Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_716.281108110852540.0
CAGL0G03179g1061117216800.0
YPR115W108390615140.0
KLLA0D15081g101084613481e-168
YGR097W (ASK10)114649113461e-167
Kwal_55.20547101487112411e-153
CAGL0B04213g90078210871e-131
AAR086W8075369741e-116
Sklu_2395.67113044825e-50
ADL234C7363044782e-49
YIL105C6863234743e-49
CAGL0G02827g7493324755e-49
Scas_671.236863124692e-48
Kwal_23.49586493044601e-47
YNL047C6563184432e-45
KLLA0F03839g6483124361e-44
CAGL0G01386g5323054089e-42
Kwal_26.7055155582770.82
Kwal_55.2116458882704.6
KLLA0D02398g120561697.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_716.28
         (1108 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_716.28                                                          2028   0.0  
CAGL0G03179g 295541..298726 similar to sp|P48361 Saccharomyces c...   651   0.0  
YPR115W (YPR115W) [5536] chr16 (754873..758124) Protein containi...   587   0.0  
KLLA0D15081g 1271696..1274728 some similarities with sgd|S000631...   523   e-168
YGR097W (ASK10) [2057] chr7 (678697..682137) Potential transcrip...   523   e-167
Kwal_55.20547                                                         482   e-153
CAGL0B04213g 412230..414932 some similarities with sp|P48361 Sac...   423   e-131
AAR086W [272] [Homologous to ScYGR097W (ASK10) - SH; ScYPR115W -...   379   e-116
Sklu_2395.6 YIL105C, Contig c2395 8302-10437                          190   5e-50
ADL234C [1507] [Homologous to ScYIL105C - SH; ScYNL047C - SH] (2...   188   2e-49
YIL105C (YIL105C) [2571] chr9 complement(167578..169638) Protein...   187   3e-49
CAGL0G02827g complement(259569..261818) similar to sp|P40485 Sac...   187   5e-49
Scas_671.23                                                           185   2e-48
Kwal_23.4958                                                          181   1e-47
YNL047C (YNL047C) [4541] chr14 complement(539909..541879) Protei...   175   2e-45
KLLA0F03839g complement(363977..365923) similar to sp|P40485 Sac...   172   1e-44
CAGL0G01386g complement(132280..133878) similar to sp|P40485 Sac...   161   9e-42
Kwal_26.7055                                                           34   0.82 
Kwal_55.21164                                                          32   4.6  
KLLA0D02398g complement(202446..206063) similar to sp|P06105 Sac...    31   7.1  

>Scas_716.28
          Length = 1108

 Score = 2028 bits (5254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 998/1108 (90%), Positives = 998/1108 (90%)

Query: 1    MSDYFSVSHTNNNEQPNYTGQAKVDTASILSSGSQYQYPQVVTPGENVSSNATSLSYSAF 60
            MSDYFSVSHTNNNEQPNYTGQAKVDTASILSSGSQYQYPQVVTPGENVSSNATSLSYSAF
Sbjct: 1    MSDYFSVSHTNNNEQPNYTGQAKVDTASILSSGSQYQYPQVVTPGENVSSNATSLSYSAF 60

Query: 61   NSPISTIPNSLNASSVNLLGKNDERSPLYVDVPIPKALPKQEQQDLQNRDGSAATKGDIE 120
            NSPISTIPNSLNASSVNLLGKNDERSPLYVDVPIPKALPKQEQQDLQNRDGSAATKGDIE
Sbjct: 61   NSPISTIPNSLNASSVNLLGKNDERSPLYVDVPIPKALPKQEQQDLQNRDGSAATKGDIE 120

Query: 121  LEENQQYVREYPTDIMADRFHKWKKILKALIAYLREVAYAQEQFGRINNQLKTAVKFSFL 180
            LEENQQYVREYPTDIMADRFHKWKKILKALIAYLREVAYAQEQFGRINNQLKTAVKFSFL
Sbjct: 121  LEENQQYVREYPTDIMADRFHKWKKILKALIAYLREVAYAQEQFGRINNQLKTAVKFSFL 180

Query: 181  TDIQEGSNKLVEPMTTIAPIKRQQPMTLAEKQKQAELEKLRATELEFELENSKXXXXXXX 240
            TDIQEGSNKLVEPMTTIAPIKRQQPMTLAEKQKQAELEKLRATELEFELENSK       
Sbjct: 181  TDIQEGSNKLVEPMTTIAPIKRQQPMTLAEKQKQAELEKLRATELEFELENSKSQSQFPP 240

Query: 241  XXXXXXXXXXXXXXMPMNDESSMTLNIYPPIQQLESDDTSATSGFIKFGSGSIQDIQVIL 300
                          MPMNDESSMTLNIYPPIQQLESDDTSATSGFIKFGSGSIQDIQVIL
Sbjct: 241  QAPLQSQQSQPLNQMPMNDESSMTLNIYPPIQQLESDDTSATSGFIKFGSGSIQDIQVIL 300

Query: 301  KKYHLSVANQQFKVSKEITTLLIPKLEELRKDLRVKIQEIKDIHGDFKSNISHHVKLTNQ 360
            KKYHLSVANQQFKVSKEITTLLIPKLEELRKDLRVKIQEIKDIHGDFKSNISHHVKLTNQ
Sbjct: 301  KKYHLSVANQQFKVSKEITTLLIPKLEELRKDLRVKIQEIKDIHGDFKSNISHHVKLTNQ 360

Query: 361  LLNKYNNSIRIMNHQSHSHHEFQPKHDPYXXXXXXXXXXXXXXSEENYLKDAYVNLQSSG 420
            LLNKYNNSIRIMNHQSHSHHEFQPKHDPY              SEENYLKDAYVNLQSSG
Sbjct: 361  LLNKYNNSIRIMNHQSHSHHEFQPKHDPYLLKLQLDLQLKRQLSEENYLKDAYVNLQSSG 420

Query: 421  MQLEKIIYSKIQNVLQRYTTLIDTEVRLMIKNLCHELQQGILSRPPAFEWDHFVSHHPKC 480
            MQLEKIIYSKIQNVLQRYTTLIDTEVRLMIKNLCHELQQGILSRPPAFEWDHFVSHHPKC
Sbjct: 421  MQLEKIIYSKIQNVLQRYTTLIDTEVRLMIKNLCHELQQGILSRPPAFEWDHFVSHHPKC 480

Query: 481  LLNWKSVDPVPQPRKVSEIVYSNMKSPLAKCIRAGYFLKNGSKGYFVLTSNYLHEFKTSN 540
            LLNWKSVDPVPQPRKVSEIVYSNMKSPLAKCIRAGYFLKNGSKGYFVLTSNYLHEFKTSN
Sbjct: 481  LLNWKSVDPVPQPRKVSEIVYSNMKSPLAKCIRAGYFLKNGSKGYFVLTSNYLHEFKTSN 540

Query: 541  FFNQQSSTLQAPASDPMGKKISTLNGLTPINSISLNECKLIETGENHFTIEGTVFHGPVT 600
            FFNQQSSTLQAPASDPMGKKISTLNGLTPINSISLNECKLIETGENHFTIEGTVFHGPVT
Sbjct: 541  FFNQQSSTLQAPASDPMGKKISTLNGLTPINSISLNECKLIETGENHFTIEGTVFHGPVT 600

Query: 601  TTANQLXXXXXXXXXXXXLNATHHKKYHLPNLLXXXXXXXXXXXXXXXXXXXGSTVANNK 660
            TTANQL            LNATHHKKYHLPNLL                   GSTVANNK
Sbjct: 601  TTANQLSPSTSKTSASMSLNATHHKKYHLPNLLKSKKDAKPKTKVPTATTSSGSTVANNK 660

Query: 661  TSIESKVKWTFKPASKLTSEEDSKHFKKWVQDLKSLTNYKTVKDRSKFIEDRLMKAHYRS 720
            TSIESKVKWTFKPASKLTSEEDSKHFKKWVQDLKSLTNYKTVKDRSKFIEDRLMKAHYRS
Sbjct: 661  TSIESKVKWTFKPASKLTSEEDSKHFKKWVQDLKSLTNYKTVKDRSKFIEDRLMKAHYRS 720

Query: 721  KSVGIIPGSKLSQQQYHYPSTSEKPGKPQYIQIQNSNPTDWSGFRSKINTPAIDDNGNLI 780
            KSVGIIPGSKLSQQQYHYPSTSEKPGKPQYIQIQNSNPTDWSGFRSKINTPAIDDNGNLI
Sbjct: 721  KSVGIIPGSKLSQQQYHYPSTSEKPGKPQYIQIQNSNPTDWSGFRSKINTPAIDDNGNLI 780

Query: 781  TLTERKYAPTLSMTPSPMVSPMYSDKSASSSNXXXXXXXXXXTNIASTSNGIIQPVMTSR 840
            TLTERKYAPTLSMTPSPMVSPMYSDKSASSSN          TNIASTSNGIIQPVMTSR
Sbjct: 781  TLTERKYAPTLSMTPSPMVSPMYSDKSASSSNPPPPQQQHQPTNIASTSNGIIQPVMTSR 840

Query: 841  NGSASSSGATTPKGVTLNPRHKRHVSLTNSLSAFVQGGSNLGVHSPESINSDGSMGGYFA 900
            NGSASSSGATTPKGVTLNPRHKRHVSLTNSLSAFVQGGSNLGVHSPESINSDGSMGGYFA
Sbjct: 841  NGSASSSGATTPKGVTLNPRHKRHVSLTNSLSAFVQGGSNLGVHSPESINSDGSMGGYFA 900

Query: 901  IPVRXXXXXXXXXXXXKIIDATSRVSTPEYQAAYVHPLSRTSSRGTPVMSRHPSQYQLQT 960
            IPVR            KIIDATSRVSTPEYQAAYVHPLSRTSSRGTPVMSRHPSQYQLQT
Sbjct: 901  IPVRNNQTAYNTAANAKIIDATSRVSTPEYQAAYVHPLSRTSSRGTPVMSRHPSQYQLQT 960

Query: 961  VNTVPKVILNNNQEIGRNVSNPDQLQGAVNNQQNPTMPALKKITSTGSAPLMHADSSPNL 1020
            VNTVPKVILNNNQEIGRNVSNPDQLQGAVNNQQNPTMPALKKITSTGSAPLMHADSSPNL
Sbjct: 961  VNTVPKVILNNNQEIGRNVSNPDQLQGAVNNQQNPTMPALKKITSTGSAPLMHADSSPNL 1020

Query: 1021 STTMPHASQLYQRSNXXXXXXXXXXXXXXXRVHPIRKHKKNVSFSSLNSLMFSKKGSNIS 1080
            STTMPHASQLYQRSN               RVHPIRKHKKNVSFSSLNSLMFSKKGSNIS
Sbjct: 1021 STTMPHASQLYQRSNSSTQSLTTPSQLVTQRVHPIRKHKKNVSFSSLNSLMFSKKGSNIS 1080

Query: 1081 THVMKSGIQEXXXXXXXSSIRLNQSIYS 1108
            THVMKSGIQE       SSIRLNQSIYS
Sbjct: 1081 THVMKSGIQEDDGDDDDSSIRLNQSIYS 1108

>CAGL0G03179g 295541..298726 similar to sp|P48361 Saccharomyces
            cerevisiae YGR097w ASK10 involved in SKN7P-dependent
            transcription, hypothetical start
          Length = 1061

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1172 (37%), Positives = 610/1172 (52%), Gaps = 236/1172 (20%)

Query: 30   LSSGSQYQYPQVVTPGENVSSNATSLSYSAFNSPISTIPNSL---NASSVN-------LL 79
            +S+   Y  PQ  TP    + N  ++S  + +  +  +P+S+   + +S++       +L
Sbjct: 33   ISATPGYLTPQSRTPSY-AALNDDAVSIKSSDYLMDMVPDSMTLKDGASISTAKRKEFIL 91

Query: 80   GKNDERSPLYVDVPIP----KALPKQEQQDLQNRDGSAATKGDIELEENQQYVREYPTDI 135
             + DERSP +V VP+P     A+     + L+    S    GD E  + Q +VREYPTD+
Sbjct: 92   PETDERSPYFVGVPVPVIAASAVVDNGDKSLEKSTRSKTVIGDTEGYDGQ-FVREYPTDM 150

Query: 136  MADRFHKWKKILKALIAYLREVAYAQEQFGRINNQLKTAVKFSFLTDIQEGSNKLVEPMT 195
            + DRF+KWKKILK++IAYLREVAYAQEQF RINNQL+ +VKF FLTD+ EGSNK+++P++
Sbjct: 151  LIDRFYKWKKILKSIIAYLREVAYAQEQFARINNQLRNSVKFPFLTDLTEGSNKIIDPLS 210

Query: 196  TIAPIKRQQPMTLAEKQKQAELEKLRATELEFELENSKXXXXXXXXXXXXXXXXXXXXXM 255
              AP K+  P T+A+K+KQ E E+  A  ++                            +
Sbjct: 211  Q-AP-KKNAPTTMAQKRKQKE-EEQNAPNVD----------------------------L 239

Query: 256  PMNDESSMTLNIYPPIQQLESDDTSATSGFIKFGSGSIQDIQVILKKYHLSVANQQFKVS 315
            P  D S   +    P+Q   +D+TSA+SGF++FGSGSIQDIQVILKKYH+S+ANQQFK+S
Sbjct: 240  PPVDPSEQFM----PVQ--ATDNTSASSGFLRFGSGSIQDIQVILKKYHVSLANQQFKIS 293

Query: 316  KEITTLLIPKLEELRKDLRVKIQEIKDIHGDFKSNISHHVKLTNQLLNKYNNSIRIM--- 372
            KEI + +IPKLEE++KDL  KI+EIK+++GDFK+NI++H+K+T  LL KY  + R +   
Sbjct: 294  KEIVSTVIPKLEEIKKDLSFKIKEIKELNGDFKTNINYHIKMTGILLKKYIAACRFVDRN 353

Query: 373  NHQSHSHHEFQPKHDPYXXXXXXXXXXXXXXSEENYLKDAYVNLQSSGMQLEKIIYSKIQ 432
            N+     ++ +PKHDPY              +EENYL++A+VNLQSSG+QLEKIIYS+IQ
Sbjct: 354  NYLQDVQNKLKPKHDPYLLKLQLDLQLKRQIAEENYLQEAFVNLQSSGLQLEKIIYSRIQ 413

Query: 433  NVLQRYTTLIDTEVRLMIKNLCHELQQGILSRPPAFEWDHFVSHHPKCLLNWKSVDPVPQ 492
            +VLQRY+TLID+E RLMIKNLC ELQ GIL++PPA EWD+FVSHHP CLLNWKS DPVP 
Sbjct: 414  HVLQRYSTLIDSEARLMIKNLCQELQYGILAKPPAMEWDNFVSHHPLCLLNWKSNDPVPV 473

Query: 493  PRKVSEIVYSNMKSPLAKCIRAGYFL----------KNGSKGYFVLTSNYLHEFKTSNFF 542
            PR  S ++Y NMKSP++KCIRAGYF+           N  K YF+LTS Y+H+F +S+F+
Sbjct: 474  PRNASAVIYPNMKSPMSKCIRAGYFMMKSESKSSKSNNFQKSYFILTSTYIHQFSSSDFY 533

Query: 543  -------NQQSS----------------TLQAPASDPMGKKISTLNGLT----------- 568
                   NQQ+S                ++           +S  NG+T           
Sbjct: 534  KPKKGAPNQQNSIQFQFQPNIYHNYNNNSINTRKVSGNVNAVSGHNGVTVENSPFSRHSE 593

Query: 569  --PINSISLNECKLIETGENHFTIEG-------------------TVFHGPVTTTANQLX 607
              PI SI L+EC+L+E+ +  F IEG                   ++ H    T +N L 
Sbjct: 594  VIPIASIPLSECRLVESSDAIFVIEGKAEYSNNLTEKVPKKQVYKSMAHAGSNTISNPLA 653

Query: 608  XXXXXXXXXXXLNATHHKKYHLPNLLXXXXXXXXXXXXXXXXXX----XGSTVANNKTSI 663
                            HK   L  L+                        + V  NK   
Sbjct: 654  SIPGAKYGQDASTKVLHKT-KLSKLVKGAKAKTLGTETSKHSKSGLEKDANKVVTNKVYT 712

Query: 664  ESKVKWTFKPASKLTSEEDSKHFKKWVQDLKSLTNYKTVKDRSKFIEDRLMKAHYRSKSV 723
              +VKWTFK  ++  +E++ K+F KW+ D+K+LT ++  K+R  FIEDRLMK+  +S+  
Sbjct: 713  TEQVKWTFKMVAEKPTEDEVKYFNKWIIDIKNLTKFEKPKERFNFIEDRLMKSQTKSQM- 771

Query: 724  GIIPGSKLSQQQYHYPSTSEKPGKPQYIQIQNSNPTDWSGFRSKINTPAIDDNGNLITLT 783
                 S   + + +  STS   GKP YI +   + + ++   S +NTPAIDDNGNLIT  
Sbjct: 772  -----SVAEEGRSNQNSTSNFAGKPTYISLGVDSKSTFTPDGSVMNTPAIDDNGNLITFG 826

Query: 784  ERKYAPTLSMTPSPMVSPMYSDKSASSSNXXXXXXXXXXTNIASTSNGIIQPVMTSRNGS 843
            +R            +VSP YS+ S +S                                 
Sbjct: 827  QRH----------SVVSPHYSNNSDNS--------------------------------- 843

Query: 844  ASSSGATTPKGVTLNPRHKRHVSLTNSLSAFVQGGSNLGVHSPESINSDGSMGGYFAIPV 903
                             +++    TNSL    +  S L V+SP S+NS+GS GGYFAIPV
Sbjct: 844  -----------------YRQSYRPTNSLPG-SRNLSPLPVNSPTSVNSEGSGGGYFAIPV 885

Query: 904  RXXXXXXXXXXXXKIIDATSRVSTPEYQAAYVHPLSRTSSRGTPVMSRHPSQYQLQTVNT 963
                             + S V+T               +  +P ++       +Q+   
Sbjct: 886  NKQMSHPGSNVQVSEFGSRSNVNT---------------AGSSPNITGMGYFVPVQSTGV 930

Query: 964  VPKVILNNNQEIGRNVSNPDQLQGAVNNQQNPTMP--ALKKITSTGSAPLMHADSSPNLS 1021
            VPKV + NN+E+G+N   P            P  P  +L+K  STGS P ++ + S    
Sbjct: 931  VPKVKV-NNEEMGQNSPQP------------PASPYNSLRKNISTGSIPTLNNEGS---- 973

Query: 1022 TTMPHASQLYQRSNXXXXXXXXXXXXXXXRVHPIRKHKKNVSFSSLNSLMFSKKGSNIST 1081
               P +   Y+ +N               RV  +RKHKKNVSFSSLNSLMFSKKGS    
Sbjct: 974  --RPESGNFYKNNN--SSTNLVAAANGTARVQAVRKHKKNVSFSSLNSLMFSKKGSVGYG 1029

Query: 1082 HVMKSGIQEXXX-----XXXXSSIRLNQSIYS 1108
                +GI E            S I+LNQS+YS
Sbjct: 1030 GQPINGISENSDNEDEGNSKESKIKLNQSLYS 1061

>YPR115W (YPR115W) [5536] chr16 (754873..758124) Protein containing
           a pleckstrin homology (PH) domain, which mediate
           protein-protein and protein-lipid interactions, has
           moderate similarity to S. cerevisiae Ask10p, which may
           be a transcription factor in the S. cerevisiae
           Skn7p-mediated regulatory system [3252 bp, 1083 aa]
          Length = 1083

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/906 (40%), Positives = 505/906 (55%), Gaps = 126/906 (13%)

Query: 78  LLGKNDERSPLYVDVPIPKALPKQEQQDLQNRDGSAATKGDIELEE----NQQYVREYPT 133
           +L K D RSP Y+++PIPK LPK E +    +  + A   D+++E     + ++VREYPT
Sbjct: 97  ILPKTDPRSPYYINMPIPKKLPKSEGKARAKQKVNRADPSDLDVENIYETSGEFVREYPT 156

Query: 134 DIMADRFHKWKKILKALIAYLREVAYAQEQFGRINNQLKTAVKFSFLTDIQEGSNKLVEP 193
           DI+ DRFHKWKKILK+LIAY RE AY+QEQ  RIN Q+K AVKF+FLTD+++ +NKLV+P
Sbjct: 157 DILIDRFHKWKKILKSLIAYFREAAYSQEQIARINYQMKNAVKFAFLTDLEDETNKLVDP 216

Query: 194 MTTIAPIKRQQPMTLAEKQKQAELEKLRATELEFELENSKXXXXXXXXXXXXXXXXXXXX 253
             +  P K+ QP+ LA ++    L+    T++E                           
Sbjct: 217 SISKLPTKKPQPVPLAAQK----LDSKYDTDVE--------------------------- 245

Query: 254 XMPMNDESSMTLNIYPPIQQLESDD-TSATSGFIKFGSGSIQDIQVILKKYHLSVANQQF 312
             P +            IQ + S++  SA+SGF+KFGSGSIQDIQVILKKYHLS+ +QQ+
Sbjct: 246 -QPQS------------IQSVPSEEVASASSGFMKFGSGSIQDIQVILKKYHLSLGSQQY 292

Query: 313 KVSKEITTLLIPKLEELRKDLRVKIQEIKDIHGDFKSNISHHVKLTNQLLNKYNNSIRIM 372
           K+SKEI   +IPKL +LRKDL  K++EIK+++GDFK+NI  H+K+T++LLNKY  S++++
Sbjct: 293 KISKEILAYIIPKLTDLRKDLTTKMKEIKELNGDFKTNIGEHIKITSRLLNKYIASVKLL 352

Query: 373 NHQSHSH----HEFQPKHDPYXXXXXXXXXXXXXXSEENYLKDAYVNLQSSGMQLEKIIY 428
           +  S S      + +PKHDPY               EENYL++A++NLQS+ +QLEKI+Y
Sbjct: 353 DEASTSGDKQGEKLKPKHDPYLLKLQLDLQLKRQLLEENYLREAFLNLQSAALQLEKIVY 412

Query: 429 SKIQNVLQRYTTLIDTEVRLMIKNLCHELQQGILSRPPAFEWDHFVSHHPKCLLNWKSVD 488
           SKIQ+ LQRY+ LID+E RLMIKNLCHELQQGILSRPPA EWD+FVSHHP CL+N KS D
Sbjct: 413 SKIQSALQRYSALIDSEARLMIKNLCHELQQGILSRPPAVEWDNFVSHHPTCLMNLKSTD 472

Query: 489 PVPQPRKVSEIVYSNMKSPLAKCIRAGYFLKNG------SKGYFVLTSNYLHEFKTSNFF 542
           P PQPR++S+IVY NMKSPLAKCIR GY LK        +KGYFVLT+NYLHEFK+S+FF
Sbjct: 473 PPPQPRRLSDIVYPNMKSPLAKCIRVGYLLKKTESSKSFTKGYFVLTTNYLHEFKSSDFF 532

Query: 543 -------------------------------NQQSSTLQAPASDPMGKKISTLNGLTPIN 571
                                          +  S   Q P      K +S+ N L PI+
Sbjct: 533 LDSKSPRSKNKPVVEQSDISRVNKDGTNAGSHPSSKGTQDPKLTKRRKGLSSSN-LYPIS 591

Query: 572 SISLNECKLIETGENHFTIEGTV-FHGPVTTTANQLXXXXXXXXXXXXLNATHHKKYHLP 630
           S+SLN+C L ++ ++ F ++G   +H P  T   +             L +   K    P
Sbjct: 592 SLSLNDCSLKDSTDSTFVLQGYASYHSPEDTCTKESSTTSDLACPTKTLASNKGKHQRTP 651

Query: 631 NLLXXXXXXXXXXXXXXXXXXXGSTVA---NNKTSIESKVKWTFK--PASKLTSEEDSKH 685
           + L                    +      N K+  E +V+WTFK   AS   + E+SK+
Sbjct: 652 SALSMVSVPKFLKSSSVPKEQKKAKEEANINKKSICEKRVEWTFKIFSASLEPTPEESKN 711

Query: 686 FKKWVQDLKSLTNYKTVKDRSKFIEDRLMKAH--------YRSK-SVGIIP-GSKLSQQQ 735
           FKKWVQD+K+LT++ + ++RS FIE++++K+          RSK S  I P  S ++  +
Sbjct: 712 FKKWVQDIKALTSFNSTQERSNFIEEKILKSRNHNNGKSSQRSKNSTYITPVDSFVNLSE 771

Query: 736 YHYPSTS-------EKPGKPQYIQIQNSNPTDW----SGFRSKINTPAIDDNGNLITLTE 784
              PS+S       ++  +P+YI I  S   +     S +RSK+NTPAID+NGNL  + E
Sbjct: 772 KVTPSSSVTTLNTRKRANRPRYIDIPKSANMNAGAMNSVYRSKVNTPAIDENGNLAIVGE 831

Query: 785 RK-YAPTLSMT---PSPMVSPMYSDKSASSS--NXXXXXXXXXXTNIASTSNGIIQPVMT 838
            K  AP   M+    +P  SP YS  +      N          +  AS    + Q  ++
Sbjct: 832 TKNSAPQNGMSYTIRTPCKSP-YSPYTGEGMLYNRSADNLMASSSRKASAPGEVPQIAVS 890

Query: 839 SRNGSASSSGATTPKGVTLNPRHKRHVSLTNSLSAFVQGG-SNLGVHSPESINSDGSMGG 897
           +    A    +        + R     S+ N    F      NL   SP  +  DG+  G
Sbjct: 891 NHGDEAIIPASAYSDSSHKSSRASSVASIHNQRVDFYPSPLMNLPGVSPSCLALDGNANG 950

Query: 898 YFAIPV 903
           YF IP+
Sbjct: 951 YFGIPL 956

>KLLA0D15081g 1271696..1274728 some similarities with sgd|S0006319
           Saccharomyces cerevisiae YPR115w, hypothetical start
          Length = 1010

 Score =  523 bits (1348), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 333/846 (39%), Positives = 441/846 (52%), Gaps = 121/846 (14%)

Query: 77  NLLGKNDERSPLYVDVPIPK-------------------------ALPKQEQQDLQNRDG 111
           ++L K +  SP YV+VP PK                         +        + +  G
Sbjct: 38  DILPKTNYHSPYYVNVPTPKHSLLAGAGANSASAGANSGAGNANISARAGANVGVGSGAG 97

Query: 112 SAATKG-----DIELEENQQYVREYPTDIMADRFHKWKKILKALIAYLREVAYAQEQFGR 166
           ++A  G     D+  +    +VREYPTDI+ADRFHKW+KILKA+I YLREVAY+QEQF R
Sbjct: 98  ASANAGKAEGLDLYDDGTASFVREYPTDILADRFHKWRKILKAMIIYLREVAYSQEQFAR 157

Query: 167 INNQLKTAVKFSFLTDIQEGSNKLVEPMTTIAPIKRQQPMTLAEKQKQAELEKLRATELE 226
           IN  LK +VKFSFLTD+ E +N++ +P+T   P K+ QPMT  +     + +   A+   
Sbjct: 158 INYSLKNSVKFSFLTDLDESTNRVSDPLTKNLPQKKPQPMTQMKSPFDEKPDPFAASNAS 217

Query: 227 FELENSKXXXXXXXXXXXXXXXXXXXXXMPMNDESSMTLNIYPPIQQLESDDTSATSGFI 286
             L NS                      + +  E            QLE +D+ + +GF+
Sbjct: 218 -TLNNS---------------------SIDLGQE-----------LQLEPNDSCSGAGFM 244

Query: 287 KFGSGSIQDIQVILKKYHLSVANQQFKVSKEITTLLIPKLEELRKDLRVKIQEIKDIHGD 346
            FGSGSIQDIQVILKKYHLS+A+QQ K SKEIT  +IPKLE+LRKDL  KI+EIK+++ D
Sbjct: 245 NFGSGSIQDIQVILKKYHLSLASQQVKSSKEITLQIIPKLEDLRKDLSHKIKEIKELNAD 304

Query: 347 FKSNISHHVKLTNQLLNKYNNSIRIMNHQS--------HSHHEFQPKHDPYXXXXXXXXX 398
           FK+NI  HV LT QLL+KY  ++  +N  +          +   + KHDPY         
Sbjct: 305 FKTNIQEHVALTGQLLHKYIAAVNFLNDNASRSDLIKLKRNSSLKSKHDPYLLKLQLDLQ 364

Query: 399 XXXXXSEENYLKDAYVNLQSSGMQLEKIIYSKIQNVLQRYTTLIDTEVRLMIKNLCHELQ 458
                 EENYL++AY+NLQSSGM+LEKII+S IQ  LQ+++ +ID + R  I NLC ELQ
Sbjct: 365 LKRQLLEENYLQEAYINLQSSGMELEKIIFSTIQKTLQKFSAIIDVQARTSINNLCRELQ 424

Query: 459 QGILSRPPAFEWDHFVSHHPKCLLNWKSVDPVPQPRKVSEIVYSNMKSPLAKCIRAGYFL 518
           +GILS+PP  EWD+FVSHHP+CLLNWKS DP+PQPRK+S+I Y  MKS LAKCIRAGY L
Sbjct: 425 RGILSKPPCVEWDNFVSHHPRCLLNWKSTDPIPQPRKLSDIRYPKMKSSLAKCIRAGYLL 484

Query: 519 KNG------SKGYFVLTSNYLHEFKTSNFFNQQSSTLQ------APASDPMGKKISTLNG 566
           K        +KGYFVLTSNYLHEFK+SNFF     T +       P+S   G+ I     
Sbjct: 485 KKSKYLKQYNKGYFVLTSNYLHEFKSSNFFKLTQDTGENSEHAIIPSSGNKGRSI----- 539

Query: 567 LTPINSISLNECKLIETGENHFTIEGTVFHGPVTTTANQLXXXXXXXXXXXXLNATHHKK 626
             PI SISLNE +L+E  E+ FTI            +  +            L       
Sbjct: 540 -IPIMSISLNESELLEI-EDKFTI---------NCKSTYIMEESASESISNDLKKISKST 588

Query: 627 YHLPNLLXXXXXXXXXXXXXXXXXXXGSTVANNKTSIESKVKWTFK-PASKLTSEEDSKH 685
             +  L                     S V +           TFK PA     + D K 
Sbjct: 589 STISKLFKPGSGKHGKNNNLAMGSSNDSRVVSGGDDTVKFTSITFKRPA-----DVDVKE 643

Query: 686 FKKWVQDLKSLTNYKTVKDRSKFIEDRLMKAHYRSKSVGIIPGSKLSQ----QQYHYPST 741
           FKKW  +LK LT +    DR+++IE++++KAH +  S  +  G   S+          S+
Sbjct: 644 FKKWTNNLKDLTKFHNTLDRARYIEEKILKAHNKFASSTLSLGQSKSEPTSSLHLSSQSS 703

Query: 742 SEKPGKPQYIQIQNSNPTDWSGFRSKINTPAIDDNGNLITLTER--KYAPTLSMTPSPMV 799
           S    +P YIQ+ + +  +    RSK+NTPAIDDNGNLI  TER    APT+   P P  
Sbjct: 704 SNLQQRPHYIQLPSVSQVN---LRSKVNTPAIDDNGNLIFATERPKSLAPTIEARPPPTE 760

Query: 800 SPMY--SDKSASSSNXXXXXXXXXXTNIASTSNGI-----IQPVMTSRNGSASSSGATTP 852
            P +  S  S  S++               TSNG+     + P+   R  S  +   T  
Sbjct: 761 LPSHQVSPTSFISNDGSSGSNKTSNMGYVITSNGMTPVHHLTPLTHVRTTSGDAGNTTNH 820

Query: 853 KGVTLN 858
            G   N
Sbjct: 821 TGAEFN 826

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 22/26 (84%)

Query: 1051 RVHPIRKHKKNVSFSSLNSLMFSKKG 1076
            +  P+RKHKK VSF+SLNSLMFSKK 
Sbjct: 954  QTQPVRKHKKTVSFNSLNSLMFSKKA 979

>YGR097W (ASK10) [2057] chr7 (678697..682137) Potential
           transcription factor involved in Skn7p-mediated
           two-component regulatory system [3441 bp, 1146 aa]
          Length = 1146

 Score =  523 bits (1346), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 266/491 (54%), Positives = 335/491 (68%), Gaps = 52/491 (10%)

Query: 78  LLGKNDERSPLYVDVPIPKALPKQEQQDLQNRDGSAATKGDIELEENQQYVREYPTDIMA 137
           +L + DERSP +++VPIPKA P    +  +   G  A  G        Q+V+EYPTDI+ 
Sbjct: 67  ILPETDERSPYFINVPIPKAQPTSTTETKKPLAGDEAIDG--------QFVKEYPTDILV 118

Query: 138 DRFHKWKKILKALIAYLREVAYAQEQFGRINNQLKTAVKFSFLTDIQEGSNKLVEPMTTI 197
           DRF+KWKKILK L+ YLREVAYAQEQF RIN QLK +VKF FLTDI E +N + +P TT 
Sbjct: 119 DRFYKWKKILKGLVIYLREVAYAQEQFARINYQLKGSVKFPFLTDIDETTNTITDPFTT- 177

Query: 198 API--KRQQPMTLAEKQKQAELEKLRATELEFELENSKXXXXXXXXXXXXXXXXXXXXXM 255
           AP   K+ QP      QK+  L      +++ + E  +                      
Sbjct: 178 APRGPKKAQPA-----QKKVGLTDSEQFQMQMQQEQQENAVQAPT--------------- 217

Query: 256 PMNDESSMTL--NIYPPIQQLESDDTSATSGFIKFGSGSIQDIQVILKKYHLSVANQQFK 313
              DES M+L  + Y P+Q  ESD+TSA SGF+KFGSGSIQDIQVILKKYHLS+ANQQFK
Sbjct: 218 ---DESKMSLAPHEYKPVQTTESDNTSAASGFVKFGSGSIQDIQVILKKYHLSLANQQFK 274

Query: 314 VSKEITTLLIPKLEELRKDLRVKIQEIKDIHGDFKSNISHHVKLTNQLLNKYNNSIRIMN 373
           +SKEIT+ +IPKLEELRKDLR KI EIKD+HGDFK+NI  H++LT+QLL KY  +++ MN
Sbjct: 275 ISKEITSTVIPKLEELRKDLRYKITEIKDLHGDFKTNIGAHIQLTSQLLKKYIAAVKFMN 334

Query: 374 HQSHSH----------HEFQPKHDPYXXXXXXXXXXXXXXSEENYLKDAYVNLQSSGMQL 423
                +          H+  PKHDPY              +EE YL++A++NLQSSG+QL
Sbjct: 335 AHGIGNDRASPTNKKPHKLDPKHDPYLLKLQLDLQLKRQVAEETYLQEAFINLQSSGLQL 394

Query: 424 EKIIYSKIQNVLQRYTTLIDTEVRLMIKNLCHELQQGILSRPPAFEWDHFVSHHPKCLLN 483
           EKIIY+KIQ+ L RY+ LID+E RLMIKN+C ELQ GI+S+PPAFEWD+FV+ HP CLLN
Sbjct: 395 EKIIYTKIQHALLRYSALIDSEARLMIKNMCQELQHGIISKPPAFEWDNFVTQHPSCLLN 454

Query: 484 WKSVDPVPQPRKVSEIVYSNMKSPLAKCIRAGYFLKNGS------KGYFVLTSNYLHEFK 537
           WKS DP+P PRKVS+++Y +MKSPLAKCI+AGYFLK         +GYFVLTSNY+HEF+
Sbjct: 455 WKSNDPIPPPRKVSDVIYPHMKSPLAKCIKAGYFLKKSELLPTYHQGYFVLTSNYIHEFQ 514

Query: 538 TSNFFNQQSST 548
           +S+F+N  SST
Sbjct: 515 SSDFYNLSSST 525

 Score =  186 bits (472), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 187/491 (38%), Positives = 235/491 (47%), Gaps = 82/491 (16%)

Query: 667  VKWTFKPASKLTSEEDSKHFKKWVQDLKSLTNYKTVKDRSKFIEDRLMKAH--------Y 718
            V WTFK  S   SEE+ KHFK+WVQDLK+LT++   KDR KFIEDR+MK+H         
Sbjct: 689  VTWTFKIVSPEPSEEELKHFKRWVQDLKNLTSFNDTKDRIKFIEDRVMKSHRFKAGHMSR 748

Query: 719  RSKSVG----IIPGSKLSQQQYHYPSTSEK--PGKPQYIQIQNSNPTDW--SGFRSKINT 770
             S ++G     +  S  + Q     S + K    KPQYI IQN++  D+  +GFRSK+NT
Sbjct: 749  NSVNIGSHTPCLTDSTFTLQDGTTTSVNLKGRAEKPQYIHIQNNSLADFDGNGFRSKVNT 808

Query: 771  PAIDDNGNLITLTERKYAPTLSMTPSPMVSP-MYSDKSASSSNXXXXXXXXXXTNIASTS 829
            PAIDD GNLIT+  R           P  SP  YSD  A+S N              S  
Sbjct: 809  PAIDDYGNLITVERR-----------PAQSPHQYSDYMATSGNTTPSYSSGSRPQ--SMY 855

Query: 830  NGIIQPVMTSRNGSA-SSSGATTPKGVTLNPRHKRHVSLTNSLSAFVQGGSNLGVHSPES 888
            NG    V  + NG     S A      T N RH+R++S T+SL  F     +L V+SP S
Sbjct: 856  NGYNPAVSITSNGMMLQQSTANNNTNPTTNLRHQRNISQTSSLPGFSYTSLSLPVNSPGS 915

Query: 889  INSDGSMGGYFAIPVRXXXXXXXXXXXXKIIDATSRVSTPEYQ---------AAYVHPLS 939
             NS+ S GGYFAIP+                   S  S+P Y             + PLS
Sbjct: 916  SNSESSSGGYFAIPLHGNNNNNNYTQR------NSEGSSPCYNDDQIRQQQQPLQMQPLS 969

Query: 940  RTSSRGTPVMS-RHPSQYQLQTVNT--VPKVILNNNQEIGRNVSNPDQLQGAVNNQQNPT 996
            RTSS    V + R  S     T N   VPKV++NN     +NV      Q A     +PT
Sbjct: 970  RTSSSSVNVTAMRSTSAGNSITANAPVVPKVMVNN-----QNVKTVAADQSAT-APSSPT 1023

Query: 997  MPA-------------LKKITSTGSAPLMHADSSPNLSTTMPHASQLYQRSNXXXXXXXX 1043
            M +             LKK  STG+ P + A+ +        HA   + +          
Sbjct: 1024 MNSSVTTINRESPYQTLKKTNSTGNVPCLTAEKT--------HAHPAFYKRGNNSAQNLT 1075

Query: 1044 XXXXXXXRVHPIRKHKKNVSFSSLNSLMFSKKGSN-----ISTHVMKSGIQEXXXXXXXS 1098
                   RVHPIRKHKKNVSFSSLNSLMFSKKG+N     ++   M  GIQE       +
Sbjct: 1076 TSSSTASRVHPIRKHKKNVSFSSLNSLMFSKKGANHGGNLMTNQFMSGGIQEDDGDSTNN 1135

Query: 1099 -SIRLNQSIYS 1108
             +I+LNQSIYS
Sbjct: 1136 DTIKLNQSIYS 1146

>Kwal_55.20547
          Length = 1014

 Score =  482 bits (1241), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 330/871 (37%), Positives = 456/871 (52%), Gaps = 109/871 (12%)

Query: 277  DDTSATSGFIKFGSGSIQDIQVILKKYHLSVANQQFKVSKEITTLLIPKLEELRKDLRVK 336
            D+ SA+SGF+KFGSGSI+DIQV+LKKYH S+ NQQ K+SKE+ T+++PKL++LRKDL++K
Sbjct: 210  DNDSASSGFMKFGSGSIEDIQVVLKKYHTSMGNQQIKMSKELNTVVVPKLDDLRKDLQLK 269

Query: 337  IQEIKDIHGDFKSNISHHVKLTNQLLNKYNNSIRIMNHQSHSHHEFQ-------PKHDPY 389
            I+EIK++HGDF++NI  H+ LT QLL KY  +++ M+  S+  + F+       PKHDPY
Sbjct: 270  IKEIKELHGDFRTNIGEHIALTGQLLQKYMAAVKFMSTNSNDQNIFKLKNQKLKPKHDPY 329

Query: 390  XXXXXXXXXXXXXXSEENYLKDAYVNLQSSGMQLEKIIYSKIQNVLQRYTTLIDTEVRLM 449
                           EENYL++AY+NLQSSG++LEKIIY ++Q+ LQRY+ LI T  R+ 
Sbjct: 330  LLKLQLDLQLKRQLLEENYLQEAYINLQSSGLELEKIIYGEVQHTLQRYSALISTSARIS 389

Query: 450  IKNLCHELQQGILSRPPAFEWDHFVSHHPKCLLNWKSVDPVPQPRKVSEIVYSNMKSPLA 509
            I NLC+EL QG+LS+PPA EWDHFV HHPKCL+NWKS +P+PQPRK+S I Y  MKS LA
Sbjct: 390  IGNLCNELHQGMLSKPPAIEWDHFVGHHPKCLINWKSTEPIPQPRKLSHIRYPKMKSSLA 449

Query: 510  KCIRAGYF------LKNGSKGYFVLTSNYLHEFKTSNFF--NQQSSTLQAPASDPMGKKI 561
            KCI+AGY       LKN +KGYFVLTSNYLHEFK+SNFF  +Q +S  +       G K 
Sbjct: 450  KCIKAGYLSKKSQILKNYNKGYFVLTSNYLHEFKSSNFFKLSQDNSEKKDHGEVQTGSK- 508

Query: 562  STLNGLTPINSISLNECKLIETGENHFTIEGTVFHGPVTTTANQLXXXXXXXXXXXXLNA 621
                 + P+ S+SLN  KL+E  E+ F+I G      + T++N                +
Sbjct: 509  --KRAMVPVTSLSLNSAKLVEASESKFSIRG------IATSSNFERKSAETGKMISKSTS 560

Query: 622  THHKKYHLPNLLXXXXXXXXXXXXXXXXXXXGSTVANNKTSIESKVK----WTFKPASKL 677
            +  K       L                   GS+ + +   ++        W FKP S  
Sbjct: 561  SIQK------FLKSSGKNPHKKDNHHNHHAPGSSGSVSGPVVQDVADDVSTWVFKPVS-- 612

Query: 678  TSEEDSKHFKKWVQDLKSLTNYKTVKDRSKFIEDRLMKAHYRSKSVGII----PGSKLSQ 733
            +  ED+K  KKW+ +++ L+N+ T  DR+KFIE+++++AH R+ S+ +       S   Q
Sbjct: 613  SKPEDAKDLKKWIAEVRHLSNFDTSADRAKFIEEKILRAHSRASSMNLAKMASDASAKKQ 672

Query: 734  QQYHYPSTSEKPGKPQYIQIQNSNPTDWSGFRSKINTPAIDDNGNLITLTERKYA-PTLS 792
             +     T     KP +I +      D +  R+KINTPAIDDNGNLIT  ER  +  + S
Sbjct: 673  DKVASNRTQGSRNKPHFIHLGPQEFQDPTSARAKINTPAIDDNGNLITAGERHISLKSPS 732

Query: 793  MTPSPMVSPMYSDKSAS----SSNXXXXXXXXXXTNIASTSNGIIQPVMTSRNGSASSSG 848
               SP  SP  S  S       SN               TSNG     MT  N + + + 
Sbjct: 733  ELSSPRQSPGQSLNSIGGGTPGSNHQNVPSPVNPQGFVITSNG-----MTPINRTPAPTA 787

Query: 849  ATTPKGVTLNPRHKRHVSLTNSLSAFVQGGSNLGVHSPESINSDGSMGGYFAIPVRXXXX 908
               P G+ L          + SL     G +++ ++SP S  S  S GGYFAIPV     
Sbjct: 788  KRVPSGIIL--SSGASSDGSGSLPMNSPGSASMAINSPSSHVSGSSGGGYFAIPVH---- 841

Query: 909  XXXXXXXXKIIDATSRVSTPEYQAAYVHPLSRTSSRGTPVMSRHPSQYQLQTVN-TVPKV 967
                        A+S+ STP       +P S              S  Q Q     VP+V
Sbjct: 842  ------------ASSQASTP----GGANPDS--------------SAAQAQATGPVVPRV 871

Query: 968  ILNNNQEIGRNVSNPDQLQGAVNNQQNPTMPALKKITSTGSAPL-----MHADSSPNLST 1022
             L N++++  +  +  QL     ++Q    P   K++    APL     +H   S N   
Sbjct: 872  RL-NDKDLAHDKPDKSQL-----SEQLSEKPQATKVSE--GAPLSRGAPVHIRKSVNAGG 923

Query: 1023 TMPHASQLYQRSNXXXXXXXXXXXXXXXRVHPIRKHKKNVSFSSLNSLMFSKKGSNIS-- 1080
            T    ++                        PIRKHKKNVSF SLNSL+FSKKG ++S  
Sbjct: 924  TGMTIAEPPHSVYANPKQSNSAQTLASTNAQPIRKHKKNVSFGSLNSLLFSKKGGDVSNN 983

Query: 1081 --THVMKSG--IQEXXXXXXXSSIRLNQSIY 1107
              T    SG  I+E        ++ +NQS+Y
Sbjct: 984  NMTDYFMSGNRIEE---NEDSGALNVNQSLY 1011

 Score =  118 bits (296), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 75/117 (64%), Gaps = 11/117 (9%)

Query: 78  LLGKNDERSPLYVDVPIPKALPKQEQQDLQNRDGSAATKGDIELEENQQYVREYPTDIMA 137
           +L K D  SP YV+VP P            ++D +AA            +VREYPTDI+ 
Sbjct: 49  ILPKTDFHSPYYVNVPTPSQSALTSDYSELSQDAAAAG-----------FVREYPTDILL 97

Query: 138 DRFHKWKKILKALIAYLREVAYAQEQFGRINNQLKTAVKFSFLTDIQEGSNKLVEPM 194
           DRF KW+KILK L  YLREVAYAQE+F RIN  L+ AVKFSFLTD++E +N++++P 
Sbjct: 98  DRFTKWRKILKGLANYLREVAYAQERFARINYSLRGAVKFSFLTDLEESTNRVIDPF 154

>CAGL0B04213g 412230..414932 some similarities with sp|P48361
           Saccharomyces cerevisiae YGR097w ASK10 involved in
           SKN7P-dependent transcription, hypothetical start
          Length = 900

 Score =  423 bits (1087), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 281/782 (35%), Positives = 400/782 (51%), Gaps = 119/782 (15%)

Query: 49  SSNATSLSYSAFNSPISTIPNSLNASSVN----------LLGKNDERSPLYVDVPIPKAL 98
           ++ A   S+  FN      P  LN+ SV           ++ + +  SP Y+ VP+P+A+
Sbjct: 62  ATTANDSSFDGFN------PKYLNSESVYRAQSNSQSGPVVSRTEVNSPYYLPVPVPEAV 115

Query: 99  PKQEQQDLQNRDGSAATKGDIELEENQQYVREYPTDIMADRFHKWKKILKALIAYLREVA 158
                 D  N   S+A +  +    + QYV+EYPT ++ADRF KW KILK LI+YLRE A
Sbjct: 116 -----TDSANPVSSSAKEQYLNGYHHSQYVKEYPTVLLADRFKKWNKILKYLISYLREAA 170

Query: 159 YAQEQFGRINNQLKTAVKFSFLTDIQEGSNKLVEPMTTIAPIKRQQPMTLAEKQKQAELE 218
           Y +E   R++ +LK  V F FLTD+ +  N+LV+P     P KR QP+T AEK++     
Sbjct: 171 YVEEHIARLHVKLKKKVTFPFLTDLDD-HNQLVDPYQKNLPTKRTQPITPAEKKRLEAEA 229

Query: 219 KLRAT----------ELEFELENSKXXXXXXXXXXXXXXXXXXXXXMPMNDESSMTLNIY 268
            L A           + + ELE+                       +P++ +        
Sbjct: 230 ALAAATTTEETTEELDFDTELEDE----------------------VPVSSD-------- 259

Query: 269 PPIQQLESDDTSATSGFIKFGSGSIQDIQVILKKYHLSVANQQFKVSKEITTLLIPKLEE 328
                   +DT A SGF+KFGSGSIQDIQV+LKKYH S+A QQ KVS+EI   +IPKLE 
Sbjct: 260 --------NDTMAPSGFLKFGSGSIQDIQVLLKKYHGSIAGQQLKVSREIMENVIPKLEG 311

Query: 329 LRKDLRVKIQEIKDIHGDFKSNISHHVKLTNQLLNKYNNSIR-IMNHQSHSHHEFQPKHD 387
           L K+L  KI+EIK + GDF++N+   +  T++L+ KYN+ ++ + N +S +    QPK D
Sbjct: 312 LVKELNNKIREIKSLDGDFRTNLIGQMNQTSRLIQKYNSVVKKLANEKSDATTTIQPKCD 371

Query: 388 PYXXXXXXXXXXXXXXSEENYLKDAYVNLQSSGMQLEKIIYSKIQNVLQRYTTLIDTEVR 447
           PY              +EE YL +A+VNLQSSG+ LE+I+Y+KIQ+ L+ YT LID+E R
Sbjct: 372 PYLVKIQLETQLKKQLAEEKYLMEAFVNLQSSGLDLERIVYTKIQSALENYTALIDSEAR 431

Query: 448 LMIKNLCHELQQGILSRPPAFEWDHFVSHHPKCLLNWKSVDPVPQPRKVSEIVYSNMKSP 507
           L++KNLC ELQQG+LS+P  +EWD F++HH  C+LNW S  P P PR++S+IVY NMK+P
Sbjct: 432 LILKNLCQELQQGMLSKPANYEWDQFITHHTNCMLNWTSTQPKPVPRELSDIVYQNMKAP 491

Query: 508 LAKCIRAGYF-------LKNGSKGYFVLTSNYLHEFKTSNFFNQQSSTLQAPASDPMGKK 560
            +KCIR GY        +K  SKGYF+LTS+YLHEFK S+F  +   +    AS+     
Sbjct: 492 QSKCIRKGYMYYGSGKDVKKYSKGYFILTSHYLHEFKDSDFSKEMKGS--TDASNNFCHM 549

Query: 561 ISTLNGLTPINSISLNECKLIETGENHFTIEGTVFHGPVTTTANQLXXXXXXXXXXXXLN 620
             +L  L P  S SL++  + E  +        VF      TA  L              
Sbjct: 550 AISLVNLIPEKSFSLSDIDIEEITDTEM-----VF------TARSLKSTKPRSSPSPAPI 598

Query: 621 ATHHKKYHLPNLLXXXXXXXXXXXXXXXXXXXGSTVANNKT------------SIESKVK 668
                K   P++                     S  AN +T             I  +  
Sbjct: 599 PAPEHKSRSPSITAAVPKFLRGGPSRSTKTRSNSG-ANRQTLFAEPSLSEPLREIGERTT 657

Query: 669 WTFKPASKLTSEEDSKHFKKWVQDLKSLTNYKTVKDRSKFIEDRLMKAHYR-SKSVGIIP 727
           W  + +     EE  K FKKW  D K+L ++     R+ FI +R   A  R SK+ G  P
Sbjct: 658 WHLRLSLGDYDEEYKKQFKKWSSDFKALADFNHSYHRNSFINERAESATRRASKTAG--P 715

Query: 728 GSKLSQQQYHYPSTSEKPGKPQYIQIQNSNPTDWSGFRSKI-NTPAIDDNGNLITLTERK 786
           G      +++  ++    G      +Q+S  +D     SKI N   +D++GNLI    RK
Sbjct: 716 G------EFNKQNSDSSRGSSDSTIVQDSGRSD-----SKIGNIVGLDEDGNLIASDGRK 764

Query: 787 YA 788
           Y+
Sbjct: 765 YS 766

>AAR086W [272] [Homologous to ScYGR097W (ASK10) - SH; ScYPR115W -
           SH] complement(496601..499024) [2424 bp, 807 aa]
          Length = 807

 Score =  379 bits (974), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 219/536 (40%), Positives = 300/536 (55%), Gaps = 61/536 (11%)

Query: 281 ATSGFIKFGSGSIQDIQVILKKYHLSVANQQFKVSKEITTLLIPKLEELRKDLRVKIQEI 340
            ++GF+++GSGSIQD+QV LKKYH++V+NQQ K S+E+  ++IPKLEELR++L  KI+EI
Sbjct: 157 CSNGFLRYGSGSIQDLQVSLKKYHMTVSNQQLKASRELNNVVIPKLEELRRNLSSKIKEI 216

Query: 341 KDIHGDFKSNISHHVKLTNQLLNKYNNSIRIMNHQSHS------HHEFQPKHDPYXXXXX 394
           K++  DFK+NI   V LT QLL KY  S+ +++    S          +PKHDPY     
Sbjct: 217 KELSNDFKTNIHEQVALTGQLLQKYIASVDLLSTAEDSTSSKSTGQRLKPKHDPYLLKLQ 276

Query: 395 XXXXXXXXXSEENYLKDAYVNLQSSGMQLEKIIYSKIQNVLQRYTTLIDTEVRLMIKNLC 454
                     EENYL++AY+NLQ+SGM+LEKI+Y +IQ  LQ++   +D E    I  +C
Sbjct: 277 LDLQLKRQLLEENYLQEAYINLQTSGMELEKIVYGQIQTALQKFAHYMDIESCAAINGIC 336

Query: 455 HELQQGILSRPPAFEWDHFVSHHPKCLLNWKSVDPVPQPRKVSEIVYSNMKSPLAKCIRA 514
            EL++GILS+P   EWD FV  HP CLLNWKS DPVP PR++S+I Y  MKSP+AKCIRA
Sbjct: 337 QELRRGILSKPTTIEWDDFVGLHPTCLLNWKSSDPVPPPRRLSDIRYPKMKSPMAKCIRA 396

Query: 515 GY------FLKNGSKGYFVLTSNYLHEFKTSNFFNQQSSTLQAPASDPMGKKISTLNGLT 568
           GY       LKN +KGYFVLTSNYLHEFK+S+FF   ++        P  KKI+      
Sbjct: 397 GYLMKKSKLLKNYNKGYFVLTSNYLHEFKSSDFFKMANN-----GEKPSLKKIN----FD 447

Query: 569 PINSISLNECKLIETGENHFTIEGTVFHGPVTTTANQLXXXXXXXXXXXXLNATHHKKYH 628
           P+ SI LNE  + E     F +  T + G  +  A               L+AT      
Sbjct: 448 PLGSIPLNESTVTEALPQKFVLCST-WAGIDSQEAG--------------LSATSSGTSF 492

Query: 629 LPNLLXXXXXXXXXXXXXXXXXXXGSTVANNKTSIESKVK---WTFKPASKLTSEEDSKH 685
               +                   G  + + K S     K   WTFKP    ++ +  K 
Sbjct: 493 TS--MQGSRSSVSLGKLLKGAAKPGKALTSAKASTSEITKGHVWTFKP----STTQSEKD 546

Query: 686 FKKWVQDLKSLTNYKTVKDRSKFIEDRLMKAHYRSKSVGIIPGSKLSQQQYHYPSTSEKP 745
           FKKW  +L+ L  + +  +R ++IE++++KAH R+        SK SQ     P   E P
Sbjct: 547 FKKWCGELRQLAGFNSTLERCRYIEEKIVKAHSRA-------SSKASQSSIGTP--PEGP 597

Query: 746 G---KPQYIQIQNSNPTDWSGFRSKINTPAIDDNGNLITLTERKYAPTLSMTPSPM 798
           G   KPQ+I I+  +P  ++   S INTPA DDNGNLI   +R  +    +TPS +
Sbjct: 598 GRAQKPQFIDIKGLSPIGYN-IASPINTPAFDDNGNLIMAGDRNMS---LLTPSGL 649

 Score =  126 bits (317), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 80/118 (67%), Gaps = 16/118 (13%)

Query: 77  NLLGKNDERSPLYVDVPIPKALPKQEQQDLQNRDGSAATKGDIELEENQQYVREYPTDIM 136
            +L K+   SP YVDVP+P++L            G     GD    + Q YVREYPT I+
Sbjct: 31  GVLPKDHYSSPFYVDVPVPQSL------------GDHRHLGD----DTQSYVREYPTSIL 74

Query: 137 ADRFHKWKKILKALIAYLREVAYAQEQFGRINNQLKTAVKFSFLTDIQEGSNKLVEPM 194
           ADRF KW+K+LK+L+AYLREVA AQEQ  RIN  LK+AVKFSFL D++EG+NK+VE +
Sbjct: 75  ADRFDKWRKLLKSLVAYLREVAAAQEQHARINAHLKSAVKFSFLADLEEGTNKVVEQL 132

>Sklu_2395.6 YIL105C, Contig c2395 8302-10437
          Length = 711

 Score =  190 bits (482), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 109/304 (35%), Positives = 166/304 (54%), Gaps = 41/304 (13%)

Query: 285 FIKFGSGSIQDIQVILKKYHLSVANQQFKVSKEITTLLIPKLEELRKDLRVKIQEIKDIH 344
           F+  G+GSIQD+  IL +YH  +A+   K SKE+T  ++P+LE+LR+DL VKI+EIK + 
Sbjct: 250 FLPLGNGSIQDLPSILTQYHSQMASAASKASKELTNEVLPRLEDLRRDLLVKIKEIKGLQ 309

Query: 345 GDFKSNISHHVKLTNQLLNKYNNSIRIMNHQSHSHHEFQPKHDPYXXXXXXXXXXXXXXS 404
            DFK++ +  ++ T Q L  + +SI    + +        + DPY              +
Sbjct: 310 SDFKNSCNKELQQTKQDLKGFQDSIEEARYGT-------ARQDPYLAKIILDKQIKRQLT 362

Query: 405 EENYLKDAYVNLQSSGMQLEKIIYSKIQNVLQRYTTLIDTEVRLMIKNLCHELQQGILSR 464
           EEN+L +A+ NLQSSG +LEK++  +IQN L  Y  ++  E +L+   L  +L  G  ++
Sbjct: 363 EENFLHEAFNNLQSSGRELEKVVVMEIQNALTIYARILGQEAQLVFDILISKLDMGFFNK 422

Query: 465 PPAFEWDHFVSHHPKCLLNWKSVDPVPQPRKVSEIVYSNMKSPLAKCIRAGY------FL 518
            P FEWD+FVS  P        V+P    R + +IVY N   PL   +++G+      FL
Sbjct: 423 EPIFEWDNFVSKDPNF------VEPDLPMRHMKDIVYRNQFDPLTNEVKSGFLERRSKFL 476

Query: 519 KNGSKGYFVLTSNYLHEFKTSNFFNQQSSTLQAPASDPMGKKISTLNGLTPINSISLNEC 578
           K+ SKG++VLT ++LHEFKT +                  KK      L P+ S+SLN+C
Sbjct: 477 KSYSKGFYVLTPSFLHEFKTGD-----------------RKK-----DLVPVMSLSLNDC 514

Query: 579 KLIE 582
            + E
Sbjct: 515 TVAE 518

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 29/49 (59%)

Query: 132 PTDIMADRFHKWKKILKALIAYLREVAYAQEQFGRINNQLKTAVKFSFL 180
           PT+++A RF  W+ ++++++ Y+ E    Q++  R   +L  AV F F 
Sbjct: 182 PTEVLAQRFAAWRSVIRSILVYMTETVSIQDEIVRQQLRLSHAVNFPFF 230

>ADL234C [1507] [Homologous to ScYIL105C - SH; ScYNL047C - SH]
           (293117..295327) [2211 bp, 736 aa]
          Length = 736

 Score =  188 bits (478), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 105/304 (34%), Positives = 165/304 (54%), Gaps = 41/304 (13%)

Query: 285 FIKFGSGSIQDIQVILKKYHLSVANQQFKVSKEITTLLIPKLEELRKDLRVKIQEIKDIH 344
           F+  GSGSIQD+  IL  YH  +A+   K SKE+T  +IP+LE++R+DL VKI+EIK + 
Sbjct: 314 FLPLGSGSIQDLPTILTGYHAQMASMASKASKELTNEVIPRLEDMRRDLLVKIKEIKSLQ 373

Query: 345 GDFKSNISHHVKLTNQLLNKYNNSIRIMNHQSHSHHEFQPKHDPYXXXXXXXXXXXXXXS 404
            DFK++ +  V  T Q+L  ++ S+    + +       PK DPY              +
Sbjct: 374 SDFKNSCAKEVSETKQMLRTFHESVEQARYGT-------PKSDPYLTRILLDKQLKRQLA 426

Query: 405 EENYLKDAYVNLQSSGMQLEKIIYSKIQNVLQRYTTLIDTEVRLMIKNLCHELQQGILSR 464
           EEN+L  A+ NLQ+SG +LEK++  +IQ+ L  Y  ++  E +L+  ++  +L  G LSR
Sbjct: 427 EENFLHQAFNNLQASGKELEKVVVMEIQSALTVYARILGREAQLVFDSVITKLDMGFLSR 486

Query: 465 PPAFEWDHFVSHHPKCLLNWKSVDPVPQPRKVSEIVYSNMKSPLAKCIRAGY------FL 518
            P FEWD F++  P        V+P    R + +I Y +   PL   ++ G+      FL
Sbjct: 487 DPVFEWDDFIARDPNF------VEPSVPMRSLKDITYKHQYDPLTYKLQCGFLERRSKFL 540

Query: 519 KNGSKGYFVLTSNYLHEFKTSNFFNQQSSTLQAPASDPMGKKISTLNGLTPINSISLNEC 578
           K+ S+G++VLT ++LHEFKT +                  KK      ++P+ S+SL++C
Sbjct: 541 KSYSRGFYVLTPSFLHEFKTCD-----------------RKK-----DVSPVMSLSLSDC 578

Query: 579 KLIE 582
            + E
Sbjct: 579 TVAE 582

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%)

Query: 132 PTDIMADRFHKWKKILKALIAYLREVAYAQEQFGRINNQLKTAVKFSFLT 181
           PT+++A RF  W+ ++KA+I YL E A  Q++  R + +L  AV F F +
Sbjct: 246 PTEVLAGRFASWRAVIKAIIVYLTETASIQDELVRQHLRLSHAVSFPFFS 295

>YIL105C (YIL105C) [2571] chr9 complement(167578..169638) Protein
           with similarity to Ask10p and Ynl047p, contains a
           Q/N-rich domain [2061 bp, 686 aa]
          Length = 686

 Score =  187 bits (474), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 118/323 (36%), Positives = 172/323 (53%), Gaps = 44/323 (13%)

Query: 266 NIYPPIQQLESDDTSATSGFIKFGSGSIQDIQVILKKYHLSVANQQFKVSKEITTLLIPK 325
           N Y P  Q   +D S    F+  G+GSIQD+  IL +YH S+A+   K S+E+T  +IP+
Sbjct: 240 NQYQPSSQ---EDKSVQKFFLPLGNGSIQDLPTILNQYHESLASSASKASRELTNDVIPR 296

Query: 326 LEELRKDLRVKIQEIKDIHGDFKSNISHHVKLTNQLLNKYNNSIRIMNHQSHSHHEFQPK 385
           LE+LR+DL VKI+EIK +  DFK++ S  ++ T Q + ++  S++   +         PK
Sbjct: 297 LEDLRRDLIVKIKEIKSLQSDFKNSCSKELQQTKQAMKQFQESLKDARYSV-------PK 349

Query: 386 HDPYXXXXXXXXXXXXXXSEENYLKDAYVNLQSSGMQLEKIIYSKIQNVLQRYTTLIDTE 445
            DP+               EEN+L +A+ NL++SG +LEKI+  +IQN L  Y  L+  E
Sbjct: 350 QDPFLTKLALDRQIKKQLQEENFLHEAFDNLETSGAELEKIVVMEIQNSLTIYARLLGQE 409

Query: 446 VRLMIKNLCHELQQGILSRPPAFEWDHFVSHHPKCLLNWKSVDPVPQPRKVSEIVYSNMK 505
            +L+   L  +L  G  +  P FEWD+F+S  P  LL      P    R   EIVY    
Sbjct: 410 AQLVFDILISKLDSGFFNVDPQFEWDNFISRDPNFLL------PNLPMRTFKEIVYKYQF 463

Query: 506 SPLAKCIRAGY------FLKNGSKGYFVLTSNYLHEFKTSNFFNQQSSTLQAPASDPMGK 559
            PL   I++G+      FLK+ SKGY+VLT N+LHEFKT++                  K
Sbjct: 464 DPLTYEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTAD-----------------RK 506

Query: 560 KISTLNGLTPINSISLNECKLIE 582
           K      L P+ S++L+EC + E
Sbjct: 507 K-----DLVPVMSLALSECTVTE 524

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 132 PTDIMADRFHKWKKILKALIAYLREVAYAQEQFGRINNQLKTAVKFSFLT 181
           PTDI+A RF  W+ ++K++I YL E+A  Q++  R   +L  AV+F F +
Sbjct: 188 PTDILAARFSAWRNVIKSVIVYLTEIASIQDEIVRQQLRLSHAVQFPFFS 237

>CAGL0G02827g complement(259569..261818) similar to sp|P40485
           Saccharomyces cerevisiae YIL105c, start by similarity
          Length = 749

 Score =  187 bits (475), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 113/332 (34%), Positives = 167/332 (50%), Gaps = 41/332 (12%)

Query: 272 QQLESDDTSATSGFIKFGSGSIQDIQVILKKYHLSVANQQFKVSKEITTLLIPKLEELRK 331
           Q   S+D      F+  GSGS+QD+  IL +YH ++A+     S+E+T  +IP+LE+LR+
Sbjct: 283 QPTSSEDRYTQKFFLPLGSGSVQDLPTILNQYHEALASNASNASRELTNDVIPRLEDLRR 342

Query: 332 DLRVKIQEIKDIHGDFKSNISHHVKLTNQLLNKYNNSIRIMNHQSHSHHEFQPKHDPYXX 391
           DL VKI+EIK +  DFK++ +  ++ T Q +  Y +S++   + +       PK DPY  
Sbjct: 343 DLLVKIKEIKSLQSDFKNSCAKELQQTKQDMKHYIDSLKEARYGT-------PKQDPYLA 395

Query: 392 XXXXXXXXXXXXSEENYLKDAYVNLQSSGMQLEKIIYSKIQNVLQRYTTLIDTEVRLMIK 451
                        EEN+L +A+ NL++SG +LEK++  +IQN L  Y  L+  + +L+  
Sbjct: 396 KIALDKQIKKQLIEENFLHEAFDNLETSGAELEKVVVMEIQNALTIYARLLGQQSQLIFD 455

Query: 452 NLCHELQQGILSRPPAFEWDHFVSHHPKCLLNWKSVDPVPQPRKVSEIVYSNMKSPLAKC 511
            L  +L  G  +  P +EWD F+S  P  L       P    R + EI Y     P    
Sbjct: 456 ILISKLDMGFFNMNPQYEWDTFISRDPNFL------QPNVPMRNLKEITYKYQHDPFTYE 509

Query: 512 IRAGY------FLKNGSKGYFVLTSNYLHEFKTSNFFNQQSSTLQAPASDPMGKKISTLN 565
           IR+GY      FLK+ SKG++VLT N+LHEFK+                      I    
Sbjct: 510 IRSGYLERRSKFLKSYSKGFYVLTPNFLHEFKS----------------------IDRKK 547

Query: 566 GLTPINSISLNECKLIETGENHFTIEGTVFHG 597
            L PI S+SLNEC + E  +        V HG
Sbjct: 548 DLVPIMSLSLNECTVTEHSKKGSHEAKFVLHG 579

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 33/50 (66%)

Query: 132 PTDIMADRFHKWKKILKALIAYLREVAYAQEQFGRINNQLKTAVKFSFLT 181
           PTD++A RF  W+ +++++I YL E+A  +++  R   +L  AV+F F T
Sbjct: 228 PTDVLAARFSAWRNVIRSIIVYLTEIASIEDEIVRQQLRLSHAVQFPFFT 277

>Scas_671.23
          Length = 686

 Score =  185 bits (469), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 109/312 (34%), Positives = 164/312 (52%), Gaps = 41/312 (13%)

Query: 277 DDTSATSGFIKFGSGSIQDIQVILKKYHLSVANQQFKVSKEITTLLIPKLEELRKDLRVK 336
           +D +    F+  G+ SIQD+  IL  YH   AN     S+E+T  +IP+LE+LR+DL +K
Sbjct: 294 EDKATQKFFLPQGNNSIQDLPTILFNYHNKTANSASAASRELTNEVIPRLEDLRRDLLIK 353

Query: 337 IQEIKDIHGDFKSNISHHVKLTNQLLNKYNNSIRIMNHQSHSHHEFQPKHDPYXXXXXXX 396
           I+EIK +  DFK++    ++ T Q L  + +S++   + +       PK DPY       
Sbjct: 354 IKEIKSLQSDFKNSCIKELQQTKQDLRNFYDSLKDARYST-------PKQDPYLTKIVLD 406

Query: 397 XXXXXXXSEENYLKDAYVNLQSSGMQLEKIIYSKIQNVLQRYTTLIDTEVRLMIKNLCHE 456
                  SEEN+L +A+ NL++SG +LEK++  +IQN L +Y  L+  + +++  +L  +
Sbjct: 407 KQIKRQISEENFLHEAFDNLETSGAELEKVVVMEIQNALTQYARLLGQQSQIVFDDLIAK 466

Query: 457 LQQGILSRPPAFEWDHFVSHHPKCLLNWKSVDPVPQPRKVSEIVYSNMKSPLAKCIRAGY 516
           L  G  +  P FEWD+F++  P  LL      P    R    I+Y     PL   IR+GY
Sbjct: 467 LDSGFFNIDPQFEWDNFIARDPNFLL------PNLPMRNFKNIIYKAQYDPLTYQIRSGY 520

Query: 517 ------FLKNGSKGYFVLTSNYLHEFKTSNFFNQQSSTLQAPASDPMGKKISTLNGLTPI 570
                 FLK+ SKGY+VLT ++LHEFKTS+                  KK      L P+
Sbjct: 521 LERRSKFLKSYSKGYYVLTPSFLHEFKTSD-----------------RKK-----DLVPV 558

Query: 571 NSISLNECKLIE 582
            S+SL EC + E
Sbjct: 559 MSLSLTECTVQE 570

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 132 PTDIMADRFHKWKKILKALIAYLREVAYAQEQFGRINNQLKTAVKFSFLT 181
           PTDI+A RF  W+ I+++++AYL E A  Q++  R   +L  AV+F F +
Sbjct: 234 PTDILAARFSAWRNIIRSILAYLTETASIQDEIVRQQLRLSHAVQFPFFS 283

>Kwal_23.4958
          Length = 649

 Score =  181 bits (460), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 103/304 (33%), Positives = 161/304 (52%), Gaps = 41/304 (13%)

Query: 285 FIKFGSGSIQDIQVILKKYHLSVANQQFKVSKEITTLLIPKLEELRKDLRVKIQEIKDIH 344
           F+  G+GS+QD+  IL ++H  +AN   K+SKE+   +IP+LE+LR DL +KI+EIK +H
Sbjct: 213 FLPMGNGSVQDLPSILSQFHSQMANGALKMSKELANEVIPRLEDLRGDLLIKIKEIKTLH 272

Query: 345 GDFKSNISHHVKLTNQLLNKYNNSIRIMNHQSHSHHEFQPKHDPYXXXXXXXXXXXXXXS 404
            DFK++ S  ++ T   L  +  ++    + +       PK DPY              +
Sbjct: 273 SDFKNSCSKELQQTKHDLKHFIEAVEAARYGA-------PKSDPYLIKISLEKQIKRQLN 325

Query: 405 EENYLKDAYVNLQSSGMQLEKIIYSKIQNVLQRYTTLIDTEVRLMIKNLCHELQQGILSR 464
           EEN L +A+ NLQ SG +LEK++  +IQN L  Y  L+    +++   L   L  G  ++
Sbjct: 326 EENLLHEAFDNLQGSGRELEKVVVMEIQNALSIYARLLGQNAQIVFDVLISRLDVGFFNK 385

Query: 465 PPAFEWDHFVSHHPKCLLNWKSVDPVPQPRKVSEIVYSNMKSPLAKCIRAGY------FL 518
            P FEWD+F+S  P        ++P    R + +IVY     PL   +++G+      FL
Sbjct: 386 EPVFEWDNFISKDPNF------IEPNLPVRHMRDIVYKYQDDPLTYEVKSGFLERRSKFL 439

Query: 519 KNGSKGYFVLTSNYLHEFKTSNFFNQQSSTLQAPASDPMGKKISTLNGLTPINSISLNEC 578
           K+ +KG+++LTS+YLHEFKT                 P  K+      L P+ S+SLN+C
Sbjct: 440 KSYTKGFYLLTSSYLHEFKT-----------------PDRKR-----DLVPVMSLSLNDC 477

Query: 579 KLIE 582
            + E
Sbjct: 478 TVAE 481

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 29/49 (59%)

Query: 132 PTDIMADRFHKWKKILKALIAYLREVAYAQEQFGRINNQLKTAVKFSFL 180
           PT+++A RF  W+ ++++++ YL E    Q++  R   +L  AV F F 
Sbjct: 145 PTEVLAQRFAAWRSVIRSILVYLTETVSIQDEIVRQQLRLSHAVNFPFF 193

>YNL047C (YNL047C) [4541] chr14 complement(539909..541879) Protein
           with similarity to Ask10p [1971 bp, 656 aa]
          Length = 656

 Score =  175 bits (443), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 110/318 (34%), Positives = 169/318 (53%), Gaps = 42/318 (13%)

Query: 272 QQLESDDTSATSGFIKFGSGSIQDIQVILKKYHLSVANQQFKVSKEITTLLIPKLEELRK 331
           Q + ++D S    F+  GSGS+QD+  +L KYH ++A+   K SKE+T+ +IP+LE+LR+
Sbjct: 219 QPVSNEDKSMQKFFLPLGSGSVQDLPTMLTKYHDNLASLASKSSKELTSEIIPRLEDLRR 278

Query: 332 DLRVKIQEIKDIHGDFKSNISHHVKLTNQLLNKYNNSIRIMNHQSHSHHEFQPKHDPYXX 391
           DL VKI+EIK +  DFK++ +  ++ T  L+  +N S++     +       PK DP+  
Sbjct: 279 DLLVKIKEIKALQSDFKNSCNKELQQTKHLMKLFNESLKECKLGT-------PKSDPFLI 331

Query: 392 XXXXXXXXXXXXSEENYLKDAYVNLQSSGMQLEKIIYSKIQNVLQRYTTLIDTEVRLMIK 451
                        EENYL +A+ NLQ+SG QLE +I  +IQN L  Y  ++  E +++  
Sbjct: 332 KLQLEKQIKRQLVEENYLHEAFDNLQNSGAQLESVIVMEIQNGLTSYARILGKEAQVVFD 391

Query: 452 NLCHELQQGILSRPPAFEWDHFVSHHPKCLLNWKSVDPVPQP-RKVSEIVYSNMKSPLAK 510
           ++  +L   IL++    EWD F+      L N  +  P   P R+  EI YSN   P   
Sbjct: 392 SVISKLDSTILNKNTNLEWDSFI------LRNISNFVPPNLPMRRFKEISYSNQNDPFTF 445

Query: 511 CIRAGY------FLKNGSKGYFVLTSNYLHEFKTSNFFNQQSSTLQAPASDPMGKKISTL 564
            +++G+      FLK+ S+G++VLT ++LHEFKT                 P   K S  
Sbjct: 446 EVKSGFLEKRSKFLKSYSRGFYVLTPSFLHEFKT-----------------PDKHKFS-- 486

Query: 565 NGLTPINSISLNECKLIE 582
              TP+ SI L EC + E
Sbjct: 487 ---TPLMSIPLVECTVTE 501

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 32/50 (64%)

Query: 132 PTDIMADRFHKWKKILKALIAYLREVAYAQEQFGRINNQLKTAVKFSFLT 181
           PTD+++ RF  W+ +++A++ YL E A  Q++  R   +L  AV+F F +
Sbjct: 164 PTDVLSARFSAWRNVIRAILVYLSETASIQDEIVRQQLRLSHAVQFPFFS 213

>KLLA0F03839g complement(363977..365923) similar to sp|P40485
           Saccharomyces cerevisiae YIL105c, start by similarity
          Length = 648

 Score =  172 bits (436), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 99/312 (31%), Positives = 163/312 (52%), Gaps = 41/312 (13%)

Query: 277 DDTSATSGFIKFGSGSIQDIQVILKKYHLSVANQQFKVSKEITTLLIPKLEELRKDLRVK 336
           +D +    F+  G GSIQD+  +  +YH  + +   K SKE++  +IP+LE++R+DL VK
Sbjct: 218 EDKNIQKFFLPLGHGSIQDLPTLFNQYHTQMVHAASKASKELSQDVIPRLEDMRRDLLVK 277

Query: 337 IQEIKDIHGDFKSNISHHVKLTNQLLNKYNNSIRIMNHQSHSHHEFQPKHDPYXXXXXXX 396
           I+EI+ +  DFK++ +  ++ T   L  +  S+    + S        K DP+       
Sbjct: 278 IKEIQSLESDFKNSCNKELQETKIRLKAFQESLENSKYGS-------VKQDPFLAKILLE 330

Query: 397 XXXXXXXSEENYLKDAYVNLQSSGMQLEKIIYSKIQNVLQRYTTLIDTEVRLMIKNLCHE 456
                  +EEN+L +A+ NLQ+SG +LEK++  +IQN L  Y  ++  E +++   L  +
Sbjct: 331 KQIKKQLTEENFLHEAFNNLQTSGRELEKVVMMEIQNALTSYAKVLGQEAQIVFDVLISK 390

Query: 457 LQQGILSRPPAFEWDHFVSHHPKCLLNWKSVDPVPQPRKVSEIVYSNMKSPLAKCIRAGY 516
           L  G  ++ P FEW++FV+  P        +DP    R+V +IVY N   P    I++G 
Sbjct: 391 LDTGFFNKDPVFEWENFVAKDPNF------IDPNLPMRRVKDIVYKNQNDPFTYEIKSGI 444

Query: 517 ------FLKNGSKGYFVLTSNYLHEFKTSNFFNQQSSTLQAPASDPMGKKISTLNGLTPI 570
                 FLK+ S+G++VLT ++LHEFK+ +                  KK      L P+
Sbjct: 445 LERRSKFLKSYSRGFYVLTPSFLHEFKSGD-----------------RKK-----DLIPV 482

Query: 571 NSISLNECKLIE 582
            S+SLN+C + E
Sbjct: 483 ISLSLNDCTVAE 494

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 33/50 (66%)

Query: 132 PTDIMADRFHKWKKILKALIAYLREVAYAQEQFGRINNQLKTAVKFSFLT 181
           PT++++ RF  W+ I+++L+ YL+E    Q++  R + +L+ A+ F F T
Sbjct: 158 PTEVLSQRFAAWRGIIRSLLVYLQETVSIQDEVVRQHLRLQHAINFPFFT 207

>CAGL0G01386g complement(132280..133878) similar to sp|P40485
           Saccharomyces cerevisiae YIL105c or sp|P53955
           Saccharomyces cerevisiae YNL047c, hypothetical start
          Length = 532

 Score =  161 bits (408), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 107/305 (35%), Positives = 164/305 (53%), Gaps = 42/305 (13%)

Query: 285 FIKFGSGSIQDIQVILKKYHLSVANQQFKVSKEITTLLIPKLEELRKDLRVKIQEIKDIH 344
           F+  G+GSIQD+ +IL++YH  +A +  K ++E+   +IP LE L KDL +KI+ IK + 
Sbjct: 130 FLPIGNGSIQDVPIILRQYHDVMAAEAAKGTRELQNSIIPGLESLNKDLVLKIKSIKSLS 189

Query: 345 GDFKSNISHHVKLTNQLLNKYNNSIRIMNHQSHSHHEFQPKHDPYXXXXXXXXXXXXXXS 404
            DFK+N S  +  T + + K+  SI    +Q+  +    P  DPY              S
Sbjct: 190 SDFKNNCSKELDTTRECMVKFQQSI----NQARKN---VPARDPYLLKVNLDNQIRRQLS 242

Query: 405 EENYLKDAYVNLQSSGMQLEKIIYSKIQNVLQRYTTLIDTEVRLMIKNLCHELQQGILSR 464
           EEN+L +A++NLQSSG +LEKI+ + IQN  +    ++  E +++   L + L    LS 
Sbjct: 243 EENFLHEAFMNLQSSGQELEKIVVASIQNAFRVLAQILGAEAKIIDDQLVNRLLSSFLSL 302

Query: 465 PPAFEWDHFVSHHPKCLLNWKSVDPVPQP-RKVSEIVYSNMKSPLAKCIRAGY------F 517
            P+ EWD+F+      L +  +  P+  P RK  EI Y+    PL   ++ GY      +
Sbjct: 303 SPSHEWDNFL------LRDNTNFIPLNLPMRKFKEIEYTGKNDPLTLVVQCGYLERRSKY 356

Query: 518 LKNGSKGYFVLTSNYLHEFKTSNFFNQQSSTLQAPASDPMGKKISTLNGLTPINSISLNE 577
           LK+ +KGY+VLT NYLHEFKTS+                  K+ S      P+ S+SL E
Sbjct: 357 LKSYTKGYYVLTPNYLHEFKTSD-----------------RKRDS-----VPLFSLSLAE 394

Query: 578 CKLIE 582
           CK+++
Sbjct: 395 CKVVQ 399

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%)

Query: 131 YPTDIMADRFHKWKKILKALIAYLREVAYAQEQFGRIN 168
           +P + +A RF +W+K+LKA+I YL EVA  QE+  R N
Sbjct: 20  HPAEQLAQRFTEWRKVLKAIIVYLSEVASVQEEIIRQN 57

>Kwal_26.7055
          Length = 1555

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 44/82 (53%), Gaps = 6/82 (7%)

Query: 295  DIQVILKKYHLSVANQQFKVSKEITTLLIPKLEELRKDLRVKIQEIKDIHGDFK------ 348
            D ++  KK  L  A  + + +K+    L+ + E+L+ D+R K++E+ ++  +F+      
Sbjct: 999  DAELANKKIELDNAKAEVEAAKKEIEDLLSQQEQLKADVRAKVEELNNVQQEFEDSRTQN 1058

Query: 349  SNISHHVKLTNQLLNKYNNSIR 370
            S++ + VK     +N+   SIR
Sbjct: 1059 SDLRNEVKSLKDEINRLQTSIR 1080

>Kwal_55.21164
          Length = 588

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 2/82 (2%)

Query: 276 SDDTSATSGFIKFGSGSIQDIQVIL--KKYHLSVANQQFKVSKEITTLLIPKLEELRKDL 333
           S+ +S  + F +     + ++Q I+  KK  L     +   SK+    L+ KLE L+++ 
Sbjct: 64  SEGSSHMTAFYRENIRQLNELQDIMFQKKCKLDAIKDELGESKDEFRTLMLKLETLKEEK 123

Query: 334 RVKIQEIKDIHGDFKSNISHHV 355
            VK+Q+IK  + D K     HV
Sbjct: 124 NVKLQQIKLKNNDLKKLSDEHV 145

>KLLA0D02398g complement(202446..206063) similar to sp|P06105
            Saccharomyces cerevisiae YJL080c SCP160 required for
            maintenance of exact ploidy singleton, start by
            similarity
          Length = 1205

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 31/61 (50%), Gaps = 6/61 (9%)

Query: 32   SGSQYQYPQVVTPGENVSSNATSLSYSAFNSPISTIPNSLNASSVNL---LG---KNDER 85
            S + Y+ P+ V  GEN SSN    S +   + + TIP  L  S ++L   LG   K DE 
Sbjct: 1053 SRANYKVPENVAGGENESSNVLIQSVTETEAKVDTIPWRLTYSPIDLSDVLGEDYKKDEE 1112

Query: 86   S 86
            S
Sbjct: 1113 S 1113

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.126    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 33,640,778
Number of extensions: 1430084
Number of successful extensions: 5105
Number of sequences better than 10.0: 73
Number of HSP's gapped: 5183
Number of HSP's successfully gapped: 100
Length of query: 1108
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 996
Effective length of database: 12,718,893
Effective search space: 12668017428
Effective search space used: 12668017428
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)