   +L + +P + +    YE   +L
Sbjct: 216 FGYKATLSRDLPFSGLQFAFYEKFRQL 242

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/313 (21%), Positives = 128/313 (40%), Gaps = 45/313 (14%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTG-QAPSGLLKMMKGMI----LNEGGL 78
           +SL AG V G+ A     P D +K+R Q   + +   A S +L+  +       LN   +
Sbjct: 30  KSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDAVSHILQAARQAAGPTSLN--AV 87

Query: 79  RSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSD--------MNGQL---QSLVVGA 127
           R F+KG VP  +         F  Y     L              +  +L   Q    G 
Sbjct: 88  RGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQMAAAGF 147

Query: 128 LAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITL 187
           ++ + ++ V+ PT+  R + +       +S     K+I   +G    F+G  A++     
Sbjct: 148 ISAIPTTLVTAPTE--RVKVVLQTTQGKASFLDAAKQIVRTQGFQSLFKGSLATLSRDGP 205

Query: 188 SASILFGTYESIKIYCDEY----SKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQ 243
            +++ F +YE  K Y ++     S E   TN     +  ++GV+  +V +P+DT++ ++Q
Sbjct: 206 GSALYFASYEICKEYLNKASGHTSGELSITNVC--ISGGMAGVSMWVVVFPIDTVKTQLQ 263

Query: 244 VRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTV 303
             +S   Q  +E   VT +  + +G              G+   + GV  ++ ++ P+  
Sbjct: 264 --SSSKRQSMLE---VTRMIYNTRG--------------GIKGFFPGVGPAILRSFPANA 304

Query: 304 VSLWAYETVMRLY 316
            +    E    L+
Sbjct: 305 ATFLGVELTHSLF 317

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 49/224 (21%), Positives = 94/224 (41%), Gaps = 38/224 (16%)

Query: 104 SFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQD-VALSSLSHGC 162
           S  N++    S +   L+SL  G + G+ +    +P D+++ R  +NQ   A+ ++SH  
Sbjct: 13  SHVNDVSQTKSQLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDAVSHIL 72

Query: 163 KEIWNMEG------IPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSK-------- 208
           +      G      + GF++G    +  +T   ++ F  Y+  K                
Sbjct: 73  QAARQAAGPTSLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAA 132

Query: 209 -ESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYK 267
            E + T     +A  IS + + +VT P +    R++V                 + Q+ +
Sbjct: 133 VEPELTLSQMAAAGFISAIPTTLVTAPTE----RVKV-----------------VLQTTQ 171

Query: 268 G-ASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310
           G ASF+     I+R +G  SL++G   +L +  P + +   +YE
Sbjct: 172 GKASFLDAAKQIVRTQGFQSLFKGSLATLSRDGPGSALYFASYE 215

 Score = 32.0 bits (71), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/92 (20%), Positives = 44/92 (47%), Gaps = 5/92 (5%)

Query: 19  DVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGL 78
           ++ ++   ++G ++G+    V+ P+DT+K +LQ     +      +L++ + +    GG+
Sbjct: 231 ELSITNVCISGGMAGVSMWVVVFPIDTVKTQLQ-----SSSKRQSMLEVTRMIYNTRGGI 285

Query: 79  RSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF 110
           + F+ G  P  +       A F      ++LF
Sbjct: 286 KGFFPGVGPAILRSFPANAATFLGVELTHSLF 317

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 101/234 (43%), Gaps = 42/234 (17%)

Query: 95  YGGAQFSSYSFYNNLFGETSDMNGQ--------LQSLVVGALAGMTSSFVSYPTDVLRTR 146
           YGG  F++  F N  F   +D +G         L+S   G+L G+    V  P DVL+ +
Sbjct: 89  YGGQPFAN-EFLNKHF--KADFDGAFGEKTGKALRSATAGSLIGI-GEIVLLPLDVLKIK 144

Query: 147 FIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYC--- 203
              N +   S    G   I   EG+ G +RG   +       +  LFG     K Y    
Sbjct: 145 RQTNPE---SFRGRGFLRILRDEGM-GLYRGWGWTAARNAPGSFALFGGNAFAKEYILGL 200

Query: 204 DEYSKESDYTNYLRYSASSISGVTSKM-VTYPLDTIRRRIQVRNSVYVQHNVENKIVTEI 262
            +YS+ +   N++    SSI G ++ + V+ PLD I+ RIQ RN                
Sbjct: 201 KDYSQATWGQNFV----SSIFGASASLIVSAPLDVIKTRIQSRN---------------F 241

Query: 263 YQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
             +  G + ++   N L+ EG  + ++G++  L  T P  V S    +T++ ++
Sbjct: 242 ESAESGFTIVK---NTLKNEGATAFFKGLTPKLLTTGPKLVFSFAIAQTLIPMF 292

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 80/171 (46%), Gaps = 21/171 (12%)

Query: 21  KVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRP-SYTGQAPSGLLKMMKGMILNEG-GL 78
           K  +S  AGS+ G+    V+ PLD LKI+ Q  P S+ G+   G L++++    +EG GL
Sbjct: 117 KALRSATAGSLIGI-GEIVLLPLDVLKIKRQTNPESFRGR---GFLRILR----DEGMGL 168

Query: 79  RSFW----KGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQ-LQSLVVGALAGMTS 133
              W      N PG+  + L+GG  F+   +   L   +    GQ   S + GA A +  
Sbjct: 169 YRGWGWTAARNAPGS--FALFGGNAFAK-EYILGLKDYSQATWGQNFVSSIFGASASLI- 224

Query: 134 SFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFT 184
             VS P DV++TR  +    +  S     K     EG   FF+G T  + T
Sbjct: 225 --VSAPLDVIKTRIQSRNFESAESGFTIVKNTLKNEGATAFFKGLTPKLLT 273

>Scas_687.15*
          Length = 328

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 85/195 (43%), Gaps = 4/195 (2%)

Query: 19  DVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGL 78
           + K ++  +AG++   +   V  P   L  + Q R  Y+    S +  ++K + L  G L
Sbjct: 136 ESKPTEKEIAGTLKKKVTFHVAKP-KQLSPQEQWRQVYSKYPSSNIFSVVKEIYLTRG-L 193

Query: 79  RSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSY 138
           R F +G +P     V     +F++Y+    L   T  +N ++ +  +G  +      ++ 
Sbjct: 194 RGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLISPTQPLN-EVYAFGIGLFSSCAVVALTQ 252

Query: 139 PTDVLRTRFIANQDVALSSLSHGCK-EIWNMEGIPGFFRGCTASMFTITLSASILFGTYE 197
           P DV++TR  +         S  C   ++  EG+   ++G    +F + LS  I FG Y+
Sbjct: 253 PIDVVKTRMQSKTAHYFYKNSLNCAYRVFVEEGMVSLWKGWLPRLFKVGLSGGISFGVYQ 312

Query: 198 SIKIYCDEYSKESDY 212
            ++       KE  +
Sbjct: 313 YVENLSHTLKKEKYF 327

 Score = 36.2 bits (82), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 44/219 (20%), Positives = 86/219 (39%), Gaps = 32/219 (14%)

Query: 123 LVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASM 182
           ++ G+ A +  + ++YP + L+T F       L   + G K    +  I  +F GCTA  
Sbjct: 12  ILAGSAAAVFETTLTYPFEFLKTGF------QLHRRTVGAKPFEALRPIKVYFAGCTALN 65

Query: 183 FTITLSASILFGTYE-SIKIYCDE-YSKESDYTNYLRYSASSISGVTSKMVTYPLDTIR- 239
            +  +  S+ F T++ + +I  D    K+S         A  ++G    +   P + ++ 
Sbjct: 66  LSAIVKTSVRFATFDKACQILRDPNLPKDSLLKGPRLLLAGILTGAVESLCIIPFENVKV 125

Query: 240 ----RRIQVRNSVYVQHNVE---NKIVT----------------EIYQSYKGASFIRMGL 276
                 +Q+  S   +  +     K VT                ++Y  Y  ++   +  
Sbjct: 126 TMIENSLQLSESKPTEKEIAGTLKKKVTFHVAKPKQLSPQEQWRQVYSKYPSSNIFSVVK 185

Query: 277 NILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
            I    GL    QG   ++ + V ++ V   AY T+ +L
Sbjct: 186 EIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQL 224

 Score = 34.3 bits (77), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 60/153 (39%), Gaps = 20/153 (13%)

Query: 163 KEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASS 222
           KEI+   G+ GF +G   ++F    ++++ F  Y ++K      S          +    
Sbjct: 185 KEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLK---QLISPTQPLNEVYAFGIGL 241

Query: 223 ISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQE 282
            S      +T P+D ++ R+Q + + Y   N  N                     +  +E
Sbjct: 242 FSSCAVVALTQPIDVVKTRMQSKTAHYFYKNSLN-----------------CAYRVFVEE 284

Query: 283 GLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
           G++SL++G    L K   S  +S   Y+ V  L
Sbjct: 285 GMVSLWKGWLPRLFKVGLSGGISFGVYQYVENL 317

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 103/233 (44%), Gaps = 40/233 (17%)

Query: 95  YGGAQFSS-------YSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRF 147
           YGG  F++        + ++N FGE +     L+S   G++ G+    V  P DVL+ + 
Sbjct: 89  YGGQPFANEFLNRNFKADFDNTFGEKTGK--ALRSATAGSMIGI-GEIVLLPLDVLKIKR 145

Query: 148 IANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYC---D 204
             N +   +    G  +I   EG+ G +RG   +       +  LFG     K Y     
Sbjct: 146 QTNPE---AFKGRGFVKILKDEGL-GLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLK 201

Query: 205 EYSKESDYTNYLRYSASSISGVTSKMV-TYPLDTIRRRIQVRNSVYVQHNVENKIVTEIY 263
           +YS+ +   N++    SSI G ++ ++ + PLD I+ RIQ         N EN       
Sbjct: 202 DYSQATWSQNFV----SSIVGASASLIISAPLDVIKTRIQ-------NKNFEN------- 243

Query: 264 QSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
               G + ++   N L+ EG  + ++G++  L  T P  V S    +T++ ++
Sbjct: 244 -PESGFTIVK---NTLKNEGFSAFFKGLTPKLLTTGPKLVFSFALAQTLIPVF 292

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 79/173 (45%), Gaps = 25/173 (14%)

Query: 21  KVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRP-SYTGQAPSGLLKMMKGMILNEG-GL 78
           K  +S  AGS+ G+    V+ PLD LKI+ Q  P ++ G+   G +K++K    +EG GL
Sbjct: 117 KALRSATAGSMIGI-GEIVLLPLDVLKIKRQTNPEAFKGR---GFVKILK----DEGLGL 168

Query: 79  RSFW----KGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSS 134
              W      N PG+  + L+GG  F+            +  +    S +VGA A +   
Sbjct: 169 YRGWGWTAARNAPGS--FALFGGNAFAKEYILGLKDYSQATWSQNFVSSIVGASASL--- 223

Query: 135 FVSYPTDVLRTRFIANQDVALSSLSHG---CKEIWNMEGIPGFFRGCTASMFT 184
            +S P DV++TR    Q+    +   G    K     EG   FF+G T  + T
Sbjct: 224 IISAPLDVIKTRI---QNKNFENPESGFTIVKNTLKNEGFSAFFKGLTPKLLT 273

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 82/331 (24%), Positives = 140/331 (42%), Gaps = 78/331 (23%)

Query: 39  VIAPLDTLKIRLQ-------------------LRP---SYTGQAPSGLLKMMK--GMILN 74
           V  P D +K RLQ                    RP   +Y  QA +   + +   G +  
Sbjct: 69  VTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVYK 128

Query: 75  EGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDM------NGQ---LQSLVV 125
           + G RS +KG  P      L G     S +F+   +G T DM      NGQ   +  L+ 
Sbjct: 129 QEGFRSLFKGLGPN-----LVGVIPARSINFFT--YGTTKDMYAKAFNNGQETPMIHLMA 181

Query: 126 GALAGMTSSFVSYPTDVLRTRFIANQ----DVALSSLSHGC-KEIWNMEGIPGFFRGCTA 180
            A AG  ++  + P  +++TR   ++     V     S  C K +   EG  G ++G +A
Sbjct: 182 AATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSA 241

Query: 181 SMFTITLSASILFGTYESIKIYCDEYSKE-------------SDYTNYLRYSASS-ISGV 226
           S +  ++   + +  YE +K    E S E                  + + S S+ ++  
Sbjct: 242 S-YLGSVEGILQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGLAKF 300

Query: 227 TSKMVTYPLDTIRRRIQVRNSVYVQHNVEN--KIVTEIYQSYKGASFIRMGLNILRQEGL 284
            + + TYP + +R R++       Q   EN  +  T + QS+K          I+++EGL
Sbjct: 301 VASIATYPHEVVRTRLR-------QTPKENGKRKYTGLVQSFK---------VIIKEEGL 344

Query: 285 LSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
            S+Y G++  L +TVP++++    +E V+RL
Sbjct: 345 FSMYSGLTPHLMRTVPNSIIMFGTWEIVIRL 375

 Score = 32.0 bits (71), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 24/40 (60%)

Query: 277 NILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
           N+ +QEG  SL++G+  +L   +P+  ++ + Y T   +Y
Sbjct: 125 NVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMY 164

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 90/208 (43%), Gaps = 38/208 (18%)

Query: 116 MNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFF 175
           +NG L SL+ GA AG ++  V +P D L+TR  A                +   G  G +
Sbjct: 2   LNGFLISLLSGAAAGTSTDLVFFPIDTLKTRLQAKGG------------FFRNGGYRGVY 49

Query: 176 RGCTASMFTITLSASILFGTYESIKIYCDEY-------SKESDYTNYLRYSASSISGVTS 228
           RG  +++      AS+ F TY++ K     +       S  +D   ++   +SS+  + +
Sbjct: 50  RGLGSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHM--FSSSMGEIAA 107

Query: 229 KMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLY 288
            MV  P + +++R Q   S     +   + + EI ++  G    R            +LY
Sbjct: 108 CMVRVPAEVVKQRSQTHAS-----HSSWETLREILKNENGEGVRR------------NLY 150

Query: 289 QGVSMSLCKTVPSTVVSLWAYETVMRLY 316
           +G S ++ + +P T +    YE + +++
Sbjct: 151 RGWSTTIMREIPFTCIQFPLYEYMKKVW 178

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 67/304 (22%), Positives = 119/304 (39%), Gaps = 54/304 (17%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKG 84
           SL++G+ +G     V  P+DTLK RLQ                 KG     GG R  ++G
Sbjct: 8   SLLSGAAAGTSTDLVFFPIDTLKTRLQ----------------AKGGFFRNGGYRGVYRG 51

Query: 85  -------NVPG-TMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFV 136
                  + PG ++ ++ Y   +  +  F+  L   +S++   +  +   ++  + +  V
Sbjct: 52  LGSAVVASAPGASLFFITYDTCKAETRGFFRGLL-PSSNVADVVTHMFSSSMGEIAACMV 110

Query: 137 SYPTDVLRTRFIANQDVALSSLSHGCKEIW---NMEGI-PGFFRGCTASMFTITLSASIL 192
             P +V++ R   +Q  A  S     +EI    N EG+    +RG + ++        I 
Sbjct: 111 RVPAEVVKQR---SQTHASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQ 167

Query: 193 FGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQV-RNSVYVQ 251
           F  YE +K    E  +      +      SI+G  +   T PLD ++ R+ + + S+ + 
Sbjct: 168 FPLYEYMKKVWAELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLMLCKKSIPL- 226

Query: 252 HNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYET 311
                 +V+ IY                ++EG    + GV            + L  YET
Sbjct: 227 ----GTLVSTIY----------------KEEGFKVFFSGVGPRTMWISAGGAIFLGIYET 266

Query: 312 VMRL 315
           V  L
Sbjct: 267 VHSL 270

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 41/88 (46%), Gaps = 7/88 (7%)

Query: 13  HLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMI 72
            L + + V+  +  V GS++G +A     PLD LK RL L         S  L  +   I
Sbjct: 180 ELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLML------CKKSIPLGTLVSTI 233

Query: 73  LNEGGLRSFWKGNVPGTMMYVLYGGAQF 100
             E G + F+ G  P T M++  GGA F
Sbjct: 234 YKEEGFKVFFSGVGPRT-MWISAGGAIF 260

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 63/321 (19%), Positives = 132/321 (41%), Gaps = 39/321 (12%)

Query: 4   IDDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSG 63
           +DD   + D+ R  +D+      ++G+  G+    V  P D  K+R+Q     T    + 
Sbjct: 11  VDDLSDSLDYKRAIKDI------LSGTAGGIAQVLVGQPFDITKVRMQ-----TSAGSAT 59

Query: 64  LLKMMKGMILNEGGLRSFWKGNVP-----GTMMYVLYGGAQFSSYSFYNNLFGETSDMNG 118
            + ++  +I NEG L  F+KG +      G  +   +G  +     F   + G+ S    
Sbjct: 60  AVDVVTSLIKNEGIL-GFYKGTLAPLVGVGACVSCQFGVNEAMKRRF-RRMNGDPSKPLS 117

Query: 119 QLQSLVVGALAGMTSSFVSYPTDVLRTRF-IANQDVALSSLSHGCKEIWNMEGIPGFFRG 177
             Q  V G  +G  ++F++ P + +R R  +  + +A +        +  +       RG
Sbjct: 118 LKQYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLLKQGALMRG 177

Query: 178 CTASMFTITLSASILFGTYESIKIYCDEYSK---ESDYTNYLRYSASSISGVTSKMVTYP 234
            TA++        I F TYE+  +  +++ K     D   +      + SG     + YP
Sbjct: 178 FTATLMRTCHGFGIYFSTYEA--LIANQHKKGIPRKDIAPWKVCIFGAFSGACYWAMAYP 235

Query: 235 LDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMS 294
           +D ++  +Q            +++V+ ++    G +  ++  +I    G  +  +G   +
Sbjct: 236 IDVVKSIMQ-----------SDRLVSPVH----GTNVWQVAKSIYTTRGKRAFIKGFMPA 280

Query: 295 LCKTVPSTVVSLWAYETVMRL 315
           + +++P    +   +E  MRL
Sbjct: 281 MLRSLPVNGATFATFEMTMRL 301

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 72/162 (44%), Gaps = 9/162 (5%)

Query: 40  IAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQ 99
           I+P + L +  +  P+      S     +K + L  G LR F +G  P     +     +
Sbjct: 252 ISPRERLFLHYEEHPT------SRFFSTVKEIYLTRG-LRGFVQGTAPTIFRQMGNSAVR 304

Query: 100 FSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLS 159
           F++Y+    L      +N +  + V+G ++      V+ P DV++TR  +    A    S
Sbjct: 305 FTTYTSLKQLISPNKPLN-EYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNS 363

Query: 160 HGCK-EIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIK 200
             C   I+  EGIP F++G    +  + LS  + FG Y+ ++
Sbjct: 364 LNCAYRIFVEEGIPKFWKGWAPRLMKVGLSGGVSFGVYQYVE 405

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 71/340 (20%), Positives = 117/340 (34%), Gaps = 80/340 (23%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGN 85
           +VAGS + +   T+  P + LK  LQL  S     P  ++   K        L      N
Sbjct: 98  IVAGSCASVFQTTISYPFEFLKTGLQLHRSLPNAHPFNMMHQFKYYFSGCAAL------N 151

Query: 86  VPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQS---LVVGALAGMTSSFVSYPTDV 142
           V GT+   +    +F+++     L  + S  +  +     L+ GA+ G   S    P + 
Sbjct: 152 V-GTLFKTV---TRFTTFEKACQLLKDPSSPSAFISGPRLLMAGAITGFMESLWVVPFEN 207

Query: 143 LRTRFIAN-----------------------------------------------QDVAL 155
           ++T  + N                                               ++   
Sbjct: 208 IKTTMVENALVLSGRFQKEIEDKGKAETGSKREVRATFHKQTPGISPRERLFLHYEEHPT 267

Query: 156 SSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNY 215
           S      KEI+   G+ GF +G   ++F    ++++ F TY S+K      S       Y
Sbjct: 268 SRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLK---QLISPNKPLNEY 324

Query: 216 LRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMG 275
             +    IS      VT P+D I+ R+Q   S Y   N +N               +   
Sbjct: 325 YAFVLGFISSCAVVAVTQPIDVIKTRMQ---SKYAWANYKNS--------------LNCA 367

Query: 276 LNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
             I  +EG+   ++G +  L K   S  VS   Y+ V  L
Sbjct: 368 YRIFVEEGIPKFWKGWAPRLMKVGLSGGVSFGVYQYVENL 407

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 36/85 (42%), Gaps = 3/85 (3%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKG 84
           + V G +S      V  P+D +K R+Q + ++     S         I  E G+  FWKG
Sbjct: 326 AFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYR---IFVEEGIPKFWKG 382

Query: 85  NVPGTMMYVLYGGAQFSSYSFYNNL 109
             P  M   L GG  F  Y +  NL
Sbjct: 383 WAPRLMKVGLSGGVSFGVYQYVENL 407

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 57/146 (39%), Gaps = 12/146 (8%)

Query: 117 NGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFR 176
           N  L  +V G+ A +  + +SYP + L+T    ++ +              M     +F 
Sbjct: 92  NSLLAPIVAGSCASVFQTTISYPFEFLKTGLQLHRSLP------NAHPFNMMHQFKYYFS 145

Query: 177 GCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLR-YSASSISGVTSKMVTYPL 235
           GC A            F T+E       + S  S + +  R   A +I+G    +   P 
Sbjct: 146 GCAALNVGTLFKTVTRFTTFEKACQLLKDPSSPSAFISGPRLLMAGAITGFMESLWVVPF 205

Query: 236 DTIRRRIQVRNSVYV----QHNVENK 257
           + I+  + V N++ +    Q  +E+K
Sbjct: 206 ENIKTTM-VENALVLSGRFQKEIEDK 230

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 75/341 (21%), Positives = 134/341 (39%), Gaps = 52/341 (15%)

Query: 1   MTNIDDGQHNTDHLRKGE--DVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTG 58
           +  ++D Q  T    K E    +V + + AG++ G+    V  P DT K+RLQ       
Sbjct: 11  LDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDTTKVRLQTA----- 65

Query: 59  QAPSGLLKMMKGMILNEGGLRSFWKGNVP-----GTMMYVLYGGAQFSSYSFYNNLFGET 113
              +  L++++ ++ NE G+ +F+KG +      G  + V +G  +     F N    + 
Sbjct: 66  TTRTTTLEVLRNLVKNE-GVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKN 124

Query: 114 SDMNGQ------------LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHG 161
            +M+ Q             Q  V G   G+ +SF++ P + +R R    Q    +     
Sbjct: 125 PNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRL---QTQTSNGGDRE 181

Query: 162 CKEIWN----MEGIPGFFRGCTASMFTITLSASILFGTYESI---KIYCDEYSKESDYTN 214
            K  W+    ++   G  RG   +M          F  YE++   +I       E     
Sbjct: 182 FKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWK 241

Query: 215 YLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRM 274
              + A   SG    +  YPLD ++  IQ  N    +   +N I      SY   +    
Sbjct: 242 LCLFGA--FSGTMLWLTVYPLDVVKSIIQ--NDDLRKPKYKNSI------SYVAKT---- 287

Query: 275 GLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
              I  +EG+ + ++G   ++ ++ P    +   +E VMR 
Sbjct: 288 ---IYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMRF 325

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 91/207 (43%), Gaps = 25/207 (12%)

Query: 13  HLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTG----QAPSGLLKMM 68
            L +   + +SQ  V G   G++   + +P++ ++IRLQ + S  G    + P   +K +
Sbjct: 133 DLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKL 192

Query: 69  KGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF------GETSDMNGQLQS 122
           K     +GGL    +G  P TM+   +G   +  +  Y  L       G T +     + 
Sbjct: 193 KA----QGGL---MRGLFP-TMIRAGHGLGTY--FLVYEALVAREIGTGLTRNEIPPWKL 242

Query: 123 LVVGALAGMTSSFVSYPTDVLRTRFIANQDVAL----SSLSHGCKEIWNMEGIPGFFRGC 178
            + GA +G       YP DV+++  I N D+      +S+S+  K I+  EGI  FF+G 
Sbjct: 243 CLFGAFSGTMLWLTVYPLDVVKS-IIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGF 301

Query: 179 TASMFTITLSASILFGTYESIKIYCDE 205
             +M          F T+E +  +  E
Sbjct: 302 GPTMVRSAPVNGATFLTFELVMRFLGE 328

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 79/186 (42%), Gaps = 15/186 (8%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLR-PSYTGQAPSGLLKMMKGMILNEGGLRSFWKG 84
           L A + +  LA  ++ P + +K++ Q   P +      G  K     I    GL   +KG
Sbjct: 116 LCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSK-----ITAAEGLSGLYKG 170

Query: 85  NVPGTMMYVLYGGAQFSSYS-----FYNNLFGETSDMNGQLQ---SLVVGALAGMTSSFV 136
             P     + Y   +F+S+       Y  L     +M+   Q   S V G LAG+  + V
Sbjct: 171 ITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVV 230

Query: 137 SYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTY 196
           S+P DV+ ++  A++     S+    K I++  G  G + G    +F I    S  +  Y
Sbjct: 231 SHPADVMVSKVNADRKQG-ESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIY 289

Query: 197 ESIKIY 202
           +S K Y
Sbjct: 290 DSFKAY 295

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 83/192 (43%), Gaps = 27/192 (14%)

Query: 129 AGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLS 188
            G T S V+ P D+++ R   N  +  S+L  G K I   EG+   F G  A+    +L 
Sbjct: 26  CGPTHSSVT-PLDLVKCRLQVNPQLYRSNLD-GWKTIVRSEGLSKVFTGVGATFIGYSLQ 83

Query: 189 ASILFGTYESIK-IYCDEYSKESDYTN----YLRYSASSISGVTSKMVTYPLDTIRRRIQ 243
            +  +G YE  K  Y +  S E+ + +    YL  SAS+     + ++  P + I+ + Q
Sbjct: 84  GACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASA--EFLADILLCPWEAIKVKQQ 141

Query: 244 VRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTV 303
                + ++                  F+     I   EGL  LY+G++   C+ +P T+
Sbjct: 142 TTIPPFCKN------------------FLEGWSKITAAEGLSGLYKGITPLWCRQIPYTM 183

Query: 304 VSLWAYETVMRL 315
               ++E ++ +
Sbjct: 184 CKFTSFERIVEM 195

 Score = 34.3 bits (77), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 47/227 (20%), Positives = 90/227 (39%), Gaps = 16/227 (7%)

Query: 27  VAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNV 86
           + G V+     + + PLD +K RLQ+ P    Q     L   K ++ +E GL   + G  
Sbjct: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNP----QLYRSNLDGWKTIVRSE-GLSKVFTGVG 74

Query: 87  PGTMMYVLYGGAQFSSYSF----YNNLFG-ETSDMNGQLQSLVVGALAGMTSSFVSYPTD 141
              + Y L G  ++  Y +    Y+NL   ET+  +     L   A A   +  +  P +
Sbjct: 75  ATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWE 134

Query: 142 VLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESI-- 199
            ++ +          +   G  +I   EG+ G ++G T             F ++E I  
Sbjct: 135 AIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVE 194

Query: 200 KIYCDEYSKESDYTNYLRYSASSI----SGVTSKMVTYPLDTIRRRI 242
            IY      + + +   +   S +    +G+   +V++P D +  ++
Sbjct: 195 MIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKV 241

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 77/197 (39%), Gaps = 26/197 (13%)

Query: 127 ALAGMTSSFVSY----PTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASM 182
           ALAG     +++    P DV++TR      V    +    K+I + EG      G   ++
Sbjct: 17  ALAGAIGCGITHSSMVPIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGAGALLTGFGPTL 76

Query: 183 FTITLSASILFGTYESIKIYCDE---YSKESDYTNYLRYSASSISGVTSKMVTYPLDTIR 239
              +L  S  FG YE  K    +   Y    +Y N +   +++I+   + +   PL+  R
Sbjct: 77  LGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATR 136

Query: 240 RRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTV 299
            R+        Q    N +            F R    IL++EG+ S Y G +  L K +
Sbjct: 137 IRL------VSQPTFANGLF---------GGFSR----ILKEEGVGSFYNGFTPILFKQI 177

Query: 300 PSTVVSLWAYETVMRLY 316
           P  +   + +E     Y
Sbjct: 178 PYNIAKFFVFEHAANAY 194

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 74/163 (45%), Gaps = 12/163 (7%)

Query: 27  VAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNV 86
           +AG++   +  + + P+D +K R+QL P+   +   G++   K +I +EG   +   G  
Sbjct: 18  LAGAIGCGITHSSMVPIDVVKTRIQLEPTVYNK---GMVSSFKQIISSEGA-GALLTGFG 73

Query: 87  PGTMMYVLYGGAQFSSYSFYNNL----FGETSDMNGQLQSLVVG--ALAGMTSSFVSYPT 140
           P  + Y L G  +F  Y  +  L     G  + +N +  ++ +G  A+A   +     P 
Sbjct: 74  PTLLGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYK-NTIYIGSAAIAEFFADIALCPL 132

Query: 141 DVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMF 183
           +  R R ++    A + L  G   I   EG+  F+ G T  +F
Sbjct: 133 EATRIRLVSQPTFA-NGLFGGFSRILKEEGVGSFYNGFTPILF 174

 Score = 35.4 bits (80), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 73/180 (40%), Gaps = 12/180 (6%)

Query: 28  AGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVP 87
           + +++   A   + PL+  +IRL  +P++      G  +     IL E G+ SF+ G  P
Sbjct: 117 SAAIAEFFADIALCPLEATRIRLVSQPTFANGLFGGFSR-----ILKEEGVGSFYNGFTP 171

Query: 88  GTMMYVLYGGAQFSSYSF----YNNLFGETSDMNGQLQSLV---VGALAGMTSSFVSYPT 140
                + Y  A+F  +      Y  L G    M+    + +    G  AG+ ++ VS P 
Sbjct: 172 ILFKQIPYNIAKFFVFEHAANAYFGLAGPKETMSETTHTAINLAAGLTAGLAAAVVSQPA 231

Query: 141 DVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIK 200
           D L ++    +     S      ++    G  G F G    +  +    S+ FG Y ++K
Sbjct: 232 DTLLSKVNKTKKAPGQSTIGLLAQLAKQLGFVGSFTGLPTRLVMVGTLTSLQFGIYGTLK 291

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 80/190 (42%), Gaps = 12/190 (6%)

Query: 12  DHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGL---LKMM 68
           + L   E +  + S V G V+  + +T          +  LR SY    P  L   +   
Sbjct: 132 NSLLSHERLNTTTSNVQGQVANEVKKT-------FHKKPTLRSSYEALFPEKLPTNVLTT 184

Query: 69  KGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGAL 128
              +  + GLR+++KG +P  M  V     +F++++     F      N +  + ++G +
Sbjct: 185 AAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQ-FAPKEYQNNEYFATLLGLI 243

Query: 129 AGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCK-EIWNMEGIPGFFRGCTASMFTITL 187
           +       + P DV++TR  A   V L   S  C   I+  EG    ++G    +  + L
Sbjct: 244 SSCAVVGATQPLDVIKTRMQAKDSVLLYRNSINCAYRIFVEEGFAMLWKGWLPRLMKVGL 303

Query: 188 SASILFGTYE 197
           S S+ FG Y+
Sbjct: 304 SGSVSFGIYQ 313

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/277 (20%), Positives = 107/277 (38%), Gaps = 59/277 (21%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGN 85
           + AGSVSGL + T+  P + LK  LQL  +     P  +L            +R+++ G 
Sbjct: 13  ITAGSVSGLFSATITYPFEFLKTGLQLHRNVVAAKPFEVLGYQ---------VRTYFAGC 63

Query: 86  VPGTMMYVLYGGAQFSSYS-----FYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPT 140
               +  V+    +F ++             + + ++G +Q L+ GAL G   S    P 
Sbjct: 64  SAVNIGVVMKTSLRFLAFDKASEWLRPPALAKDAPLSG-VQLLMAGALTGTMESLCIIPF 122

Query: 141 DVLRTRFIANQDVALSSLS------------------HG--------------------- 161
           + ++   I N  ++   L+                  H                      
Sbjct: 123 ENVKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEALFPEKLPTNVL 182

Query: 162 --CKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYS 219
               E++   G+  +F+G   ++     ++ + F T+  +K +  +  + ++Y   L   
Sbjct: 183 TTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKEYQNNEYFATLLGL 242

Query: 220 ASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVEN 256
            SS + V +   T PLD I+ R+Q ++SV +  N  N
Sbjct: 243 ISSCAVVGA---TQPLDVIKTRMQAKDSVLLYRNSIN 276

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/217 (17%), Positives = 98/217 (45%), Gaps = 32/217 (14%)

Query: 114 SDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPG 173
           + +N  +  +  G+++G+ S+ ++YP + L+T    +++V    ++    E+   + +  
Sbjct: 4   NKVNDNVTLITAGSVSGLFSATITYPFEFLKTGLQLHRNV----VAAKPFEVLGYQ-VRT 58

Query: 174 FFRGCTASMFTITLSASILFGTYESIKIYC--DEYSKESDYTNYLRYSASSISGVTSKMV 231
           +F GC+A    + +  S+ F  ++    +      +K++  +      A +++G    + 
Sbjct: 59  YFAGCSAVNIGVVMKTSLRFLAFDKASEWLRPPALAKDAPLSGVQLLMAGALTGTMESLC 118

Query: 232 TYPLDTIRRRIQVRNSVYVQH-------NVENKIVTEIYQSYKGASFIR----------M 274
             P + ++  + ++NS+           NV+ ++  E+ +++     +R          +
Sbjct: 119 IIPFENVKVAM-IQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEALFPEKL 177

Query: 275 GLNIL-------RQEGLLSLYQGVSMSLCKTVPSTVV 304
             N+L       RQ GL + ++G   +L + V ++VV
Sbjct: 178 PTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVV 214

 Score = 29.3 bits (64), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 27/73 (36%), Gaps = 9/73 (12%)

Query: 42  PLDTLKIRLQLRPS---YTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGA 98
           PLD +K R+Q + S   Y               I  E G    WKG +P  M   L G  
Sbjct: 254 PLDVIKTRMQAKDSVLLYRNSINCAY------RIFVEEGFAMLWKGWLPRLMKVGLSGSV 307

Query: 99  QFSSYSFYNNLFG 111
            F  Y +  N+  
Sbjct: 308 SFGIYQYTENMIA 320

>Scas_328.1
          Length = 227

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 75/147 (51%), Gaps = 21/147 (14%)

Query: 163 KEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDY-TNYLRYSAS 221
           K+    +G+ G +RG   S+  I +   + FG Y+S+K      S E+ +  ++L   A 
Sbjct: 87  KKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLTGSFENAFLPSFLLGWAV 146

Query: 222 SISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQ 281
           +IS  T+   +YPLDT+RRR+ + +   V+              YKGA  I     I+ Q
Sbjct: 147 TISASTT---SYPLDTVRRRMMMTSGQAVK--------------YKGA--IDCFQQIVSQ 187

Query: 282 EGLLSLYQGVSMSLCKTVPST-VVSLW 307
           EG+ SL++G   ++ + V +  V+SL+
Sbjct: 188 EGVYSLFKGCGANIFRGVAAAGVISLY 214

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 64/133 (48%), Gaps = 3/133 (2%)

Query: 62  SGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQ 121
           +G+L + K  +  +G L   ++G +P  +  ++Y G  F  Y     +    S  N  L 
Sbjct: 80  NGILDVYKKTLFTDGVL-GLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLTGSFENAFLP 138

Query: 122 SLVVGALAGMTSSFVSYPTDVLRTRFI--ANQDVALSSLSHGCKEIWNMEGIPGFFRGCT 179
           S ++G    +++S  SYP D +R R +  + Q V         ++I + EG+   F+GC 
Sbjct: 139 SFLLGWAVTISASTTSYPLDTVRRRMMMTSGQAVKYKGAIDCFQQIVSQEGVYSLFKGCG 198

Query: 180 ASMFTITLSASIL 192
           A++F    +A ++
Sbjct: 199 ANIFRGVAAAGVI 211

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 83/198 (41%), Gaps = 36/198 (18%)

Query: 120 LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCT 179
           + SLV GA AG ++    +P D L+TR  A         ++G        G  G +RG  
Sbjct: 7   IASLVSGAAAGTSTDLAFFPIDTLKTRLQAKGGF----FANG--------GYKGVYRGLG 54

Query: 180 ASMFTITLSASILFGTYESIKIYCDEY------SKESDYTNYLRYSASSISG-VTSKMVT 232
           +++     SAS+ F  Y+S+K +            E    + L +  SS  G +++ MV 
Sbjct: 55  SAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEISACMVR 114

Query: 233 YPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVS 292
            P + I++R Q   +     N   + +  + ++  G    R            +LY+G S
Sbjct: 115 VPAEVIKQRTQTHRT-----NSSLQTLQALLRNENGEGLRR------------NLYRGWS 157

Query: 293 MSLCKTVPSTVVSLWAYE 310
            ++ + +P T +    YE
Sbjct: 158 TTIMREIPFTCIQFPLYE 175

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/303 (21%), Positives = 114/303 (37%), Gaps = 48/303 (15%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKG 84
           SLV+G+ +G        P+DTLK RLQ                 KG     GG +  ++G
Sbjct: 9   SLVSGAAAGTSTDLAFFPIDTLKTRLQ----------------AKGGFFANGGYKGVYRG 52

Query: 85  -------NVP-GTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQ-LQSLVVGALAGMTSSF 135
                  + P  ++ +V Y   +  S      L  +  D     L  +V  +   +++  
Sbjct: 53  LGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEISACM 112

Query: 136 VSYPTDVLRTRFIANQ-DVALSSLSHGCKEIWNMEGI-PGFFRGCTASMFTITLSASILF 193
           V  P +V++ R   ++ + +L +L    +   N EG+    +RG + ++        I F
Sbjct: 113 VRVPAEVIKQRTQTHRTNSSLQTLQALLRNE-NGEGLRRNLYRGWSTTIMREIPFTCIQF 171

Query: 194 GTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHN 253
             YE +K    E   +     +       I+G  +   T PLD ++ RI +         
Sbjct: 172 PLYEYMKKRWAEVQGKERAAPWQGSVCGCIAGGIAAAATTPLDVLKTRIMLH-------- 223

Query: 254 VENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVM 313
                       +K  S + +   +L++EG+   + GV            + L  YETV 
Sbjct: 224 ------------HKSVSALHLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYETVH 271

Query: 314 RLY 316
            L+
Sbjct: 272 SLF 274

>Kwal_23.2913
          Length = 320

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/312 (19%), Positives = 127/312 (40%), Gaps = 45/312 (14%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQL-RPSYTGQAPSGLLKMMKG----MILNEGGL 78
           +SL AG V G+ A     P D LK+R Q  + S T  A S +L   K     + LN+  +
Sbjct: 30  ESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAISRVLHEAKSKSGPLPLNQ--I 87

Query: 79  RSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF----GETSDMNGQLQSL---------VV 125
           + F++G +P  +         F  Y     L        +D+ G    L         + 
Sbjct: 88  KGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQLALA 147

Query: 126 GALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTI 185
           G  + + ++ ++ PT+ ++   +  Q     S     + +    G+   F+G  A++   
Sbjct: 148 GFFSAIPTTLITAPTERVK---VVLQTSESGSFLGAARTLIREGGVRSLFQGTLATLARD 204

Query: 186 TLSASILFGTYESIKIYCDEYSKESDYTNYLRYS-ASSISGVTSKMVTYPLDTIRRRIQV 244
              +++ F +YE  K +    ++++D  + +    A  ++G++  +  +P+DTI+ ++Q 
Sbjct: 205 GPGSALYFASYEVSKRFLSR-NQDTDALSVVSICVAGGVAGMSMWIGVFPIDTIKTKLQ- 262

Query: 245 RNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVV 304
                               S +  S ++    I  + GL   + G+  +L ++ P+   
Sbjct: 263 -------------------SSSRSQSMVQAAREIYTRAGLRGFFPGLGPALMRSFPANAA 303

Query: 305 SLWAYETVMRLY 316
           +    E   +L+
Sbjct: 304 TFLGVEFTHQLF 315

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/214 (21%), Positives = 85/214 (39%), Gaps = 39/214 (18%)

Query: 120 LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDV----ALSSLSHGCKE---IWNMEGIP 172
            +SL  G + G+ +    +P D+L+ R  +NQ      A+S + H  K       +  I 
Sbjct: 29  FESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAISRVLHEAKSKSGPLPLNQIK 88

Query: 173 GFFRGCTASMFTITLSASILFGTYE-----------SIKIYCDEYSKESDYTNYLRYSAS 221
           GF+RG    +  +T   ++ F  Y+            +       SK +  T      A 
Sbjct: 89  GFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQLALAG 148

Query: 222 SISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQ 281
             S + + ++T P +    R++V                 + Q+ +  SF+     ++R+
Sbjct: 149 FFSAIPTTLITAPTE----RVKV-----------------VLQTSESGSFLGAARTLIRE 187

Query: 282 EGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
            G+ SL+QG   +L +  P + +   +YE   R 
Sbjct: 188 GGVRSLFQGTLATLARDGPGSALYFASYEVSKRF 221

>Kwal_0.232
          Length = 274

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 75/177 (42%), Gaps = 16/177 (9%)

Query: 28  AGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGG---LRSFWKG 84
           AG ++  + R    P + +K R Q   S +       L+ +K ++ NE G    R+ ++G
Sbjct: 104 AGEIAACMVRV---PAEVIKQRTQTHKSDSS------LQTLKKLLQNENGEGIRRNLYRG 154

Query: 85  NVPGTMMYVLYGGAQFSSYSFYNNLFGETS--DMNGQLQSLVVGALAGMTSSFVSYPTDV 142
                M  + +   QF  Y F    +  +   +     Q    G +AG  ++  + P DV
Sbjct: 155 WSTTVMREIPFTCIQFPLYEFLKKQWAISGGREQVAPWQGAFCGCVAGGIAAATTTPLDV 214

Query: 143 LRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESI 199
           L+TR + +       + H  ++I+  EG   FF G       I+   +I  G YE++
Sbjct: 215 LKTRLMLSHTSV--PVLHLARQIYATEGWKVFFSGVGPRTVWISAGGAIFLGVYETV 269

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 105/247 (42%), Gaps = 16/247 (6%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKG 84
           SL+AG+ +G        P+DTLK RLQ    +   A  G L + +       GL S    
Sbjct: 9   SLLAGAAAGTSTDLFFFPIDTLKTRLQAAGGFF--ANGGYLGVYR-------GLGSAVVA 59

Query: 85  NVP-GTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAG-MTSSFVSYPTDV 142
           + P  ++ +V Y G +  S   +NNL   +SD   +  + +  + AG + +  V  P +V
Sbjct: 60  SAPSASLFFVTYDGMKSYSRPIFNNLI-TSSDQVAETATHMFSSSAGEIAACMVRVPAEV 118

Query: 143 LRTRFIANQ-DVALSSLSHGCKEIWNMEGI-PGFFRGCTASMFTITLSASILFGTYESIK 200
           ++ R   ++ D +L +L    +   N EGI    +RG + ++        I F  YE +K
Sbjct: 119 IKQRTQTHKSDSSLQTLKKLLQNE-NGEGIRRNLYRGWSTTVMREIPFTCIQFPLYEFLK 177

Query: 201 IYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQV-RNSVYVQHNVENKIV 259
                         +       ++G  +   T PLD ++ R+ +   SV V H       
Sbjct: 178 KQWAISGGREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSHTSVPVLHLARQIYA 237

Query: 260 TEIYQSY 266
           TE ++ +
Sbjct: 238 TEGWKVF 244

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 87/208 (41%), Gaps = 35/208 (16%)

Query: 115 DMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGF 174
           D +  + SL+ GA AG ++    +P D L+TR  A    A    ++G        G  G 
Sbjct: 2   DRSSFITSLLAGAAAGTSTDLFFFPIDTLKTRLQA----AGGFFANG--------GYLGV 49

Query: 175 FRGCTASMFTITLSASILFGTYESIKIYCDEY------SKESDYTNYLRYSASSISGVTS 228
           +RG  +++     SAS+ F TY+ +K Y          S +          +SS   + +
Sbjct: 50  YRGLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIAA 109

Query: 229 KMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLY 288
            MV  P + I++R Q   S     +   + + ++ Q+  G    R            +LY
Sbjct: 110 CMVRVPAEVIKQRTQTHKS-----DSSLQTLKKLLQNENGEGIRR------------NLY 152

Query: 289 QGVSMSLCKTVPSTVVSLWAYETVMRLY 316
           +G S ++ + +P T +    YE + + +
Sbjct: 153 RGWSTTVMREIPFTCIQFPLYEFLKKQW 180

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 41/83 (49%), Gaps = 7/83 (8%)

Query: 18  EDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGG 77
           E V   Q    G V+G +A     PLD LK RL L  S+T   P  +L + + +   E G
Sbjct: 187 EQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLML--SHT-SVP--VLHLARQIYATE-G 240

Query: 78  LRSFWKGNVPGTMMYVLYGGAQF 100
            + F+ G  P T +++  GGA F
Sbjct: 241 WKVFFSGVGPRT-VWISAGGAIF 262

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/309 (20%), Positives = 134/309 (43%), Gaps = 43/309 (13%)

Query: 21  KVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRS 80
           K  + +++G+  G+    V  P D  K+R+Q     T       ++++K ++ NE GL +
Sbjct: 22  KAIKDIISGTSGGIAQVLVGQPFDITKVRMQ-----TSSGSPTAIEVIKNLVKNE-GLLA 75

Query: 81  FWKGNVPGTMMYVLYGGA----QFSSYSFYNNLFGETSDMNGQ----LQSLVVGALAGMT 132
           F+K    GT++ ++  GA    QF         F   +    Q    LQ    G ++G  
Sbjct: 76  FYK----GTLVPLIGVGACVSCQFGVNEAMKRYFLRVNGYKDQHLSLLQYYTCGFVSGSA 131

Query: 133 SSFVSYPTDVLRTRFIANQDVALSSLSH----GC-KEIWNMEGIPGFFRGCTASMFTITL 187
           ++F++ P + +R R +  Q  AL+   +     C K++   + +    RG TA++   + 
Sbjct: 132 NAFLATPIEHVRIR-LQLQTKALAKAEYRGSLDCMKKLLKQKAL---MRGFTATLMRTSH 187

Query: 188 SASILFGTYESIKIYCDEYSK-ESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRN 246
              + F TYE++ +  ++      D   +      + SG     +TYP D ++  +Q   
Sbjct: 188 GFGVYFLTYEALIMNQNKNGVLRKDIPPWKVCVFGAFSGAFFWAMTYPFDVVKSIMQA-- 245

Query: 247 SVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSL 306
                    +++V+ ++    G +  ++  +I    G  +  +G   ++ +++P    + 
Sbjct: 246 ---------DRLVSPVH----GKNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGATF 292

Query: 307 WAYETVMRL 315
             +E  MRL
Sbjct: 293 ATFEVTMRL 301

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 78/196 (39%), Gaps = 25/196 (12%)

Query: 16  KGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP-SGLLKMMKGMILN 74
           K + + + Q    G VSG     +  P++ ++IRLQL+     +A   G L  MK ++  
Sbjct: 112 KDQHLSLLQYYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQ 171

Query: 75  EGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQS-------LVVGA 127
           +  +R F       T+M   +G   F  Y           + NG L+         V GA
Sbjct: 172 KALMRGF-----TATLMRTSHG---FGVYFLTYEALIMNQNKNGVLRKDIPPWKVCVFGA 223

Query: 128 LAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHG------CKEIWNMEGIPGFFRGCTAS 181
            +G     ++YP DV+++   A++   L S  HG       K I    G   F +G   +
Sbjct: 224 FSGAFFWAMTYPFDVVKSIMQADR---LVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPT 280

Query: 182 MFTITLSASILFGTYE 197
           M          F T+E
Sbjct: 281 MLRSLPVNGATFATFE 296

>Scas_562.12
          Length = 300

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 97/223 (43%), Gaps = 39/223 (17%)

Query: 95  YGGAQFSSYSF-------YNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRF 147
           YGG  F++          +++ FGE +     ++S   G+L G+    V  P DVL+ + 
Sbjct: 90  YGGQPFANEFLNKHYKKDFDSAFGEKTGK--AMRSATAGSLIGI-GEIVLLPLDVLKIKR 146

Query: 148 IANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYC---D 204
             N +   +    G  +I   EGI   +RG   +       +  LFG     K Y    +
Sbjct: 147 QTNPE---AFKGRGFVKILKDEGIFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLE 203

Query: 205 EYSKESDYTNYLRYSASSISGVT-SKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIY 263
           +YS+ S   N++    SSI G + S +V+ PLD I+ RIQ R+      N E        
Sbjct: 204 DYSQASWSQNFI----SSIVGASCSLIVSAPLDVIKTRIQNRSF----DNPET------- 248

Query: 264 QSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSL 306
               G + ++   N  + EG+ + ++G++  L  T P  V S 
Sbjct: 249 ----GLTIVK---NTFKNEGITAFFKGLTPKLLTTGPKLVFSF 284

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 4/65 (6%)

Query: 23  SQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFW 82
           SQ+ ++  V    +  V APLD +K R+Q R   +   P   L ++K    NE G+ +F+
Sbjct: 211 SQNFISSIVGASCSLIVSAPLDVIKTRIQNR---SFDNPETGLTIVKNTFKNE-GITAFF 266

Query: 83  KGNVP 87
           KG  P
Sbjct: 267 KGLTP 271

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 70/181 (38%), Gaps = 22/181 (12%)

Query: 139 PTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYES 198
           P DV++TR      V    +    K+I   EG      G   ++   ++  +  FG YE 
Sbjct: 37  PIDVVKTRIQLEPTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGYEV 96

Query: 199 IK-IYCDE--YSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVE 255
            K  + D   Y   S Y N +   +++++   + +   PL+  R R+        Q    
Sbjct: 97  FKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRL------VSQPQFA 150

Query: 256 NKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
           N +V           F R    IL++EG+ S Y G +  L K +P  +     +E     
Sbjct: 151 NGLV---------GGFSR----ILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFERASEF 197

Query: 316 Y 316
           Y
Sbjct: 198 Y 198

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 72/174 (41%), Gaps = 12/174 (6%)

Query: 34  LLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYV 93
            LA   + PL+  +IRL  +P +      G  +     IL E G+ SF+ G  P     +
Sbjct: 127 FLADIALCPLEATRIRLVSQPQFANGLVGGFSR-----ILKEEGIGSFYSGFTPILFKQI 181

Query: 94  LYGGAQFSSY----SFYNNLFG---ETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTR 146
            Y  A+F  +     FY    G   + S  +  L +L+ G  AG+ ++ VS P D L ++
Sbjct: 182 PYNIAKFLVFERASEFYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSK 241

Query: 147 FIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIK 200
               +     S      ++    G  G F G    +  +    S+ FG Y S+K
Sbjct: 242 VNKTKKAPGQSTVGLLAQLAKQLGFFGSFAGLPTRLVMVGTLTSLQFGIYGSLK 295

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 96/238 (40%), Gaps = 15/238 (6%)

Query: 27  VAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNV 86
           +AG++      + + P+D +K R+QL P+   +   G++   K +I  EG   +   G  
Sbjct: 22  LAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNK---GMVGSFKQIIAGEGA-GALLTGFG 77

Query: 87  PGTMMYVLYGGAQFSSYS-----FYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTD 141
           P  + Y + G  +F  Y      F +NL  +T+        +   A+A   +     P +
Sbjct: 78  PTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLE 137

Query: 142 VLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKI 201
             R R ++    A + L  G   I   EGI  F+ G T  +F         F  +E    
Sbjct: 138 ATRIRLVSQPQFA-NGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFERASE 196

Query: 202 YCDEYS--KE---SDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNV 254
           +   ++  KE   S  T  L   +   +G+ + +V+ P DT+  ++        Q  V
Sbjct: 197 FYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQSTV 254

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 118 GQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGC-KEIWNMEGIPGFFR 176
           G  Q+ +VGAL+G+ + + + P D ++TR  A  D A    + GC + +   EG+   +R
Sbjct: 210 GSGQTFLVGALSGIVTVYATMPVDTVKTRMQA-LDAARYGSTVGCFRAVVREEGVRALWR 268

Query: 177 GCTASMFTITLSASILFGTYESIKI 201
           G T  +  + LS  I+F  YE + +
Sbjct: 269 GATPRLGRLVLSGGIVFTAYEKLLV 293

 Score = 35.4 bits (80), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 64/313 (20%), Positives = 130/313 (41%), Gaps = 33/313 (10%)

Query: 15  RKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILN 74
           R  E    ++S VAG+ +G +   V  P +  K RLQL    +G++ + L+ + +     
Sbjct: 3   RSREGADAARSFVAGAAAGAIEGCVTYPFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQ 62

Query: 75  EGGLRSFWKGNVPGTMMYVLYGGAQFSSY-SFYNNLFGETSDMNGQLQSLVVGALAGMTS 133
             G  + + G     +      G +F  + +    L  E   ++G  + ++ G  AG+  
Sbjct: 63  GAG--ALYVGCPAFVVGNTCKAGVRFLGFDALRRALQDERGALSGP-RGMLAGLGAGLLE 119

Query: 134 SFVSY-PTDVLRTRFIANQDVALSSLSH---GCKEIWNMEGIPGFFRGCTASMFTITL-- 187
           S ++  P + ++T  I ++  A     H   G    + +       RG    +  + L  
Sbjct: 120 SVLAVTPFEAVKTALIDDRQAARPRYQHNGRGAARNYALLLRELGLRGLYGGLVPVALRQ 179

Query: 188 --SASILFGTYESIKIYCDEYS---KESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRI 242
             + ++ FG Y  +K     Y+    +    +   +   ++SG+ +   T P+DT++ R+
Sbjct: 180 ASNQAVRFGCYTQLKQAVQRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRM 239

Query: 243 QVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPST 302
           Q  ++               Y S  G         ++R+EG+ +L++G +  L + V S 
Sbjct: 240 QALDAAR-------------YGSTVGCF-----RAVVREEGVRALWRGATPRLGRLVLSG 281

Query: 303 VVSLWAYETVMRL 315
            +   AYE ++ L
Sbjct: 282 GIVFTAYEKLLVL 294

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 70/329 (21%), Positives = 131/329 (39%), Gaps = 76/329 (23%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQ-------------------APSGL 64
           +S ++G+V+  +A TV+ PLD +K  +Q +     Q                    P   
Sbjct: 5   ESALSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVP 64

Query: 65  LKMMKG-------------MILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFG 111
           +K+ +               I  + G+R  ++G     M       + F  YSF    + 
Sbjct: 65  IKLNENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYF 124

Query: 112 ETSDMNGQ------LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDV-ALSSLSHGCKE 164
               +N +      ++ L++G +A  TS   + P  ++  R    Q +   +      KE
Sbjct: 125 RVKLINRKNTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDFLTVAKE 184

Query: 165 IWNME-GIPGFFRGCTASMFTITLSASILFGTYESIKI-------------YCDEYSKES 210
           I+  +  I GF++G   S+  +T++ SI + +YE +K                D  S+ S
Sbjct: 185 IYKEQRSIKGFWKGLKVSLM-LTINPSITYTSYEKLKDALFTTDTMNLKKELVDSSSQLS 243

Query: 211 DYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGAS 270
            Y N+   +   +S + S ++T PL        + +  ++Q N  N            +S
Sbjct: 244 PYQNF---TLGVLSKMISAIITMPL--------IISKAWLQRNGSN-----------FSS 281

Query: 271 FIRMGLNILRQEGLLSLYQGVSMSLCKTV 299
           F ++   + + EGL S ++G+S  L K V
Sbjct: 282 FQQVLYYLYKNEGLRSWWKGLSPQLAKGV 310

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 95/214 (44%), Gaps = 48/214 (22%)

Query: 116 MNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFF 175
           MN    SL+ GA AG ++  V +P D ++TR  A         ++G        G  G +
Sbjct: 1   MNTFFLSLLSGAAAGTSTDLVFFPIDTIKTRLQAKGGF----FANG--------GYKGIY 48

Query: 176 RGCTASMFTITLSASILFGTYESIKIYCDE-----YSKES----DYTNYLRYSASSISGV 226
           RG  +++      AS+ F +Y+ +K+         YS+ S    D T ++   +SSI  +
Sbjct: 49  RGLGSAVVASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHML--SSSIGEI 106

Query: 227 TSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILR---QEG 283
            + +V  P + +++R QV ++      ++                     +ILR   +EG
Sbjct: 107 CACLVRVPAEVVKQRTQVHSTNSSWQTLQ---------------------SILRNDNKEG 145

Query: 284 LL-SLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
           L  +LY+G S ++ + +P T +    YE + + +
Sbjct: 146 LRKNLYRGWSTTIMREIPFTCIQFPLYEYLKKTW 179

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/302 (21%), Positives = 121/302 (40%), Gaps = 48/302 (15%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKG 84
           SL++G+ +G     V  P+DT+K RLQ                 KG     GG +  ++G
Sbjct: 7   SLLSGAAAGTSTDLVFFPIDTIKTRLQ----------------AKGGFFANGGYKGIYRG 50

Query: 85  -------NVPG-TMMYVLYGGAQFSSYSFYNNLFGETSD-MNGQLQSLVVGALAGMTSSF 135
                  + PG ++ ++ Y   +  S  + + L+ + S+ +      ++  ++  + +  
Sbjct: 51  LGSAVVASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACL 110

Query: 136 VSYPTDVLRTRF-IANQDVALSSLSHGCKEIWNMEGI-PGFFRGCTASMFTITLSASILF 193
           V  P +V++ R  + + + +  +L    +   N EG+    +RG + ++        I F
Sbjct: 111 VRVPAEVVKQRTQVHSTNSSWQTLQSILRND-NKEGLRKNLYRGWSTTIMREIPFTCIQF 169

Query: 194 GTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHN 253
             YE +K    + + +S    +      SI+G  +   T PLD ++ R+ +         
Sbjct: 170 PLYEYLKKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLML--------- 220

Query: 254 VENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVM 313
             NK    +     G+  IR    I R+EG    + GV            + L  YETV 
Sbjct: 221 --NKTTASL-----GSVIIR----IYREEGPAVFFSGVGPRTMWISAGGAIFLGMYETVH 269

Query: 314 RL 315
            L
Sbjct: 270 SL 271

>Scas_702.10
          Length = 302

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 67/260 (25%), Positives = 100/260 (38%), Gaps = 27/260 (10%)

Query: 29  GSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPG 88
           G  +G+ A  +  PLD  K+RLQ  P      P   L  M   IL    +   + G    
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAP-----LPKPTLGRMLTTILRNENVMGLYSGLSAA 70

Query: 89  TMMYVLYGGAQFSSYSFYN-NLF--GETSDMNGQLQ-SLVVGALAGMTSSFVSYPTDVLR 144
            +    Y   +F +Y     NL   G  +DM   L  S+  GA+ G+  +F     DV+ 
Sbjct: 71  VLRQCTYTTVRFGAYDLMKENLIPQGHINDMVYLLPCSMFSGAIGGLVGNF----ADVVN 126

Query: 145 TRFIANQDVALS--------SLSHGCKEIWNME-GIPGFFRGCTASMFTITLSASILFGT 195
            R     D AL         +   G  +I+  E GI     G   +M    L  +    T
Sbjct: 127 IRM--QNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQVVT 184

Query: 196 YESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVE 255
           Y+  K Y           N    SAS ++G+ +  +  P D I+ RI   N+   +    
Sbjct: 185 YDVFKNYLVTKLSFDPKKNSTHLSASLLAGLVATTICSPADVIKTRIM--NAHKTESESA 242

Query: 256 NKIVTEIYQSYKGASFIRMG 275
            KI+T   +  +G SF+  G
Sbjct: 243 IKILTSAIKK-EGPSFMFRG 261

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 37/87 (42%), Gaps = 19/87 (21%)

Query: 224 SGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEG 283
           +G+ + ++T+PLD  + R+Q                          +  RM   ILR E 
Sbjct: 19  AGIFACVMTHPLDLAKVRLQA-------------------APLPKPTLGRMLTTILRNEN 59

Query: 284 LLSLYQGVSMSLCKTVPSTVVSLWAYE 310
           ++ LY G+S ++ +    T V   AY+
Sbjct: 60  VMGLYSGLSAAVLRQCTYTTVRFGAYD 86

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 78/182 (42%), Gaps = 27/182 (14%)

Query: 123 LVVGALAGMTSSFVSYPTDVLRTRFI------ANQDVALSSLSHGCKEIWNMEGIPGFFR 176
            V GA AG++   V YP DV++TR            VA + +     +I   EG    ++
Sbjct: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71

Query: 177 GCTASMFTITLSASILFGTYESI-KIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPL 235
           G ++ M       +  F   +S  K++ D Y  +   T  +   + S++GVT   V  P 
Sbjct: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLYGVD-KLTQQISILSGSLAGVTEACVIVPF 130

Query: 236 DTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSL 295
           + ++ R+Q  NS   + N   ++V                   +R+ G+LSLY G+  ++
Sbjct: 131 ELVKIRLQDVNS---KFNGPMEVV----------------FKTIRETGILSLYNGLESTM 171

Query: 296 CK 297
            +
Sbjct: 172 WR 173

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 66/301 (21%), Positives = 125/301 (41%), Gaps = 26/301 (8%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLR---PSYTGQAPSGLLKMMKGMILNEGGLRSFW 82
            V+G+ +G+    V+ PLD +K R+QL+    + +G A +G++  + G I+   G    +
Sbjct: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCL-GQIVKREGFSRLY 70

Query: 83  KGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQ--SLVVGALAGMTSSFVSYPT 140
           KG     +M       +F+    Y  +F +   ++   Q  S++ G+LAG+T + V  P 
Sbjct: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPF 130

Query: 141 DVLRTRFIANQDVALSSLSHGCKEI----WNMEGIPGFFRGCTASMFTITLSASILFGTY 196
           ++++ R    QDV  +S  +G  E+        GI   + G  ++M+         FG  
Sbjct: 131 ELVKIRL---QDV--NSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVI 185

Query: 197 ESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLD-TIRRRIQVRNSVYVQHNVE 255
             I+    +       TN  + +   I+G       Y  + TI   ++ R        + 
Sbjct: 186 FQIRALLPKAK-----TNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLA 240

Query: 256 NKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
           +  V   Y     + F      I  +EG  +LY+G    + +  P   + L  +  +M  
Sbjct: 241 DGTVVPKYNWTWPSLF-----KIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAF 295

Query: 316 Y 316
           +
Sbjct: 296 F 296

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQ 51
           S+++GS++G+    VI P + +KIRLQ
Sbjct: 112 SILSGSLAGVTEACVIVPFELVKIRLQ 138

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 44.7 bits (104), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 50/104 (48%), Gaps = 12/104 (11%)

Query: 209 ESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKG 268
           + +  N  + +  +ISG  ++ + YP D +RRR QV      +     K V++       
Sbjct: 5   DPNLANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSD------- 57

Query: 269 ASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETV 312
            + I +G    + EG    Y+G++ +L K +PST VS   YE +
Sbjct: 58  -ALITIG----KTEGPKGYYKGLTANLFKVIPSTAVSWLVYEVI 96

 Score = 44.7 bits (104), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 49/95 (51%), Gaps = 7/95 (7%)

Query: 113 TSDMN-GQLQSLVVGALAGMTSSFVSYPTDVLRTRF----IANQDVAL--SSLSHGCKEI 165
            +D N   L  L +GA++G  +  + YP D+LR RF    +   ++     S+S     I
Sbjct: 3   VTDPNLANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITI 62

Query: 166 WNMEGIPGFFRGCTASMFTITLSASILFGTYESIK 200
              EG  G+++G TA++F +  S ++ +  YE I+
Sbjct: 63  GKTEGPKGYYKGLTANLFKVIPSTAVSWLVYEVIR 97

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 85/197 (43%), Gaps = 36/197 (18%)

Query: 120 LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCT 179
           L SLV GA AG ++  V +P D L+TR  A                ++  G  G +RG  
Sbjct: 6   LASLVSGAAAGTSTDVVFFPIDTLKTRLQAKGG------------FFHNGGYRGIYRGLG 53

Query: 180 ASMFTITLSASILFGTYESIK----IYCDEYSKESDYTNYLRYS-ASSISGVTSKMVTYP 234
           +++      AS+ F TY+S+K         ++        L +  +SS+  +++ +V  P
Sbjct: 54  SAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVRVP 113

Query: 235 LDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLL-SLYQGVSM 293
            + I++R Q        H+  + + T           +R+ L     EG++  LY+G   
Sbjct: 114 AEVIKQRTQT-------HHTNSSLQT-----------LRLILRDPTGEGVVRGLYRGWWT 155

Query: 294 SLCKTVPSTVVSLWAYE 310
           ++ + +P T +    YE
Sbjct: 156 TIMREIPFTCIQFPLYE 172

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/300 (19%), Positives = 113/300 (37%), Gaps = 44/300 (14%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKG 84
           SLV+G+ +G     V  P+DTLK RLQ                 KG   + GG R  ++G
Sbjct: 8   SLVSGAAAGTSTDVVFFPIDTLKTRLQ----------------AKGGFFHNGGYRGIYRG 51

Query: 85  -------NVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVS 137
                  + PG  ++ +   +           +  +  +   L  ++  +L  M++  V 
Sbjct: 52  LGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVR 111

Query: 138 YPTDVLRTRFIANQ-DVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTY 196
            P +V++ R   +  + +L +L    ++      + G +RG   ++        I F  Y
Sbjct: 112 VPAEVIKQRTQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQFPLY 171

Query: 197 ESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVEN 256
           E +K     Y++    + +      S++G  +   T PLD ++ R+ +          E 
Sbjct: 172 EYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLH---------ER 222

Query: 257 KIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
           ++             + +   + R+EG    ++G+            + L  YE V  L+
Sbjct: 223 RV-----------PMLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVYEAVHSLF 271

 Score = 35.0 bits (79), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 8/94 (8%)

Query: 18  EDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGG 77
           E V   Q  V GS++G +A     PLD LK R+ L   +  + P  +L + + +   EG 
Sbjct: 185 ERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMML---HERRVP--MLHLARTLFREEGA 239

Query: 78  LRSFWKGNVPGTMMYVLYGGAQF-SSYSFYNNLF 110
            R F++G  P T M++  GGA F   Y   ++LF
Sbjct: 240 -RVFFRGIGPRT-MWISAGGAIFLGVYEAVHSLF 271

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 71/307 (23%), Positives = 129/307 (42%), Gaps = 54/307 (17%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLK--IRLQLRPSYTGQAPSGLL---KMMKGM------I 72
           +S + G+V+  +A   + PLD  K  I+ Q+ PS +  +  G +   +  K +      I
Sbjct: 5   ESALTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINI 64

Query: 73  LNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFY------NNLFGETSDMN-------GQ 119
             E G+   ++G    T+   +     F  Y+F       + L G  S  N         
Sbjct: 65  FKEKGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPITPST 124

Query: 120 LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIW--NMEGIPGFFRG 177
           ++ LV+G  A   S   + P  V+ TR         +  ++  K+I+  N   I  F++G
Sbjct: 125 IEELVLGVAAASISQLFTSPMAVVATRQQTVHSAESAKFTNVIKDIYRENNGDITAFWKG 184

Query: 178 CTASMFTITLSASILFGTYESIK-IYCDEYSKESDYTNYLRYSASSISGVTSKM----VT 232
               +  +T++ SI + +++ +K ++  ++S ++   + ++   + I GV SKM    VT
Sbjct: 185 LRTGL-ALTINPSITYASFQRLKEVFFHDHSNDAGSLSAVQ---NFILGVLSKMISTLVT 240

Query: 233 YPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVS 292
            PL   +  +Q   S                   K  +F    L + + EGL SL++GV 
Sbjct: 241 QPLIVAKAMLQSAGS-------------------KFTTFQEALLYLYKNEGLKSLWKGVL 281

Query: 293 MSLCKTV 299
             L K V
Sbjct: 282 PQLTKGV 288

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 39/90 (43%), Gaps = 5/90 (5%)

Query: 12  DHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGM 71
           DH      +   Q+ + G +S +++  V  PL   K  LQ   S        LL + K  
Sbjct: 212 DHSNDAGSLSAVQNFILGVLSKMISTLVTQPLIVAKAMLQSAGSKFTTFQEALLYLYK-- 269

Query: 72  ILNEGGLRSFWKGNVPGTMMYVLYGGAQFS 101
             NEG L+S WKG +P     V+  G  F+
Sbjct: 270 --NEG-LKSLWKGVLPQLTKGVIVQGLLFA 296

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 47/96 (48%), Gaps = 5/96 (5%)

Query: 222 SISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNV-ENKIVTEIYQSYKGASFIRMGLNILR 280
           +++   + +  YPLD  +  IQ + S     +  E K++    + YK    +   +NI +
Sbjct: 11  AVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPN--RRYKNV--VDCMINIFK 66

Query: 281 QEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316
           ++G+L LYQG++++   T     V  + Y  + + Y
Sbjct: 67  EKGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSY 102

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 70/181 (38%), Gaps = 22/181 (12%)

Query: 139 PTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYES 198
           P DV++TR      V    +    ++I   EG      G   ++   ++  +  FG YE 
Sbjct: 33  PIDVVKTRIQLEPTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGYEV 92

Query: 199 IKIYCDE---YSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVE 255
            K +  +   Y   + Y N +   +++ +   + +   PL+  R R+        Q    
Sbjct: 93  FKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRL------VSQPTFA 146

Query: 256 NKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
           N +V           F R    IL++EG+ S Y G +  L K +P  +     +E    L
Sbjct: 147 NGLV---------GGFSR----ILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASEL 193

Query: 316 Y 316
           Y
Sbjct: 194 Y 194

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 69/174 (39%), Gaps = 12/174 (6%)

Query: 34  LLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYV 93
            LA   + PL+  +IRL  +P++      G  +     IL E G+ SF+ G  P     +
Sbjct: 123 FLADIALCPLEATRIRLVSQPTFANGLVGGFSR-----ILKEEGVGSFYSGFTPILFKQI 177

Query: 94  LYGGAQFSSYSFYNNLFGETSDMNGQLQ-------SLVVGALAGMTSSFVSYPTDVLRTR 146
            Y  A+F  +   + L+   +     L        +L+ G  AG+ ++ VS P D L ++
Sbjct: 178 PYNIAKFLVFERASELYFSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSK 237

Query: 147 FIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIK 200
                     S      ++    G  G F G    +  +    S+ FG Y  +K
Sbjct: 238 VNKTSKAPGQSTVGLLFQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYGQLK 291

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/238 (20%), Positives = 94/238 (39%), Gaps = 15/238 (6%)

Query: 27  VAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNV 86
           +AG++      + + P+D +K R+QL P+   +   G  +     I+ E G  +   G  
Sbjct: 18  LAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFR----KIIAEEGAGALLTGFG 73

Query: 87  PGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQ---SLVVG--ALAGMTSSFVSYPTD 141
           P  + Y + G  +F  Y  +   F +T   +   +   S+ +G  A A   +     P +
Sbjct: 74  PTLLGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLE 133

Query: 142 VLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKI 201
             R R ++    A + L  G   I   EG+  F+ G T  +F         F  +E    
Sbjct: 134 ATRIRLVSQPTFA-NGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASE 192

Query: 202 YCDEYSKESDYTNYLRYSASSI-----SGVTSKMVTYPLDTIRRRIQVRNSVYVQHNV 254
                +   D  +    +A ++     +G+ + +V+ P DT+  ++   +    Q  V
Sbjct: 193 LYFSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSKVNKTSKAPGQSTV 250

>Kwal_23.5757
          Length = 307

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 77/185 (41%), Gaps = 16/185 (8%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRLQ--LRPSYTGQAPSGLLKMMKGMILNEGGLRSFWK 83
           L A + +  +A   + P + +K+R Q  + P +         KM     +   G  S +K
Sbjct: 120 LAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKM-----VGAEGFASLYK 174

Query: 84  GNVPGTMMYVLYGGAQFSSYS-----FYNNLFGETSDMN--GQLQ-SLVVGALAGMTSSF 135
           G  P     + Y   +F+S+       Y  L     +M+  GQ+  S   G LAG+  + 
Sbjct: 175 GITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAV 234

Query: 136 VSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGT 195
           VS+P DV+ ++ + N+  +  S       I+   G PG + G    +  I    S  +  
Sbjct: 235 VSHPADVMVSK-VNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLI 293

Query: 196 YESIK 200
           Y+S K
Sbjct: 294 YDSFK 298

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 80/189 (42%), Gaps = 22/189 (11%)

Query: 130 GMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSA 189
           G T S V+ P D+++ R   +  +  S+L  G ++I   EG    F G  A+    +L  
Sbjct: 31  GPTHSAVT-PLDLVKCRRQVDASLYKSNLD-GWRQIVRSEGATKVFTGVGATAIGYSLQG 88

Query: 190 SILFGTYESIK-IYCDEYSKES--DYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRN 246
           +  +G YE  K  Y    S E+   Y   +  +AS+ +   + +   P + I+ R Q   
Sbjct: 89  AFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQT-- 146

Query: 247 SVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSL 306
                  V       ++ +Y           ++  EG  SLY+G++    + +P T+   
Sbjct: 147 ------AVPPPFARNVFDAYS---------KMVGAEGFASLYKGITPLWFRQIPYTMCKF 191

Query: 307 WAYETVMRL 315
            ++E ++ +
Sbjct: 192 TSFERIVEM 200

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 87/201 (43%), Gaps = 30/201 (14%)

Query: 119 QLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGC 178
           +L   + G+L G  S  V+YP   + T     ++ A   L    KEI+N  GI G+F G 
Sbjct: 11  ELAHAIAGSLGGAASIAVTYPLVTITTNLQTKENEARPKL-ETIKEIYNKNGIIGYFLGL 69

Query: 179 TASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYL----RYSASSISGVTSKMVTYP 234
            ++++ +  +  + +  YE    +C + ++      YL       AS+I+G  + + + P
Sbjct: 70  ESAVYGMATTNFVYYYFYE----WCAKTARTLTTKQYLSTWESILASTIAGSMTAVASNP 125

Query: 235 LDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMS 294
           +     R+ V  S +                    S +R  ++I++ +G L+L  G+  +
Sbjct: 126 IWVANTRMTVAKSNH--------------------STLRTVIDIVKTDGPLTLLNGLKPA 165

Query: 295 LCKTVPSTVVSLWAYETVMRL 315
           L   V + ++    YE +  L
Sbjct: 166 LV-LVSNPIIQYTVYEQLKNL 185

 Score = 32.7 bits (73), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 59/290 (20%), Positives = 121/290 (41%), Gaps = 40/290 (13%)

Query: 19  DVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGL 78
           DV      +AGS+ G  +  V  PL T+   LQ + +   +A   L  + +  I N+ G+
Sbjct: 8   DVDELAHAIAGSLGGAASIAVTYPLVTITTNLQTKEN---EARPKLETIKE--IYNKNGI 62

Query: 79  RSFWKGNVPGTMMYVLYGGA--QFSSYSFYNNLFGETSDMNGQ-----LQSLVVGALAGM 131
             ++ G     +   +YG A   F  Y FY         +  +      +S++   +AG 
Sbjct: 63  IGYFLG-----LESAVYGMATTNFVYYYFYEWCAKTARTLTTKQYLSTWESILASTIAGS 117

Query: 132 TSSFVSYPTDVLRTRFIANQDVALSSLS--HGCKEIWNMEGIPGFFRGCTASMFTITLSA 189
            ++  S P  V  TR      VA S+ S      +I   +G      G   ++  ++ + 
Sbjct: 118 MTAVASNPIWVANTRM----TVAKSNHSTLRTVIDIVKTDGPLTLLNGLKPALVLVS-NP 172

Query: 190 SILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVY 249
            I +  YE +K       ++   +    +   +I  + +   TYP  T++ R+ +     
Sbjct: 173 IIQYTVYEQLKNLVLRLQRKKVLSPSWAFLLGAIGKLAATGTTYPYITLKTRMHL----- 227

Query: 250 VQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTV 299
           +Q++ +++            S   + + I++++G+  LY GV++ L +++
Sbjct: 228 MQNDPKHQ-----------KSMWSLIVEIVKKDGVSGLYNGVAVKLVQSI 266

>Kwal_23.3529
          Length = 395

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/307 (20%), Positives = 117/307 (38%), Gaps = 25/307 (8%)

Query: 22  VSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPS--GLLKMMKGMILNEGGLR 79
           ++  +VAG + G +  +V+  LDT+K R Q  P+    AP    ++   + + + EG  R
Sbjct: 85  IAHCIVAGGIGGAIGDSVMHSLDTVKTRQQGAPN----APKYRNMISAYQKIFMEEGIRR 140

Query: 80  SFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYP 139
             + G     +         F +Y        +   +N  L  L  G    + SS V  P
Sbjct: 141 GLYGGYTAAMLGSFPSAAIFFGTYELTKRKLIDDWGVNETLSHLTAGLSGDLVSSVVYVP 200

Query: 140 TDVLRTRFIA---------NQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSAS 190
           ++VL+TR            +      +L      I  +EG    F G  A++      ++
Sbjct: 201 SEVLKTRLQLQGCYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSA 260

Query: 191 ILFGTYESIKIYC---DEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNS 247
             F  YE  + +    +  +   D +        + +G  + ++T P+D I+ RIQ +  
Sbjct: 261 FQFAFYEKFRQWAFTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMP 320

Query: 248 VYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLW 307
             V  +    +  E        S I+    + R EG L  + GV      T   + + L 
Sbjct: 321 STVASDSTRLVRIE-------NSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLL 373

Query: 308 AYETVMR 314
            Y+  ++
Sbjct: 374 LYQVTLK 380

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 104/206 (50%), Gaps = 26/206 (12%)

Query: 120 LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDV-ALSSLSHGCKEIWNMEGIPGFFRGC 178
           ++ L++  LA  TS   + P +++ T+    + +   +S     KE+++ +GI GF++  
Sbjct: 151 IEELLLSMLAAATSQLFTNPINIVSTKQQTRRGLEGDNSFKAIAKEVYDEDGITGFWKSL 210

Query: 179 TASMFTITLSASILFGTYESIK--IYCDEYSKE--SDYTNYLRYSASSISGVTSKMV--- 231
             S+  +T++ SI + + E +K  +Y  E++ +  +D +  L+   + + GV SK++   
Sbjct: 211 KVSL-VLTINPSITYASAEKLKDILYHVEWNAKDLNDSSLQLKPGQNFLIGVLSKIISTC 269

Query: 232 -TYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQ-------EG 283
            T+PL   +  +Q  +S +       +++T +Y+ ++GA  +  GL  L Q       +G
Sbjct: 270 LTHPLIVAKASLQRSSSKFTSF---QEVLTYLYR-HEGAHALWKGL--LPQLTKGVIVQG 323

Query: 284 LLSLYQGVSMSLCKTVPSTVVSLWAY 309
           LL +++G    L K +   +  L  Y
Sbjct: 324 LLFMFKG---ELAKHIKKLLFLLQVY 346

>Kwal_55.21338
          Length = 323

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 87/185 (47%), Gaps = 27/185 (14%)

Query: 121 QSLVVGALAGMTSSFVSYPTDVLRTRFIANQDV--ALSSLSHGCKEIWNMEGIPGFFRGC 178
           +S++VG++AG  ++  + P  V  TR    +     LS++    K+    EGI G F+G 
Sbjct: 120 ESMLVGSIAGSLNATAANPLWVANTRMTVQKSDRGTLSTIFDIVKD----EGISGLFKGL 175

Query: 179 TASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMV----TYP 234
             ++  + ++  I +  YE +K     +   S  T  L  S + I G   K+     TYP
Sbjct: 176 NPALI-LVINPIIQYTVYEQLK----NWILSSRQTRTLSPSWAFILGAVGKLAATGSTYP 230

Query: 235 LDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMS 294
             T++ R+ +          E+K  T    +    S + +   I++++G+L LY+G+ + 
Sbjct: 231 YVTMKARMHLLG--------EHKSST----AAPPRSLLSLMAEIIKKDGILGLYRGIGIK 278

Query: 295 LCKTV 299
           L +++
Sbjct: 279 LVQSI 283

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 85/196 (43%), Gaps = 15/196 (7%)

Query: 15  RKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILN 74
           R  + +  ++S++ GS++G L  T   PL     R+ ++ S       G L  +  ++ +
Sbjct: 111 RHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQKS-----DRGTLSTIFDIVKD 165

Query: 75  EGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNN--LFGETSDMNGQLQSLVVGALAGMT 132
           EG +   +KG  P  ++ V+    Q++ Y    N  L    +       + ++GA+  + 
Sbjct: 166 EG-ISGLFKGLNPA-LILVINPIIQYTVYEQLKNWILSSRQTRTLSPSWAFILGAVGKLA 223

Query: 133 SSFVSYPTDVLRTRF------IANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTIT 186
           ++  +YP   ++ R        ++      SL     EI   +GI G +RG    +    
Sbjct: 224 ATGSTYPYVTMKARMHLLGEHKSSTAAPPRSLLSLMAEIIKKDGILGLYRGIGIKLVQSI 283

Query: 187 LSASILFGTYESIKIY 202
           L+A+ LF   E + I+
Sbjct: 284 LTAAFLFFFKEGLVIW 299

 Score = 35.0 bits (79), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 69/162 (42%), Gaps = 23/162 (14%)

Query: 136 VSYPTDVLRTRFIANQDVALS--SLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILF 193
           ++YP  V+ T+ +  QD      SL+   K+I+  +G  GFF G  +++F  TLS  + +
Sbjct: 39  LTYPLIVVTTK-LQTQDAKGEKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYY 97

Query: 194 GTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHN 253
             YE+              T        SI+G  +     PL     R+ V+ S      
Sbjct: 98  YCYEASSRCVLRARHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQKS------ 151

Query: 254 VENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSL 295
            +   ++ I+             +I++ EG+  L++G++ +L
Sbjct: 152 -DRGTLSTIF-------------DIVKDEGISGLFKGLNPAL 179

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 66/168 (39%), Gaps = 22/168 (13%)

Query: 27  VAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGM------ILNEGGLRS 80
           +AG++      + + P+D +K R+QL P          LK   GM      I+ E G  +
Sbjct: 20  LAGAIGCGATHSAMVPIDVVKTRIQLEP----------LKYSSGMVGSFRKIVGEEGAAA 69

Query: 81  FWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQ---SLVVG--ALAGMTSSF 135
              G  P  + Y + G  +F  Y  +   F +        Q    + +G  A+A   +  
Sbjct: 70  LLTGFGPTLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADI 129

Query: 136 VSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMF 183
              P +  R R ++    A + L  G   I   EGI  F+ G T  +F
Sbjct: 130 ALCPLEATRIRLVSQPTFA-NGLVGGFARILKEEGIGSFYNGFTPILF 176

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 68/181 (37%), Gaps = 22/181 (12%)

Query: 139 PTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYES 198
           P DV++TR         S +    ++I   EG      G   ++   ++  +  FG YE 
Sbjct: 35  PIDVVKTRIQLEPLKYSSGMVGSFRKIVGEEGAAALLTGFGPTLLGYSMQGAFKFGGYEV 94

Query: 199 IK-IYCDE--YSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVE 255
            K  + D   Y     Y   +   +++I+   + +   PL+  R R+        Q    
Sbjct: 95  FKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLEATRIRL------VSQPTFA 148

Query: 256 NKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
           N +V           F R    IL++EG+ S Y G +  L K +P  +     +E     
Sbjct: 149 NGLV---------GGFAR----ILKEEGIGSFYNGFTPILFKQIPYNIAKFVVFEHAANA 195

Query: 316 Y 316
           Y
Sbjct: 196 Y 196

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 68/181 (37%), Gaps = 18/181 (9%)

Query: 30  SVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPGT 89
           +++   A   + PL+  +IRL  +P++      G  +     IL E G+ SF+ G  P  
Sbjct: 121 AIAEFFADIALCPLEATRIRLVSQPTFANGLVGGFAR-----ILKEEGIGSFYNGFTPIL 175

Query: 90  MMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSS----------FVSYP 139
              + Y  A+F  +    N +     + G  ++L   A  G+              +S P
Sbjct: 176 FKQIPYNIAKFVVFEHAANAY---FGLAGSKENLSTTAATGINLLAGLTAGLAAAVISQP 232

Query: 140 TDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESI 199
            D L ++    +     S      ++    G  G F G    +  +    S+ FG Y  +
Sbjct: 233 ADTLLSKVNKTKKAPGQSTFGLLMQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYGKL 292

Query: 200 K 200
           K
Sbjct: 293 K 293

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 75/150 (50%), Gaps = 11/150 (7%)

Query: 114 SDMNGQLQS-LVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNM-EGI 171
           SD N  L S L+ G+ A +  + +S+P + L+T     Q +   SL +   E +NM   +
Sbjct: 2   SDTNPSLYSNLLAGSAAAVFQTTLSHPFEFLKT----GQQLH-RSLPNA--EAFNMFHHV 54

Query: 172 PGFFRGCTASMFTITLSASILFGTYE-SIKIYCDEYSKESDYTNYLRYSASSISGVTSKM 230
             +F GC+A    I L  +  F T++ + ++  D  + E+  +     +A SI+G    M
Sbjct: 55  KSYFAGCSALNIGILLKTATRFATFDKACQLLKDPENPEAPVSGLRLIAAGSITGFMESM 114

Query: 231 VTYPLDTIRRRIQVRNSVYVQHNVENKIVT 260
           +  P + I+ R+ + N++ + +  + ++ T
Sbjct: 115 LIIPFENIKTRM-IENALILSNRYQEEVET 143

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/177 (19%), Positives = 78/177 (44%), Gaps = 9/177 (5%)

Query: 30  SVSGLLARTVIAPLDTLKIRLQLRPSYTG-----QAPS-GLLKMMKGMILNEGGLRSFWK 83
           SV+ +  +  I P    +++ ++ P Y       + PS  +   ++ M+   G   +F++
Sbjct: 153 SVNNMETKEQIRPKLYKQVKKEINPRYEKFLYYEKHPSTNIFTTVREMVQTRG-FTTFFQ 211

Query: 84  GNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVL 143
           G++P     V     +F++Y+    +      ++ +  +  +G  +      ++ P DV+
Sbjct: 212 GSMPTIFRQVGNSAVRFTTYTTLKQMISPNKPLS-EYYAFGIGVFSSCAVVALTQPIDVV 270

Query: 144 RTRFIANQDVALSSLSHGC-KEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESI 199
           +TR  +    +L   S  C    +  EG+   ++G    +F + LS  + FG Y+ +
Sbjct: 271 KTRMQSKYTWSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLFKVGLSGGVSFGVYQYV 327

 Score = 35.8 bits (81), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 35/81 (43%), Gaps = 3/81 (3%)

Query: 29  GSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPG 88
           G  S      +  P+D +K R+Q +  YT       L  +    + EG L S WKG VP 
Sbjct: 253 GVFSSCAVVALTQPIDVVKTRMQSK--YTWSLYRNSLNCVYRTFIEEG-LTSLWKGWVPR 309

Query: 89  TMMYVLYGGAQFSSYSFYNNL 109
                L GG  F  Y + +NL
Sbjct: 310 LFKVGLSGGVSFGVYQYVDNL 330

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 65/153 (42%), Gaps = 20/153 (13%)

Query: 163 KEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASS 222
           +E+    G   FF+G   ++F    ++++ F TY ++K      S     + Y  +    
Sbjct: 198 REMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLK---QMISPNKPLSEYYAFGIGV 254

Query: 223 ISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQE 282
            S      +T P+D ++ R+Q + +  +  N  N +       Y+  +FI        +E
Sbjct: 255 FSSCAVVALTQPIDVVKTRMQSKYTWSLYRNSLNCV-------YR--TFI--------EE 297

Query: 283 GLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
           GL SL++G    L K   S  VS   Y+ V  L
Sbjct: 298 GLTSLWKGWVPRLFKVGLSGGVSFGVYQYVDNL 330

>Kwal_47.19228
          Length = 281

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 62/153 (40%), Gaps = 20/153 (13%)

Query: 163 KEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASS 222
           +EI+   GI GF +G   ++   T ++++ F TY S+K      S       Y  ++   
Sbjct: 136 QEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLK---QMISPNKPLNEYYAFALGF 192

Query: 223 ISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQE 282
           IS      VT P+D I+ R+Q   S Y   N +N               +     I  +E
Sbjct: 193 ISSCAVVAVTQPIDVIKTRMQ---SKYTWSNYKNS--------------LNCAYRIFVEE 235

Query: 283 GLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
           G    ++G +  L K   S  VS   Y+ V  L
Sbjct: 236 GFTKFWKGWAPRLMKVGLSGGVSFGVYQYVDNL 268

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 40/95 (42%), Gaps = 6/95 (6%)

Query: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKG 84
           +   G +S      V  P+D +K R+Q +  YT       L     + + EG    FWKG
Sbjct: 187 AFALGFISSCAVVAVTQPIDVIKTRMQSK--YTWSNYKNSLNCAYRIFVEEG-FTKFWKG 243

Query: 85  NVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQ 119
             P  M   L GG  F  Y + +NL      +NGQ
Sbjct: 244 WAPRLMKVGLSGGVSFGVYQYVDNLM---KAVNGQ 275

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/267 (20%), Positives = 114/267 (42%), Gaps = 22/267 (8%)

Query: 42  PLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGA--Q 99
           PL T+  +LQ + +         L+ +K  I  + GL  F+ G     +   +YG A   
Sbjct: 33  PLVTITTKLQTQGNDENNQVKSKLETIKE-IYRKDGLLGFYAG-----LESAIYGMALTN 86

Query: 100 FSSYSFY-----NNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIA--NQD 152
           F  Y FY     N L          L+S++ G +AG  ++  S P  V  TR     ++ 
Sbjct: 87  FVYYYFYELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKSEK 146

Query: 153 VALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDY 212
            AL+++     EI   +     F G   ++  + ++  + +  +E +K     ++K+   
Sbjct: 147 TALATII----EIVKKDSAKTLFNGLKPAL-VLVMNPIVQYTVFEQLKNLVLAWNKQGIL 201

Query: 213 TNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFI 272
           +    +   ++  + +   TYP  T++ R+ +  S   +H  ++             S +
Sbjct: 202 SPSWAFLLGALGKLAATGSTYPYITLKTRMHLSESG--KHTDDDSGKKAKGHKASSKSML 259

Query: 273 RMGLNILRQEGLLSLYQGVSMSLCKTV 299
            +   I++++G+  LY+GV + L +++
Sbjct: 260 SLITEIVKKDGVSGLYRGVGIKLAQSI 286

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 41/213 (19%), Positives = 88/213 (41%), Gaps = 27/213 (12%)

Query: 9   HNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMM 68
            N   +RK + +   +S++ G V+G +      P+     R+    + T    + L  ++
Sbjct: 98  RNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRM----TVTKSEKTALATII 153

Query: 69  KGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQ---SLVV 125
           +  I+ +   ++ + G  P  ++ V+    Q++ +    NL     +  G L    + ++
Sbjct: 154 E--IVKKDSAKTLFNGLKPA-LVLVMNPIVQYTVFEQLKNLV-LAWNKQGILSPSWAFLL 209

Query: 126 GALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCK----------------EIWNME 169
           GAL  + ++  +YP   L+TR   ++    +    G K                EI   +
Sbjct: 210 GALGKLAATGSTYPYITLKTRMHLSESGKHTDDDSGKKAKGHKASSKSMLSLITEIVKKD 269

Query: 170 GIPGFFRGCTASMFTITLSASILFGTYESIKIY 202
           G+ G +RG    +    L+A+ LF   E + ++
Sbjct: 270 GVSGLYRGVGIKLAQSILTAAFLFFFKEGLVLW 302

 Score = 28.9 bits (63), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 37/87 (42%), Gaps = 15/87 (17%)

Query: 228 SKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSL 287
           S  +TYPL TI  ++Q       Q N EN  V    ++ K          I R++GLL  
Sbjct: 27  SMALTYPLVTITTKLQT------QGNDENNQVKSKLETIK---------EIYRKDGLLGF 71

Query: 288 YQGVSMSLCKTVPSTVVSLWAYETVMR 314
           Y G+  ++     +  V  + YE   R
Sbjct: 72  YAGLESAIYGMALTNFVYYYFYELTSR 98

>Scas_705.9
          Length = 323

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/304 (21%), Positives = 126/304 (41%), Gaps = 48/304 (15%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLK--IRLQLRPSYTGQAPSGLLKMMKG--------MIL 73
           +S + G+++  +A  ++ PLD  K  I+ + +   T +      ++++          I 
Sbjct: 5   ESAITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIF 64

Query: 74  NEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLF--------GETSDMNG--QLQSL 123
            + GLR  ++G         +     F  YSF    +         +   +N    ++ L
Sbjct: 65  RKRGLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINSISTVEEL 124

Query: 124 VVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEG--IPGFFRGCTAS 181
           +VG  A   +  V+ P +V+ T+     D          K+I+      +  +++G   S
Sbjct: 125 IVGVGAAALTQVVNNPIEVILTKQQTTDDKDNVDFYSVLKQIYVESNGKLSSYWKGFKVS 184

Query: 182 MFTITLSASILFGTYESIK-IYCDEYSK-ESDYTNYLRYSASSISGVTSKMV----TYPL 235
           +  +T++ SI F  Y+  K I   + S  E  Y+  L  + + I G  +K++    T PL
Sbjct: 185 LI-LTVNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGALAKIISTIITQPL 243

Query: 236 DTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSL 295
              +  +Q  NS + +H  E  ++  +Y                ++EG+L+L++GV   L
Sbjct: 244 IVAKVSLQRSNSKF-KHFEE--VLRYLY----------------KEEGVLALWKGVGPQL 284

Query: 296 CKTV 299
            K V
Sbjct: 285 TKGV 288

 Score = 32.0 bits (71), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 42/96 (43%), Gaps = 6/96 (6%)

Query: 222 SISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQ 281
           +I+   + ++ YPLD  +  IQ          +  K    + Q     + IR  + I R+
Sbjct: 11  AIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQE----NVIRCLIRIFRK 66

Query: 282 EGLLSLYQGVSMSL-CKTVPSTVVSLWAYETVMRLY 316
            GL  LYQG+S S+  K V S     W Y  + R Y
Sbjct: 67  RGLRGLYQGMSTSVFSKFVQSFCYFFW-YSFLRRKY 101

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 16/80 (20%)

Query: 120 LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSS--LSHGCKEIWNME-------- 169
           L+S + GA+A   ++ + YP DV +T  I ++  A  +  LS   K I   E        
Sbjct: 4   LESAITGAIASTMANVIVYPLDVAKT-VIQSETKAKETDELSEKDKRILRQENVIRCLIR 62

Query: 170 -----GIPGFFRGCTASMFT 184
                G+ G ++G + S+F+
Sbjct: 63  IFRKRGLRGLYQGMSTSVFS 82

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 68/311 (21%), Positives = 122/311 (39%), Gaps = 63/311 (20%)

Query: 24  QSLVAGSVSGLLARTVIAPLDTLK--IRLQLRPSYTGQAPS------------------G 63
           +S   G+V+  LA T + PLD  K  I+ Q + + +G +                    G
Sbjct: 5   ESAFTGAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRG 64

Query: 64  LLKMMKGMILN------EGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMN 117
            L + +G+  N      +  +  FW   +         G  Q    S +  L        
Sbjct: 65  FLGLYQGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIEL-------- 116

Query: 118 GQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEG--IPGFF 175
             ++ L +G  AG  +  V+ P  V+ TR    +D   +SL    K+I+      +  F+
Sbjct: 117 STIEELALGMSAGAMTQVVTNPISVISTRQQLTKDGEDASLKAVIKQIYEESNGDLTAFW 176

Query: 176 RGCTASMFTITLSASILFGTYESIK---IYCDEYSKESDYTNYLRYSASSISGVTSKM-- 230
           +G   ++  ++ + +I +G+Y+ +K   +     S     +  L    + + G+ SKM  
Sbjct: 177 KGFKVAL-VLSTNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGMFSKMIS 235

Query: 231 --VTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLY 288
             VT PL   +  +Q + S +       K   E+ Q            +I + EG LSL+
Sbjct: 236 TFVTQPLIVAKITLQGKGSKF-------KTFQEVLQ------------HIYQNEGFLSLW 276

Query: 289 QGVSMSLCKTV 299
           +GV   + K V
Sbjct: 277 KGVIPQVSKGV 287

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 15/106 (14%)

Query: 207 SKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSY 266
           S ES +T  +   ASS++  T     YPLD  +  IQ       QH   +   ++  + Y
Sbjct: 3   SLESAFTGAV---ASSLAATT----VYPLDLAKTLIQT------QHKNADSGDSKEEEKY 49

Query: 267 KGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETV 312
           K    I   + I ++ G L LYQG++ ++        +  + Y  +
Sbjct: 50  KNV--IDCIIKIFKKRGFLGLYQGLATNVAANFVQNFIYFFWYSLI 93

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/218 (19%), Positives = 82/218 (37%), Gaps = 44/218 (20%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKI-----------RLQLRPSY------TGQAPSGLLKMM 68
           L+AG+++G L    + P +++K            R+Q  P         G AP       
Sbjct: 114 LLAGAITGFLESLWVVPFESIKTTAVENALELSRRVQGEPETRAAAVSKGPAPKATFHAA 173

Query: 69  KGM-------------------------ILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSY 103
           + +                         I    G+R F +G +P     +     +F++Y
Sbjct: 174 RPVQTAHERWLLHYERQPSSHFAGTVLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTY 233

Query: 104 SFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCK 163
           ++          ++ + Q+   GAL+      ++ P DV++TR  +         S  C 
Sbjct: 234 AWIVQSLSPHKALD-EYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCA 292

Query: 164 -EIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIK 200
             I+  EG    ++G    +F ++LS  I FG Y+ ++
Sbjct: 293 YRIFVEEGFRYMWKGWVPRLFKVSLSGGISFGVYQYVE 330

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 72/350 (20%), Positives = 123/350 (35%), Gaps = 59/350 (16%)

Query: 5   DDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGL 64
           D  Q  T+     E   V  S++AG+ + +   T+  P + LK   QL  +  G A   +
Sbjct: 3   DGTQDGTEASLVAERHGVRSSVIAGAAAAVFQTTMSHPFEFLKTGQQLHRALPGAAAFNM 62

Query: 65  LKMMK-----------GMILNEG-----------GLRSFWKGNVPGTMMYVLYGGA---- 98
           L   K           G +L  G            LR     + P     +L  GA    
Sbjct: 63  LHPFKYYFSGCAALNVGTLLKTGTRFATFEQACVWLRDPEHADQPIAGPRLLLAGAITGF 122

Query: 99  -------QFSSY--SFYNNLFGETSDMNGQLQSLVVGALAGMTSS---FVSYPTDVLRTR 146
                   F S   +   N    +  + G+ ++       G         + P      R
Sbjct: 123 LESLWVVPFESIKTTAVENALELSRRVQGEPETRAAAVSKGPAPKATFHAARPVQTAHER 182

Query: 147 FIANQDVALSSLSHGCK-EIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDE 205
           ++ + +   SS   G   EI+   G+ GF +G   ++F    ++ + F TY  I      
Sbjct: 183 WLLHYERQPSSHFAGTVLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWI---VQS 239

Query: 206 YSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQS 265
            S       Y  ++A ++S      +T P+D I+ R+Q + + +               +
Sbjct: 240 LSPHKALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWF---------------T 284

Query: 266 YKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
           YK  S +     I  +EG   +++G    L K   S  +S   Y+ V  L
Sbjct: 285 YK--SSLNCAYRIFVEEGFRYMWKGWVPRLFKVSLSGGISFGVYQYVENL 332

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 60/297 (20%), Positives = 112/297 (37%), Gaps = 35/297 (11%)

Query: 29  GSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPG 88
           G  +G+ A     PLD  K+RLQ  P      P+ +++M++ ++ NE G+   + G    
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQAAPI---PKPT-IVQMLRSILKNE-GIVGLYAGLSAS 67

Query: 89  TMMYVLYGGAQFSSYSFYNNLFGETSDMNGQL----QSLVVGALAGMTSSFVSYPTDVLR 144
            +    Y  A+F  Y            +         S+V GAL G+  +F     D++ 
Sbjct: 68  LLRQCTYTTARFGMYDALKEHVIPRDKLTNMWYLLGASMVSGALGGLAGNF----ADLIN 123

Query: 145 TRFIANQDVALSSLSH------GCKEIWNMEGIPG-FFRGCTASMFTITLSASILFGTYE 197
            R   +  + L    +      G  +I+  EG    F  G   +M    L  +    TY+
Sbjct: 124 IRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVVTYD 183

Query: 198 SIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENK 257
             K +           N    ++S ++G  +  V  P D I+  +          N   K
Sbjct: 184 MFKNFLVTKYNMDPKKNSTHLTSSLLAGFVATTVCSPADVIKTIVM---------NAHKK 234

Query: 258 IVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMR 314
                   +   S  ++ +  + +EG   +++G   S  +  P T++  +A E + +
Sbjct: 235 ------PGHNHDSSFKILMEAINKEGPSFMFRGWVPSFTRLAPFTMLIFFAMEQLKK 285

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 79/326 (24%), Positives = 133/326 (40%), Gaps = 62/326 (19%)

Query: 23  SQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFW 82
           S  L+ G   GL +   + PLD LK R+Q     T      L K +K +   +  L+  W
Sbjct: 11  SSHLIGGFFGGLTSAVALQPLDLLKTRIQQDKKAT------LWKNLKEI---DSPLQ-LW 60

Query: 83  KGNVP-------GTMMYVLYGGAQFSSYSFYNNLFGE-TSDMN------------GQLQS 122
           +G +P       G+ +Y+       SS +   N     T+D N               ++
Sbjct: 61  RGTLPSALRTSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKSSSLPRLTMYEN 120

Query: 123 LVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASM 182
           L+ GA A     +++ P  V++ R+  +     SSL      I+  EG+ GFFRG  A+ 
Sbjct: 121 LLTGAFARGLVGYITMPITVIKVRY-ESTLYNYSSLKEAITHIYTKEGLFGFFRGFGATC 179

Query: 183 FTITLSASILFGTYESIKIYCD--------EYSKESDYTNYLRYSASSISGVTSK----M 230
                 A +    YE  K             Y+ E  +T Y   + ++ S V S      
Sbjct: 180 LRDAPYAGLYVLLYEKSKQLLPMVLPSRFIHYNPEGGFTTYTSTTVNTTSAVLSASLATT 239

Query: 231 VTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQG 290
           VT P DTI+ R+Q+  S +          T  + ++          +I++ E +L L+ G
Sbjct: 240 VTAPFDTIKTRMQLEPSKF----------TNSFNTFT---------SIVKNENVLKLFSG 280

Query: 291 VSMSLCKTVPSTVVSLWAYETVMRLY 316
           +SM L +   S  ++   YE +++ +
Sbjct: 281 LSMRLARKAFSAGIAWGIYEELVKRF 306

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/203 (19%), Positives = 80/203 (39%), Gaps = 31/203 (15%)

Query: 26  LVAGSVSGLLARTVIAPLDTLKIRL------------QLRPSYTGQAP------------ 61
           L+AG+++G++    I P + +K  L            + +P    +A             
Sbjct: 79  LIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVA 138

Query: 62  --SGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQ 119
               LL  +K M    G   +F +G        +     QF++Y+ +  L    +D   +
Sbjct: 139 RIEKLLPAVKHMYQTRGP-AAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARND---K 194

Query: 120 LQSLVVGALAGMTSSFVSYPTDVLRTRFIA-NQDVALSSLSHGCKEIWNMEGIPGFFRGC 178
             S++ G     T   ++ P DV++TR ++ N      +  +    I+  EG+  F++G 
Sbjct: 195 ASSVITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWKGS 254

Query: 179 TASMFTITLSASILFGTYESIKI 201
                 + +S  + F  YE + +
Sbjct: 255 IFRFMKVGISGGLTFTVYEQVSL 277

 Score = 29.6 bits (65), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 43/92 (46%), Gaps = 3/92 (3%)

Query: 23  SQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFW 82
           + S++ G  +      +  P+D +K R+  + + T       L  M  + + EG + +FW
Sbjct: 195 ASSVITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEY--KNTLNCMYRIFVQEG-MATFW 251

Query: 83  KGNVPGTMMYVLYGGAQFSSYSFYNNLFGETS 114
           KG++   M   + GG  F+ Y   + L G +S
Sbjct: 252 KGSIFRFMKVGISGGLTFTVYEQVSLLLGFSS 283

>Scas_671.1*
          Length = 123

 Score = 35.8 bits (81), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 4/46 (8%)

Query: 13 HLRKGEDVKVSQSLVAGSVSGL----LARTVIAPLDTLKIRLQLRP 54
          H ++      S S V  SVS +    LA  + AP DT+K R+QL+P
Sbjct: 26 HYKEDMKFSTSTSTVVNSVSAIASASLATAITAPFDTIKTRMQLKP 71

 Score = 33.5 bits (75), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 52/115 (45%), Gaps = 20/115 (17%)

Query: 201 IYCDEYSKESDYTNYLRYSASSISGVT-SKMVTYPLDTIRRRIQVRNSVYVQHNVENKIV 259
           I+  E  K S  T+ +  S S+I+  + +  +T P DTI+ R+Q++  V+          
Sbjct: 25  IHYKEDMKFSTSTSTVVNSVSAIASASLATAITAPFDTIKTRMQLKPKVF---------- 74

Query: 260 TEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMR 314
                     +F    + I + E +  L+ G+SM L +   S  ++   YE +++
Sbjct: 75  ---------TNFFTTLVLITKNESIFQLFSGLSMRLTRKALSAGIAWGIYEDLIK 120

>Scas_660.17
          Length = 497

 Score = 36.6 bits (83), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 59/277 (21%), Positives = 113/277 (40%), Gaps = 45/277 (16%)

Query: 10  NTDHLRKGEDVK-VSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKM- 67
           N D + + ED+       V  S+        + P D   I +   P+    +P+ L  M 
Sbjct: 177 NEDDISETEDIDYFPVKKVESSIDNEGENQTVVPSDHTAIIIN--PNLI--SPASLKTMD 232

Query: 68  MKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFY-------NNLFGETS------ 114
           +  +++++ GL+  W+ N   T   + + G   +S+          N  F          
Sbjct: 233 ILNVLIDKEGLKGLWRAN--HTTFILNFLGVSINSWLVSLLSSLVSNYFFSSPHSSISTS 290

Query: 115 -----DMNGQLQSLVVGAL-AGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEI--- 165
                 +    +SL++  L A + ++ V  P D+++ R I    +  S+     + +   
Sbjct: 291 LPLALPITSSFKSLILINLTAAILTNLVLIPMDLIKLRLIVTSTMESSNKRRSLRRLITK 350

Query: 166 --WNMEG----IPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNY-LRY 218
             W  +G    I  +F     S+ T+T      FGT   I IY  +++ +  +TN+ + Y
Sbjct: 351 WSWRNDGPNLPISIWFNSILKSIVTVT------FGTNFDILIYS-KFNLDK-FTNWKIFY 402

Query: 219 SASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVE 255
           S   IS      +  P++TI RR Q+   +  Q+N++
Sbjct: 403 SFKFISKCVELFIKLPIETILRRSQLNYLLNYQNNLQ 439

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 65/299 (21%), Positives = 114/299 (38%), Gaps = 50/299 (16%)

Query: 38  TVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKG------MILNEGGLRSFWKGNVPGTMM 91
           T   P++T+K RLQL+    G+  +G+ ++  G      +I    GLR   +G       
Sbjct: 27  TFTNPIETVKTRLQLQ----GELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAY 82

Query: 92  YVLYGGAQFSSYSFYNNLFG-------ETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLR 144
            +L  G++   Y       G        T        +   GA AGM  + +  P  +++
Sbjct: 83  QILLNGSRLGLYDPLRAALGGCVLSDRRTYGTAALAVNATAGAAAGMIGAALGSPLQLVK 142

Query: 145 TRF--IANQDVALSSLSHGCK--EIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIK 200
           TR   +A + V       G +   ++   G+ G ++G  A++    + +++    Y   K
Sbjct: 143 TRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAK 202

Query: 201 IYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVT 260
              +  S+       L   AS++S V   +   P D                      +T
Sbjct: 203 ---EALSRHVPDGMALYTLASALSSVAVCIAMNPFDVA--------------------MT 239

Query: 261 EIYQSYKGASFIRMGLNIL----RQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315
            +Y    G    R  L+ L    RQEG  +LY+G    L +  P T++ L   E  +R+
Sbjct: 240 RMYHHRGG--LYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRV 296

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 32.7 bits (73), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 54/275 (19%), Positives = 117/275 (42%), Gaps = 34/275 (12%)

Query: 35  LARTVIAPLDTLKIRLQL--RPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPGTMMY 92
           L+  +  PL TL  R+Q+  +    G      L+ ++ +   EG +  F+ G     +  
Sbjct: 29  LSMALTMPLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEG-VVGFYYG-----LES 82

Query: 93  VLYGGA--QFSSYSFYNNLFGETSDMNGQL-----QSLVVGALAGMTSSFVSYPTDVLRT 145
            +YG A    + Y FY      T  + G       ++++  A+AG  ++  S P  V+ T
Sbjct: 83  AMYGMAANSLNYYYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNT 142

Query: 146 RF-IANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCD 204
           R  +A  + +  ++     +I   +G+   F G   ++  ++ +  I +  +E +K    
Sbjct: 143 RMTVAKSEQSTLAV---LLDIVRKDGVTALFNGLRPALMLVS-NPIIQYTVFEQLKNVVL 198

Query: 205 EYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQ 264
           ++S          +   ++  + +   TYP  T++ R+         H  + K   +  Q
Sbjct: 199 KWSGSDVLLPSWAFLLGAVGKLAATGSTYPYITLKTRM---------HLAKGKEDADTQQ 249

Query: 265 SYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTV 299
           S        + ++I+++EG+  LY G+ + L +++
Sbjct: 250 S-----MWSLMVDIVKKEGIQGLYHGIGVKLTQSI 279

>CAGL0K06545g complement(641129..642667) similar to tr|Q03327
           Saccharomyces cerevisiae YDR470c, hypothetical start
          Length = 512

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 50/249 (20%), Positives = 94/249 (37%), Gaps = 55/249 (22%)

Query: 40  IAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQ 99
           +A ++   IR  L P  +    S     +   IL+E G++  WK N     +Y +     
Sbjct: 212 VASIEETHIRC-LTPERSINPESKHTLDIMNSILDEEGIKGLWKAN-NTNFIYQILSSTL 269

Query: 100 FSSYS------------FYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLRTRF 147
            + Y+            ++ +L       +  L +L VG L  +T      P D++RTRF
Sbjct: 270 EAWYTGLISPLLHIPDPYFIDLIHFPDTQSAVLLTLSVGVLTALTL----IPIDLIRTRF 325

Query: 148 I-------------------ANQDVALSSLSHGCKEI-WNMEGIPGFFRGCTASMFTITL 187
           I                   AN+     SL H  +   W  + +        + M+ +T+
Sbjct: 326 IVTALYGTDTEVSEEASEGAANKKHDSRSLRHWIRSWSWRHDAL-----KLPSDMWLLTM 380

Query: 188 SASILFGTYESI-------KIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRR 240
             S+   ++  +       K + D+YS+ + Y      +   ++ +    V  P++ + R
Sbjct: 381 LQSVSNVSFNKLIDLVIYHKFHVDKYSQMTTYN-----TMKVLARIAELFVKLPIECLLR 435

Query: 241 RIQVRNSVY 249
           R Q+   VY
Sbjct: 436 RCQLDFLVY 444

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 77/189 (40%), Gaps = 18/189 (9%)

Query: 72  ILNEGGLRSFWKGNVP---------GTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQS 122
           I + GG+  F++G +P         G ++  +   A++       N FG  + + G +  
Sbjct: 58  IWSRGGVFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYHFKKLGLNNFG--AGIMGGVSG 115

Query: 123 LVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASM 182
            V  A A +T  F +    V  T+  +    A  S     KEI+N EGI G  +G  A  
Sbjct: 116 GV--AQAYLTMGFCTCMKTVEITKHKSAAAGAKQSSWAAFKEIYNKEGIRGINKGVNAVA 173

Query: 183 FTITLSASILFG----TYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTI 238
                +    FG      E ++ +  + + +   T   +  AS+I G  S     P++ I
Sbjct: 174 IRQMTNWGSRFGFSRLVEEGLRKFTGKTNPDDKLTALEKIFASAIGGGLSAW-NQPIEVI 232

Query: 239 RRRIQVRNS 247
           R  +Q + +
Sbjct: 233 RVEMQSKTN 241

>KLLA0E22880g complement(2033077..2034387) similar to
           ca|CA2800|IPF11366 Candida albicans unknown function,
           hypothetical start
          Length = 436

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 37/85 (43%), Gaps = 10/85 (11%)

Query: 123 LVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIW-------NMEGIPGFF 175
           L  G LAG   + VS P D + TR  AN D  LSS +     +W          G+ G F
Sbjct: 164 LRAGFLAGAAQAIVSAPIDAIYTR--ANIDELLSS-AKKYDNLWLYSRDKIREIGLIGCF 220

Query: 176 RGCTASMFTITLSASILFGTYESIK 200
            G   S    +   ++ F T+E I+
Sbjct: 221 GGFGLSFIRESFGFALYFTTFEMIR 245

>AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, 429
           aa]
          Length = 429

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 55/123 (44%), Gaps = 16/123 (13%)

Query: 88  GTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLV-----VGALAGMTSSFVSYPTDV 142
           G ++Y  Y     SS SF     G   + +GQ    +      G +AG+  +  S P D 
Sbjct: 125 GVVLYTTY----LSSLSFLRGPLGAGGE-HGQSPPRISDVVCAGFMAGVAQAVASAPIDA 179

Query: 143 LRTRFIANQDVALSSLSHGCKEIWNME-----GIPGFFRGCTASMFTITLSASILFGTYE 197
           + TR  AN D+  S+  +    ++ ++     G+ G F G   S+   ++  ++ F T+E
Sbjct: 180 IYTRSTAN-DLLSSAKKYNSLWLYGIDKLKEIGLVGCFGGFGLSLVKESVGFAVYFTTFE 238

Query: 198 SIK 200
            +K
Sbjct: 239 LLK 241

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/114 (21%), Positives = 47/114 (41%), Gaps = 5/114 (4%)

Query: 4   IDDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSG 63
           ++DG     H R  E +   + +VA ++ G L+     P++ +++ +Q R +   +  + 
Sbjct: 194 VEDGIRRVTHKRSDEKLSAMEKIVASALGGGLS-AWNQPIEVIRVEMQSRTNDPNRPKNL 252

Query: 64  LLKMMKGMILNEGGLRSFWKGNVP----GTMMYVLYGGAQFSSYSFYNNLFGET 113
            +      I    GLR  ++G  P    G    +   G    +  F   L GET
Sbjct: 253 TVGKTFRYIYENNGLRGLYRGVTPRIGLGVWQTIFMVGFGDIARDFVGRLTGET 306

>Scas_696.9
          Length = 312

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 43/82 (52%), Gaps = 6/82 (7%)

Query: 120 LQSLVVGALAGMTS-SFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGC 178
             ++++GA   M   + +  P +V++T   AN+++   +  +  K +W+  GI GF++G 
Sbjct: 18  FSNIILGATINMAEVTSLGQPLEVVKTTMAANRNL---NFVNSMKYVWSRGGIVGFYQGL 74

Query: 179 T--ASMFTITLSASILFGTYES 198
              A +   T  A +LF + ES
Sbjct: 75  IPWAWIEASTKGAVLLFVSAES 96

>KLLA0C01914g 152834..153592 highly similar to sp|Q06287
           Saccharomyces cerevisiae YLR186w singleton, start by
           similarity
          Length = 252

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 125 VGALAGMTSSFVSYPTD--VLRTRFIANQDVALSSLSHGCKEIWNM 168
           VGA+A    +F     D  +  + +  +  VA S   HGC+++WN+
Sbjct: 206 VGAMARGKDNFADEFVDEKIGLSNYPLSASVACSKFCHGCEDVWNI 251

>Kwal_34.15907
          Length = 312

 Score = 28.5 bits (62), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 5/62 (8%)

Query: 139 PTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCT--ASMFTITLSASILFGTY 196
           P +V++T   AN+++   +     K +W+  G+ GF++G    A +   T  A +LF + 
Sbjct: 38  PLEVIKTTMAANRNL---NFGQSVKHVWSRGGVFGFYQGLIPWAWIEASTKGAVLLFVSA 94

Query: 197 ES 198
           E+
Sbjct: 95  EA 96

>Scas_713.20
          Length = 876

 Score = 28.9 bits (63), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 158 LSHGCKEIWNMEGIP--GFFRGCTASMFTITLSASILFGTYESIKIYCDEY 206
           + H C+EI +   +P   F          +TL+ S ++G   ++KI  DEY
Sbjct: 305 VCHDCREIPSKHNVPCVNFIPNSVDRNGFVTLTYSSIYGNVSTVKIKQDEY 355

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 28.5 bits (62), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 139 PTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCT--ASMFTITLSASILFGTY 196
           P +V++T   AN+     S  +  K +W+  G+ GF++G    A +   T  A +LF + 
Sbjct: 38  PLEVIKTTMAANRSF---SFFNAIKHVWSRGGVFGFYQGLIPWAWIEASTKGAVLLFVSA 94

Query: 197 ES 198
           ES
Sbjct: 95  ES 96

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,425,771
Number of extensions: 369951
Number of successful extensions: 2686
Number of sequences better than 10.0: 218
Number of HSP's gapped: 1556
Number of HSP's successfully gapped: 536
Length of query: 316
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 214
Effective length of database: 13,065,073
Effective search space: 2795925622
Effective search space used: 2795925622
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)