Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_716.27d22122111851e-168
KLLA0D15103g2212065165e-66
CAGL0G03201g2152114582e-57
Kwal_55.205442082084243e-52
AAR087C2322194124e-50
Scas_662.1230843661.3
YDR320C (SWA2)66857661.7
YMR312W (ELP6)273111632.8
Kwal_47.1917383632608.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_716.27d
         (221 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_716.27d                                                          461   e-168
KLLA0D15103g complement(1275080..1275745) similar to ca|CA0389|I...   203   5e-66
CAGL0G03201g complement(299021..299668) similar to KLLA0D15103g ...   181   2e-57
Kwal_55.20544                                                         167   3e-52
AAR087C [273] [Homologous to NOHBY] (499168..499866) [699 bp, 23...   163   4e-50
Scas_662.12                                                            30   1.3  
YDR320C (SWA2) [1148] chr4 complement(1106088..1108094) Bifuncti...    30   1.7  
YMR312W (ELP6) [4266] chr13 (898404..899225) Subunit of RNA poly...    29   2.8  
Kwal_47.19173                                                          28   8.8  

>Scas_716.27d
          Length = 221

 Score =  461 bits (1185), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 221/221 (100%), Positives = 221/221 (100%)

Query: 1   MKWCLPRLYSTGITKNSVTQTRFKETMSRVSNSVSIVTAAVGIDQKQDTYHGLTISSMTS 60
           MKWCLPRLYSTGITKNSVTQTRFKETMSRVSNSVSIVTAAVGIDQKQDTYHGLTISSMTS
Sbjct: 1   MKWCLPRLYSTGITKNSVTQTRFKETMSRVSNSVSIVTAAVGIDQKQDTYHGLTISSMTS 60

Query: 61  LALNPFPLIQFNLKLPSFTSESLHKYGYFGVHLLGSNERAVKLANQFSKGARQCENGLFE 120
           LALNPFPLIQFNLKLPSFTSESLHKYGYFGVHLLGSNERAVKLANQFSKGARQCENGLFE
Sbjct: 61  LALNPFPLIQFNLKLPSFTSESLHKYGYFGVHLLGSNERAVKLANQFSKGARQCENGLFE 120

Query: 121 RTKPFIGLKEGADFETHYIKHSEFKIPLLKYCRRILICKKVEVFRIGDHEIWVGKVNDII 180
           RTKPFIGLKEGADFETHYIKHSEFKIPLLKYCRRILICKKVEVFRIGDHEIWVGKVNDII
Sbjct: 121 RTKPFIGLKEGADFETHYIKHSEFKIPLLKYCRRILICKKVEVFRIGDHEIWVGKVNDII 180

Query: 181 INDVHDSDHGGLLHYNRGFHKLGDNILSNDSMQNKFGITDS 221
           INDVHDSDHGGLLHYNRGFHKLGDNILSNDSMQNKFGITDS
Sbjct: 181 INDVHDSDHGGLLHYNRGFHKLGDNILSNDSMQNKFGITDS 221

>KLLA0D15103g complement(1275080..1275745) similar to
           ca|CA0389|IPF14465 Candida albicans unknown function,
           start by similarity
          Length = 221

 Score =  203 bits (516), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 100/206 (48%), Positives = 140/206 (67%), Gaps = 6/206 (2%)

Query: 7   RLYSTG-ITKNSVTQTRFKETMSRVSNSVSIVTAAVGIDQKQDTYHGLTISSMTSLALNP 65
           RLYST  I+ + +TQ +F+ETM R+ N   I+T AV I    D + G+T+SS+TSL+L P
Sbjct: 11  RLYSTAKISIHDITQQKFRETMGRICNQAMILTTAVPIHCNSDRFRGVTLSSVTSLSLMP 70

Query: 66  FPLIQFNLKLPSFTSESLHKYGYFGVHLLGSNERAVKLANQFSKGA-RQCENGLFERTKP 124
            PLIQFNL+LPSFTS+ LH + +F +HL+  NE+++ LA  FSKGA +   NG    T+P
Sbjct: 71  IPLIQFNLQLPSFTSDFLHDFNHFALHLMKPNEQSIHLARNFSKGAMKNTHNGEIVPTQP 130

Query: 125 FIGLKEGADFETHYIKHSEFKIPLLKYCRRILICKKVEVFRIGDHEIWVGKVNDII---- 180
           F+GL+EG +++T+ I  +  +IPLLK   R+++C+ ++ F +GDHEIWVGKV DI+    
Sbjct: 131 FVGLQEGVEYDTYDINGTNLRIPLLKNAERVIVCQGLKTFNVGDHEIWVGKVEDIVNRTS 190

Query: 181 INDVHDSDHGGLLHYNRGFHKLGDNI 206
                D   GGLL+ NR FH LGD I
Sbjct: 191 EEGADDPISGGLLYCNRNFHTLGDPI 216

>CAGL0G03201g complement(299021..299668) similar to KLLA0D15103g
           Kluyveromyces lactis, hypothetical start
          Length = 215

 Score =  181 bits (458), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 98/211 (46%), Positives = 134/211 (63%), Gaps = 15/211 (7%)

Query: 4   CLP-------RLYSTGITKNSVTQTRFKETMSRVSNSVSIVTAAVGIDQKQDTYHGLTIS 56
           CLP       R  S G  K+ VTQ +FKE+M++V+N   ++TAA  +    + +HGLTIS
Sbjct: 12  CLPLQHLVTKRCLSYG-GKHVVTQQKFKESMAKVANQAMVLTAASPVGTSHELFHGLTIS 70

Query: 57  SMTSLALNPFPLIQFNLKLPSFTSESLHKYGYFGVHLLGSNERAVKLANQFSKGARQCEN 116
           SMTSLAL P P+IQFNL+LPS TS++LH+  YF +HLL     ++ +   FSKGA Q  N
Sbjct: 71  SMTSLALKPHPMIQFNLQLPSATSDTLHQNRYFAIHLLNPTNESIDIIRNFSKGALQGIN 130

Query: 117 GLFERTKPFIGLKEGADFETHYI-KHSEFKIPLLKYCRRILICKKVEVFRIGDHEIWVGK 175
               RT PF  L+    +  H I   + + +P+LK  +  +ICKK  VFR+GDHEIWVG 
Sbjct: 131 ----RTMPFKDLEMNEHYMIHKIGNKTNYDLPILKEAQLAIICKKKNVFRVGDHEIWVGV 186

Query: 176 VNDIIINDVHDSDHGGLLHYNRGFHKLGDNI 206
           V D I+  ++D  +GG+L+ NR FHKLG +I
Sbjct: 187 VEDTIV--MNDDTNGGVLYCNRNFHKLGSHI 215

>Kwal_55.20544
          Length = 208

 Score =  167 bits (424), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 91/208 (43%), Positives = 138/208 (66%), Gaps = 3/208 (1%)

Query: 1   MKWCLPRLYSTGITKNSVTQTRFKETMSRVSNSVSIVTAAVGIDQKQDTYHGLTISSMTS 60
           M++ + R Y   I +N++ Q +FK++M+R+ +   I+T+A         Y G+T+SS++S
Sbjct: 1   MRFPIAR-YQCTINRNALIQQKFKDSMARMGSQAMILTSAGKSSLPHKLYRGVTLSSVSS 59

Query: 61  LALNPFPLIQFNLKLPSFTSESLHKYGYFGVHLLGSNERAVKLANQFSKGA-RQCENGLF 119
           L+L P PL+QFNL+LPSFTS+SLH +G+F VHLL  +  +++LA  FSKGA +  E+G  
Sbjct: 60  LSLKPQPLLQFNLQLPSFTSDSLHSHGFFAVHLLKPDLDSMQLARIFSKGAMKHKESGEI 119

Query: 120 ERTKPFIGLKEGADFETHYIKHSEFKIPLLKYCRRILICKKVEVFRIGDHEIWVGKVNDI 179
             T+PF  L E   +E + + + +  +P+LK   R+ +C+K +VFR+GDHEIWVG V+DI
Sbjct: 120 IPTEPFKDLTESVHYELYALNNCDLSVPVLKNSERVFVCRKKDVFRVGDHEIWVGLVDDI 179

Query: 180 IINDVHDSD-HGGLLHYNRGFHKLGDNI 206
           I N    +   GGLL+ +R FHKLG  I
Sbjct: 180 IENTTDSASVSGGLLYCDRRFHKLGKGI 207

>AAR087C [273] [Homologous to NOHBY] (499168..499866) [699 bp, 232
           aa]
          Length = 232

 Score =  163 bits (412), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 125/219 (57%), Gaps = 39/219 (17%)

Query: 18  VTQTRFKETMSRVSNSVSIVTAAVGIDQKQDTYHGLTISSMTSLALNPFPLIQFNLKLPS 77
           VTQ +FKETMSR+SN V I+T +        +  G+T+ S TSLAL P P+IQFNL+LPS
Sbjct: 22  VTQQKFKETMSRISNQVMILTTS--------SMKGVTLGSATSLALQPRPMIQFNLQLPS 73

Query: 78  FTSESLHKYGYFGVHLLGSNERAVKLANQFSKGA-RQCENGLFERTKPFIGLKEGADFET 136
           FTS+ LHK   F +HL+   E++VKLA  FSKGA R+ ++G+   T+PF  L  GADF  
Sbjct: 74  FTSQELHKRRKFALHLMAPTEQSVKLARLFSKGAIRRPDSGVMP-TRPFEALAAGADFAL 132

Query: 137 HYIKHSE--------------------------FKIPLLKYCRRILICKKVEVFRIGDHE 170
           H    S                            ++P+L    R+LIC+ +  FR+GDHE
Sbjct: 133 HKTSASTGGSLEPVVEDEILDHGLDKPALGARTVELPVLASAERVLICECIRCFRVGDHE 192

Query: 171 IWVGKVNDIII---NDVHDSDHGGLLHYNRGFHKLGDNI 206
           IWVG V +I+    N  + +  GGL++ NR F K+G  I
Sbjct: 193 IWVGMVEEILSPANNAPNSAVTGGLMYCNRQFFKIGSPI 231

>Scas_662.12
          Length = 308

 Score = 30.0 bits (66), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 27/43 (62%)

Query: 46 KQDTYHGLTISSMTSLALNPFPLIQFNLKLPSFTSESLHKYGY 88
          +++   GL+  S+T+L ++P  LI+  L+L + T+   H+ GY
Sbjct: 8  QKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGY 50

>YDR320C (SWA2) [1148] chr4 complement(1106088..1108094)
          Bifunctional clathrin-binding protein required for
          normal clathrin function and for uncoating of
          clathrin-coated vesicles, required for cortical ER
          inheritance, contains a tetratricopeptide repeat (TPR)
          domain [2007 bp, 668 aa]
          Length = 668

 Score = 30.0 bits (66), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%)

Query: 15 KNSVTQTRFKETMSRVSNSVSIVTAAVGIDQKQDTYHGLTISSMTSLALNPFPLIQF 71
          KN  + +  KET  + SNS SI  +AV    + D     ++ S+++  L P P + F
Sbjct: 13 KNKDSASASKETTPQSSNSPSITGSAVADVARTDKSPNDSLHSISAPPLIPSPKVDF 69

>YMR312W (ELP6) [4266] chr13 (898404..899225) Subunit of RNA
           polymerase II elongator complex [822 bp, 273 aa]
          Length = 273

 Score = 28.9 bits (63), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 50/111 (45%), Gaps = 9/111 (8%)

Query: 73  LKLPSFTSESLHKYGYFGVHLLGSNERAVKLANQFSKGARQCENG------LFERTKPFI 126
           LK+PS     L     F V+ + +  R   L++  +K +   +N       + E+ +  +
Sbjct: 96  LKIPSNNYNVLDFLSDFIVNNIHNKPRDKILSDVLAKFSAAIQNNPTDTIVIIEQPELLL 155

Query: 127 GLKEGADFETHYIKHSEFKIPLLKYCRRILICKKVEVFRIGDHEIWVGKVN 177
            L  G    T    +++F  PLL+ C+ ++I    ++F I +++  V   N
Sbjct: 156 SLVSGL---TCSELNNKFITPLLRQCKVLIIVSNSDIFNIDEYDASVHSSN 203

>Kwal_47.19173
          Length = 836

 Score = 27.7 bits (60), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 17/32 (53%)

Query: 124 PFIGLKEGADFETHYIKHSEFKIPLLKYCRRI 155
           PFI LK G    T++  H EF   +L Y R +
Sbjct: 479 PFIALKPGNMVRTNFGLHEEFVFDILSYQRML 510

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.137    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,514,047
Number of extensions: 321907
Number of successful extensions: 708
Number of sequences better than 10.0: 15
Number of HSP's gapped: 700
Number of HSP's successfully gapped: 15
Length of query: 221
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 123
Effective length of database: 13,203,545
Effective search space: 1624036035
Effective search space used: 1624036035
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)