Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_716.271620162080590.0
YGR098C (ESP1)1630165132900.0
AAR089C1618164825740.0
Kwal_55.205351636166223460.0
KLLA0D15136g1591154922720.0
CAGL0G03223g1604156016500.0
Kwal_34.15777499101761.3
KLLA0F27797g1101167716.2
Scas_638.10108174706.8
AGL287W276859707.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_716.27
         (1620 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_716.27                                                          3108   0.0  
YGR098C (ESP1) [2058] chr7 complement(682568..687460) Separin pr...  1271   0.0  
AAR089C [275] [Homologous to ScYGR098C (ESP1) - SH] (500951..505...   996   0.0  
Kwal_55.20535                                                         908   0.0  
KLLA0D15136g complement(1276819..1281594) similar to sp|Q03018 S...   879   0.0  
CAGL0G03223g complement(300119..304933) similar to sp|Q03018 Sac...   640   0.0  
Kwal_34.15777                                                          34   1.3  
KLLA0F27797g complement(2572415..2575720) similar to sp|P40541 S...    32   6.2  
Scas_638.10                                                            32   6.8  
AGL287W [4025] [Homologous to ScYBL088C (TEL1) - SH] complement(...    32   7.8  

>Scas_716.27
          Length = 1620

 Score = 3108 bits (8059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1532/1620 (94%), Positives = 1532/1620 (94%)

Query: 1    MSKQEDPLNEVSLNTTTWHSPSKRGQNNELKNFNAYPNKENIPQLHTGRLEKDLDLYYKQ 60
            MSKQEDPLNEVSLNTTTWHSPSKRGQNNELKNFNAYPNKENIPQLHTGRLEKDLDLYYKQ
Sbjct: 1    MSKQEDPLNEVSLNTTTWHSPSKRGQNNELKNFNAYPNKENIPQLHTGRLEKDLDLYYKQ 60

Query: 61   ISEFIKAQSLQKPQIERIHAVFTTXXXXXXXXXXXXXXXXXVKEHLIVVVKLINNNFYDY 120
            ISEFIKAQSLQKPQIERIHAVFTT                 VKEHLIVVVKLINNNFYDY
Sbjct: 61   ISEFIKAQSLQKPQIERIHAVFTTLYRELNRRHLLRHLRALVKEHLIVVVKLINNNFYDY 120

Query: 121  SQSGILCLYNTTNLFKAHDLKDVILADFSESNEFYLSTLKILSFQVILKKKNLKMYEDTI 180
            SQSGILCLYNTTNLFKAHDLKDVILADFSESNEFYLSTLKILSFQVILKKKNLKMYEDTI
Sbjct: 121  SQSGILCLYNTTNLFKAHDLKDVILADFSESNEFYLSTLKILSFQVILKKKNLKMYEDTI 180

Query: 181  IQAFSHDERYILKDPNIKIHTVVKLLLNFFSILPTFKTLFGLKFLQYIKQFNLSFQTYIK 240
            IQAFSHDERYILKDPNIKIHTVVKLLLNFFSILPTFKTLFGLKFLQYIKQFNLSFQTYIK
Sbjct: 181  IQAFSHDERYILKDPNIKIHTVVKLLLNFFSILPTFKTLFGLKFLQYIKQFNLSFQTYIK 240

Query: 241  NMDSITFEKQLVRYGSKNIQQLKPYLNSYYINYSKFNSHLTKLMLTDFVGRDLQSHKKTF 300
            NMDSITFEKQLVRYGSKNIQQLKPYLNSYYINYSKFNSHLTKLMLTDFVGRDLQSHKKTF
Sbjct: 241  NMDSITFEKQLVRYGSKNIQQLKPYLNSYYINYSKFNSHLTKLMLTDFVGRDLQSHKKTF 300

Query: 301  ALLKDHKEISSTSTECYCCLSHSQMDNFVISCHALMSNNDQIHLHTIDAVTFGWSIIRSE 360
            ALLKDHKEISSTSTECYCCLSHSQMDNFVISCHALMSNNDQIHLHTIDAVTFGWSIIRSE
Sbjct: 301  ALLKDHKEISSTSTECYCCLSHSQMDNFVISCHALMSNNDQIHLHTIDAVTFGWSIIRSE 360

Query: 361  NFPRNKKMLALLDSTLIFLNSQMKHLEKMQISLVKLIKMLAEVCMDYQEYKRMTNVIXXX 420
            NFPRNKKMLALLDSTLIFLNSQMKHLEKMQISLVKLIKMLAEVCMDYQEYKRMTNVI   
Sbjct: 361  NFPRNKKMLALLDSTLIFLNSQMKHLEKMQISLVKLIKMLAEVCMDYQEYKRMTNVINVS 420

Query: 421  XXXXXXXXXXXXLKLTAELESKHYLVCHDKSQWKKLIQKFEKFIGSAPEQYQKIELFSYV 480
                        LKLTAELESKHYLVCHDKSQWKKLIQKFEKFIGSAPEQYQKIELFSYV
Sbjct: 421  FNCFVFFRNFDFLKLTAELESKHYLVCHDKSQWKKLIQKFEKFIGSAPEQYQKIELFSYV 480

Query: 481  FNTFLLFNDDSLSFVVEFTETIFLRCFSRLKLTYFIDFHDVSEPMLSILYGNSSITNIPH 540
            FNTFLLFNDDSLSFVVEFTETIFLRCFSRLKLTYFIDFHDVSEPMLSILYGNSSITNIPH
Sbjct: 481  FNTFLLFNDDSLSFVVEFTETIFLRCFSRLKLTYFIDFHDVSEPMLSILYGNSSITNIPH 540

Query: 541  GDWNNLTEMLFFCVSGRFEINAININQVTTKWYYLYKYKDLIKSIYVLNLDMKKHXXXXX 600
            GDWNNLTEMLFFCVSGRFEINAININQVTTKWYYLYKYKDLIKSIYVLNLDMKKH     
Sbjct: 541  GDWNNLTEMLFFCVSGRFEINAININQVTTKWYYLYKYKDLIKSIYVLNLDMKKHSSSNL 600

Query: 601  XXXXXXXXXKWVQKTSLLNEGISSIEVTFITMLFQYLGFNNFNKCILTLSAALRDHINYF 660
                     KWVQKTSLLNEGISSIEVTFITMLFQYLGFNNFNKCILTLSAALRDHINYF
Sbjct: 601  SQLTSSYISKWVQKTSLLNEGISSIEVTFITMLFQYLGFNNFNKCILTLSAALRDHINYF 660

Query: 661  APLKLEISRWNIQSSINLQLMEQINDEAKLLSTIAPTYTICKLEKLLTFLEAKLDVFTWT 720
            APLKLEISRWNIQSSINLQLMEQINDEAKLLSTIAPTYTICKLEKLLTFLEAKLDVFTWT
Sbjct: 661  APLKLEISRWNIQSSINLQLMEQINDEAKLLSTIAPTYTICKLEKLLTFLEAKLDVFTWT 720

Query: 721  NDYEGFQELFMEELPSVRLEVFDLNNQSKMPASQYIKVLLFMTKLFNHSSRLHLARDDIT 780
            NDYEGFQELFMEELPSVRLEVFDLNNQSKMPASQYIKVLLFMTKLFNHSSRLHLARDDIT
Sbjct: 721  NDYEGFQELFMEELPSVRLEVFDLNNQSKMPASQYIKVLLFMTKLFNHSSRLHLARDDIT 780

Query: 781  ASVIESKRALKLATSLIKKQNKLSQSSRIRLINLVLNSFTQLIEIYIRLGLAKEADYYAD 840
            ASVIESKRALKLATSLIKKQNKLSQSSRIRLINLVLNSFTQLIEIYIRLGLAKEADYYAD
Sbjct: 781  ASVIESKRALKLATSLIKKQNKLSQSSRIRLINLVLNSFTQLIEIYIRLGLAKEADYYAD 840

Query: 841  QLSKVICDLGEPSVVYRGLHFLHNYYKLVKHEALEIITLQKANKTFDYLDGESDIESVLM 900
            QLSKVICDLGEPSVVYRGLHFLHNYYKLVKHEALEIITLQKANKTFDYLDGESDIESVLM
Sbjct: 841  QLSKVICDLGEPSVVYRGLHFLHNYYKLVKHEALEIITLQKANKTFDYLDGESDIESVLM 900

Query: 901  FLFDNSEFKKISESLNLFFQDDFNNSFLPLYWQLKMGRPIDDSLCLTTLKSTNSIKKLER 960
            FLFDNSEFKKISESLNLFFQDDFNNSFLPLYWQLKMGRPIDDSLCLTTLKSTNSIKKLER
Sbjct: 901  FLFDNSEFKKISESLNLFFQDDFNNSFLPLYWQLKMGRPIDDSLCLTTLKSTNSIKKLER 960

Query: 961  DYKHVLGQLESDPFFKNLFESILAVPAVTNIHNTQSDGTMCLMETPTKKKLAFKVNDSPR 1020
            DYKHVLGQLESDPFFKNLFESILAVPAVTNIHNTQSDGTMCLMETPTKKKLAFKVNDSPR
Sbjct: 961  DYKHVLGQLESDPFFKNLFESILAVPAVTNIHNTQSDGTMCLMETPTKKKLAFKVNDSPR 1020

Query: 1021 PSNMTPKSKNLKQKFDKAVALSNLNRIKCCIXXXXXXXXXXXXXXXISSLFSLTVTMLSN 1080
            PSNMTPKSKNLKQKFDKAVALSNLNRIKCCI               ISSLFSLTVTMLSN
Sbjct: 1021 PSNMTPKSKNLKQKFDKAVALSNLNRIKCCIEDLNLELLNHGDLLNISSLFSLTVTMLSN 1080

Query: 1081 ISKNALEDATLFQRFNLIDLPKRVPMYYDKLLSSIDDDLYTDIKLLPFSSNHEQTRKKQA 1140
            ISKNALEDATLFQRFNLIDLPKRVPMYYDKLLSSIDDDLYTDIKLLPFSSNHEQTRKKQA
Sbjct: 1081 ISKNALEDATLFQRFNLIDLPKRVPMYYDKLLSSIDDDLYTDIKLLPFSSNHEQTRKKQA 1140

Query: 1141 LLSLNESTEFCGLSFDVITIDICSITGNLLLSKLSATNGHKSHLSIPLNRANLRDLDAYS 1200
            LLSLNESTEFCGLSFDVITIDICSITGNLLLSKLSATNGHKSHLSIPLNRANLRDLDAYS
Sbjct: 1141 LLSLNESTEFCGLSFDVITIDICSITGNLLLSKLSATNGHKSHLSIPLNRANLRDLDAYS 1200

Query: 1201 LTFVEAVKELAYIIDXXXXXXXXXXXXXIKTKEDRKTWWKSRYELDNRLSSLLHNIETSW 1260
            LTFVEAVKELAYIID             IKTKEDRKTWWKSRYELDNRLSSLLHNIETSW
Sbjct: 1201 LTFVEAVKELAYIIDESNSTTSVEVTSSIKTKEDRKTWWKSRYELDNRLSSLLHNIETSW 1260

Query: 1261 FAGLKGLFDQSVVDPSLFEEFKKKFYGILHSNLPSRKQMGKPMTFLQINDWIIELFLKLD 1320
            FAGLKGLFDQSVVDPSLFEEFKKKFYGILHSNLPSRKQMGKPMTFLQINDWIIELFLKLD
Sbjct: 1261 FAGLKGLFDQSVVDPSLFEEFKKKFYGILHSNLPSRKQMGKPMTFLQINDWIIELFLKLD 1320

Query: 1321 PQDDEFISMIEDMIYFTLDILLFQGEENAYDEIDLSMVHIQLEEQIKRYHSKVISNSHKV 1380
            PQDDEFISMIEDMIYFTLDILLFQGEENAYDEIDLSMVHIQLEEQIKRYHSKVISNSHKV
Sbjct: 1321 PQDDEFISMIEDMIYFTLDILLFQGEENAYDEIDLSMVHIQLEEQIKRYHSKVISNSHKV 1380

Query: 1381 DHTFLVIGSACHTFPWESLSFMNDLSLSRIPSIKWLESAITRHYEQLIKGVPLTEKISMI 1440
            DHTFLVIGSACHTFPWESLSFMNDLSLSRIPSIKWLESAITRHYEQLIKGVPLTEKISMI
Sbjct: 1381 DHTFLVIGSACHTFPWESLSFMNDLSLSRIPSIKWLESAITRHYEQLIKGVPLTEKISMI 1440

Query: 1441 LNPHGDXXXXXXXXXXXXXXIVAKRPSSSLIVNEKPDEEKMLHMMSNCNLFIYVGHGGGE 1500
            LNPHGD              IVAKRPSSSLIVNEKPDEEKMLHMMSNCNLFIYVGHGGGE
Sbjct: 1441 LNPHGDLERTELRFRETFETIVAKRPSSSLIVNEKPDEEKMLHMMSNCNLFIYVGHGGGE 1500

Query: 1501 QYVRTREIKRCDNVGPSFLLGCSSASLKYYGGLEPTGTVNSYLLAGSPLVLGNLWDVTDK 1560
            QYVRTREIKRCDNVGPSFLLGCSSASLKYYGGLEPTGTVNSYLLAGSPLVLGNLWDVTDK
Sbjct: 1501 QYVRTREIKRCDNVGPSFLLGCSSASLKYYGGLEPTGTVNSYLLAGSPLVLGNLWDVTDK 1560

Query: 1561 DIDKFSQSVFEKIGLVMGEDEIIHKRSISRAVNESRQLCHLKFLNGAAPVVYGLPLHFFT 1620
            DIDKFSQSVFEKIGLVMGEDEIIHKRSISRAVNESRQLCHLKFLNGAAPVVYGLPLHFFT
Sbjct: 1561 DIDKFSQSVFEKIGLVMGEDEIIHKRSISRAVNESRQLCHLKFLNGAAPVVYGLPLHFFT 1620

>YGR098C (ESP1) [2058] chr7 complement(682568..687460) Separin protein
            required for Mcd1p and Rec8p cleavage and sister
            chromatid separation during mitosis and meiosis, also
            cleaves Slk19p and Mcd1p, also involved in regulation of
            spindle pole body duplication [4893 bp, 1630 aa]
          Length = 1630

 Score = 1271 bits (3290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 708/1651 (42%), Positives = 1034/1651 (62%), Gaps = 53/1651 (3%)

Query: 1    MSKQEDPLNEVSLNTT----------TWHSPSKRGQNNELKNF---NAYPNKENIPQLHT 47
            M KQE+PLNE+S NT           T       GQ   L +    +A  N   I  +H 
Sbjct: 2    MVKQEEPLNEISPNTPMTSKSYLLNDTLSKVHHSGQTRPLTSVLSGDASSNSIGILAMHN 61

Query: 48   GRLEKDLDLYYKQISEFIKAQSLQKPQIERIHAVFTTXXXXXXXXXXXXXXXXXVKEHLI 107
              +     +    I   I+  +     +  I+++  +                 VK+HL+
Sbjct: 62   NIIRDFTKIASNNIDLAIEDITTVDHSLNSIYSLLKSHHMWGHINST-------VKQHLM 114

Query: 108  VVVKLINNNFYDYSQSGILCLYNTTNLFKAHDLKDVILADFSESNEFYLSTLKILSFQVI 167
            ++VKLINNN    + S I+ L+N TNLF+AH LK+++LADFS  N++YLS LKIL+ Q+I
Sbjct: 115  IIVKLINNNALGLASSEIIFLFNETNLFQAHSLKNILLADFSTWNDYYLSNLKILALQII 174

Query: 168  LKKKNLKMYEDTIIQAFSHDERYILKDPNIKIHTVVKLLLNFFSILPTFKTLFGLKFLQY 227
            LK+K +  Y   I++ FSHD+RY+LKDPN+K H + K++L+FFS+  + K LFGLKFLQY
Sbjct: 175  LKRKLVDEYLPHILELFSHDKRYLLKDPNLKAHALTKIVLSFFSVTTSCKVLFGLKFLQY 234

Query: 228  IKQFNLSFQTYIKNMDSITFEKQLVRYGSKNIQQLKP---YLNSYYINYSKFNSHLTKLM 284
            IKQF L F+ +I N+    F K L+    KN  ++ P   YLNS+Y++YS     L K+M
Sbjct: 235  IKQFKLPFKKFISNITVECFSKNLLH---KNYLEMGPNKIYLNSFYLSYSMLYDGLDKIM 291

Query: 285  LTDFVGRDLQSH-KKTFALLKDHKEISSTSTE--CYCCLSHSQMDNFVISCHALMSNNDQ 341
            L D +  +  +  ++     K+  E  + S     + C+S   ++  + +    + N  +
Sbjct: 292  LLDILSYEETTEVQRAIKSKKEFNEYCNMSENRLLWSCISVDDLNVILENATNFLQNKGK 351

Query: 342  IHLHTIDAVTFGWSIIRSENFPRNKKMLALLDSTLIFLNSQMKHL--EKMQISLVKLIKM 399
                T+  +   WS IR E  P+NK +L   D T+I++NS +K +  E     L +L+ +
Sbjct: 352  HISATLKCLVCLWSTIRLEGLPKNKDILRQFDCTVIYINSNIKSINDESAAALLSELLGV 411

Query: 400  LAEVCMDYQEYKRMTNVIXXXXXXXXXXXXXXXLKLTAELESKHYLVCHDKSQWKKLIQK 459
            L+E+C+DY+E KR++N+I               L  TA LE  + L+ +D     + I K
Sbjct: 412  LSEICIDYKEPKRLSNIISVLFNASVLFKSHSFLLKTANLEISNVLISNDSKTSHRTILK 471

Query: 460  FEKFIGSAPEQYQKIELFSYVFNTFLLFNDDSLSFVVEFTETIFLRCFSRLKLTYFIDFH 519
            FEKFI SA    +KIE+FS +FN + +  +D+LSFV +F +  F+ CF+RLK+T FI+F 
Sbjct: 472  FEKFISSAQSAQKKIEIFSCLFNVYCMLRNDTLSFVFDFCQNAFIHCFTRLKITKFIEFS 531

Query: 520  DVSEPMLSILYGNSSITNIPHGDWNNLTEMLFFCVSGRFEINAININQVTTKWYYLYKYK 579
            + SE MLS+LYGNSSI NIP  +W+ L+ M+F  + G F+++ + +N    K + L KY+
Sbjct: 532  NSSEIMLSVLYGNSSIENIPSENWSQLSRMIFCSLRGIFDLDPLELNNTFDKLHLLNKYE 591

Query: 580  DLIKSIYVLNLDMKKHXXXXXXXXXXXXXXKWVQKTSLLNEGISSIEVTFITMLFQYLGF 639
             LI+ +Y+LNLDM KH              KW+QK+    E ISS E+ F+ ML  YL F
Sbjct: 592  LLIRIVYLLNLDMSKHLTTNLSKITKLYINKWLQKSDEKAERISSFEMDFVKMLLCYLNF 651

Query: 640  NNFNKCILTLSAALRDHINYFAPLKLEISRWNIQSSINLQLMEQINDEAKLLSTIAPTYT 699
            NNF+K  + LS  ++    Y++ +      + +++ ++L +   I+D   + + +  T  
Sbjct: 652  NNFDKLSIELSLCIKSKEKYYSSIVPYADNYLLEAYLSLYM---IDDALMMKNQLQKTMN 708

Query: 700  I--CKLEKLLTFLEAKLDVFTWTNDYEGFQELFMEELPSVRLEVFDLNNQSKMPASQYIK 757
            +   K+E+ L    + ++V  W +D   FQ  F + LP+++ E+FD+NN   +P S YIK
Sbjct: 709  LSTAKIEQALLHASSLINVHLWDSDLTAFQIYFGKTLPAMKPELFDINNDHNLPMSLYIK 768

Query: 758  VLLFMTKLFNHSSRLHLARDDITASVIESKRALKLATSLIKKQNKLSQSSRIRLINLVLN 817
            V+L   K+FN S++L++   ++ ++VI+ ++A  LA SL+KK+NKLSQ SR+ L+  +  
Sbjct: 769  VILLNIKIFNESAKLNIKAGNVISAVIDCRKAQNLALSLLKKKNKLSQGSRLALLKSLSF 828

Query: 818  SFTQLIEIYIRLGLAKEADYYADQLSKVICDLGEPSVVYRGLHFLHNYYKLVKHEALEII 877
            SF QLI+I+IR+G A++ ++Y+ +LS++I DL EP +VYR LHFLH YY + +   L+ I
Sbjct: 829  SFFQLIKIHIRIGSARDCEFYSKELSRIISDLEEPIIVYRCLHFLHRYYMITEQTCLQNI 888

Query: 878  TLQKANKTFDYLDGESDIESVLMFLFDNSEFKKISESLNLFFQDDFNNSFLPLYWQLKMG 937
            TL KANK FDYLD E+DI S+ MFL+DN EF K+ +SL L+F D    +FLP  W+L +G
Sbjct: 889  TLGKANKAFDYLDAEADITSLTMFLYDNKEFVKLEQSLVLYFGDQLEKTFLPNLWKLHLG 948

Query: 938  RPIDDSLCLTTLKSTNSIKKLERDYKHVLGQLESDPFFKNLFESILAVP-AVTNIHNTQS 996
            + IDDS+CL+     N I ++   ++ V+ QLE DPFFK +FES L +P ++  I +T  
Sbjct: 949  KDIDDSICLSEYMPKNVINRVHNMWQKVMSQLEEDPFFKGMFESTLGIPSSLPVIPSTMP 1008

Query: 997  DGTMCLMETPTKKKLAFKVNDSPRPSNMTPKSKNLKQKFDKAVALSNLNRIKCCIXXXXX 1056
            +    +++TP+K     K+ DSPR S+MTP+ KN++QKFD+  A+S L ++K  +     
Sbjct: 1009 NN---ILKTPSKHSTGLKLCDSPRSSSMTPRGKNIRQKFDRIAAISKLKQMKELLESLKL 1065

Query: 1057 XXXXXXXXXXISSLFSLTVTMLSNISKNALEDATLFQRFNLIDLPKRVPMYYDKLLSSID 1116
                      ISSL SLT+T+LSNI+     +++L   F+L DLP+ +P+ +DK+L++ID
Sbjct: 1066 DTLDNHELSKISSLSSLTLTILSNITSIHNAESSLITNFSLTDLPRHMPLLFDKVLNNID 1125

Query: 1117 DDLYTDIK----LLP--FSSNHEQTRKKQALLSLNESTEFCGLSFDVITIDICSITGNLL 1170
            +  Y + +    + P   S+  E  R   A   L ES     L+ +VITID C ITGNLL
Sbjct: 1126 NKNYREFRVSSLIAPNNISTITESIRVSAAQKDLMES----NLNINVITIDFCPITGNLL 1181

Query: 1171 LSKLSATNGHKSHLSIPLNRANLRDLDAYSLTFVEAVKELAYIIDXXXXXXXXXXXXXIK 1230
            LSKL      ++HL +PL R+N RDLD   L+F EA K+L  II+             IK
Sbjct: 1182 LSKLEPRRKRRTHLRLPLIRSNSRDLDEVHLSFPEATKKLLSIINESNQTTSVEVTNKIK 1241

Query: 1231 TKEDRKTWWKSRYELDNRLSSLLHNIETSWFAGLKGLFDQSVVDPSLFEEFKKKFYGILH 1290
            T+E+RK+WW +RY+LD R+  LL+NIE SWF G++G F   VVD SLFE+FK KFY ILH
Sbjct: 1242 TREERKSWWTTRYDLDKRMQQLLNNIENSWFNGVQGFFSPEVVDNSLFEKFKDKFYEILH 1301

Query: 1291 SNLPSRKQMGKPMTFLQINDWIIELFLKLDPQDDEFISMIEDMIYFTLDILLFQGEENAY 1350
             NLPSRK  G P  F+++ DW+IELFLKL+PQ+ +F+S +ED+IYF LDILLF GEENAY
Sbjct: 1302 QNLPSRKLYGNPAMFIKVEDWVIELFLKLNPQEIDFLSKMEDLIYFVLDILLFHGEENAY 1361

Query: 1351 DEIDLSMVHIQLEEQIKRYHSKVISNSHKVDHTFLVIGSACHTFPWESLSFMNDLSLSRI 1410
            DEID SM+H+QLEEQIK+Y + + +NS  + HTFLV+ S+CH FPWE LSF+ DLS++R+
Sbjct: 1362 DEIDFSMLHVQLEEQIKKYRATMTTNS--IFHTFLVVSSSCHLFPWECLSFLKDLSITRV 1419

Query: 1411 PSIKWLESAITRHYEQLIKGVPLTEKISMILNPHGDXXXXXXXXXXXXXXIVAKRPSSSL 1470
            PS   L   ++R + QL   V + + ISMILNP+GD              I+  +PSS L
Sbjct: 1420 PSYVCLNKLLSRFHYQLPLQVTIEDNISMILNPNGDLSRTESKFKGMFQKIIDAKPSSQL 1479

Query: 1471 IVNEKPDEEKMLHMMSNCNLFIYVGHGGGEQYVRTREIKRCDNVGPSFLLGCSSASLKYY 1530
            ++NEKP+EE +L M+ N NLF+Y+GHGGGEQYVR++EIK+C  + PSFLLGCSSA++KYY
Sbjct: 1480 VMNEKPEEETLLKMLQNSNLFVYIGHGGGEQYVRSKEIKKCTKIAPSFLLGCSSAAMKYY 1539

Query: 1531 GGLEPTGTVNSYLLAGSPLVLGNLWDVTDKDIDKFSQSVFEKIGLVMGEDEI-IHKRSIS 1589
            G LEPTGT+ +YLL G P+VLGNLWDVTDKDIDKFS+ +FEK+G     D++  +  S+S
Sbjct: 1540 GKLEPTGTIYTYLLGGCPMVLGNLWDVTDKDIDKFSEELFEKMGFRCNTDDLNGNSLSVS 1599

Query: 1590 RAVNESRQLCHLKFLNGAAPVVYGLPLHFFT 1620
             AV++SR +CHL++LNGAAPV+YGLP+ F +
Sbjct: 1600 YAVSKSRGVCHLRYLNGAAPVIYGLPIKFVS 1630

>AAR089C [275] [Homologous to ScYGR098C (ESP1) - SH] (500951..505807)
            [4857 bp, 1618 aa]
          Length = 1618

 Score =  996 bits (2574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/1648 (35%), Positives = 923/1648 (56%), Gaps = 68/1648 (4%)

Query: 1    MSKQEDPLNEVSLNT----TTWHSPSKRGQNNELKNFNAYPNKENIPQLH-TGRLEKDLD 55
            M+++++ LN ++LNT     +W   +     +E     A+ +  N  +LH   RL  D+ 
Sbjct: 1    MAREKEVLNVINLNTPIMRNSWTGAAGGTTKHEKPLVEAFNSSTN--RLHFVDRLPFDVT 58

Query: 56   LYYKQISEFIKAQSLQKPQIERIHAVFTTXXXXXXXXXXXXXXXXXVKEHLIVVVKLINN 115
              ++++  F++     K + +++    T                   ++H+ VVV+L+  
Sbjct: 59   EGFREVQRFVQEG---KGEADKVREALTGLYRELKQRHQLGRVAEVSRQHMGVVVRLLEA 115

Query: 116  NFYDYSQSGILCLYNTTNLFKAHDLKDVILADFSESNEFYLSTLKILSFQVILKKKNLKM 175
                 +   ++ LYN TN   A  L DV++ADF  SNE YLST KIL+ Q+I++ + ++ 
Sbjct: 116  GQDAAAAREVVALYNQTNYRPAGGLGDVLMADFGVSNERYLSTAKILAMQLIIRMRQVES 175

Query: 176  YEDTIIQAFSHDERYILKDPNIKIHTVVKLLLNFFSILPTFKTLFGLKFLQYIKQFNLSF 235
            + +T+++ F+ DERYIL+DP +K+HTVVKL+LNFFS+LP +K LF LKFLQY+ QF L F
Sbjct: 176  HAETVVRIFAADERYILRDPKLKVHTVVKLILNFFSLLPQYKVLFALKFLQYVSQFRLDF 235

Query: 236  QTYIKNMDSITFEKQLVRYGSKNIQQLKPYLNSYYINYSKFNSHLTKLMLTDFVGRDLQS 295
             TYIKNMD   F+KQ++++    ++   P+L+ YY +YS+  + + KLM  DF   D   
Sbjct: 236  STYIKNMDLAKFQKQVLKFAGAGLESSLPFLDIYYRSYSQHMTSIGKLMWQDFRVPDRGD 295

Query: 296  HKKTF-------ALLKDHKEISSTSTECYCCLSHSQMDNFVISCHALMSNNDQIHLHTID 348
             K           +L   + + +   + Y     +++   V    A         L  + 
Sbjct: 296  TKLNPEDPIILQQILHGRRTLDNAEFDAYTKHITTKLSKGVSPTDAF--------LGALK 347

Query: 349  AVTFGWSIIRSENFPRNKKMLALLDSTLIFLNSQMKHLEKMQISLVKLIKMLAEVCMDYQ 408
                  S+ R       K  + LLD   IF+N+ + H+    I  +  +K LAE  +D +
Sbjct: 348  VYILNCSLKR---LRLQKAHVILLDKIAIFINTNVVHVSVESIHTI--LKSLAEYFIDAK 402

Query: 409  EYKRMTNVIXXXXXXXXXXXXXXXLKLTAELESKHYLVCHDKSQWKKLIQKFEKFIGSAP 468
            EYKR+ NV+               ++L A+LE   +L    K  W  +  KFEKFI  A 
Sbjct: 403  EYKRLNNVVNISFNAYVMYKHESLIRLAADLEL--FLFMSVKQDWS-MFTKFEKFISVAS 459

Query: 469  EQYQKIELFSYVFNTFLLFNDDSLSFVVEFTETIFLRCFSRLKLTYFIDFHDVSEPMLSI 528
                 + LF   FN +++F D SL+ + +      L+CF +L LT + DF   SEPML +
Sbjct: 460  GDIS-VSLFEQCFNVYVMFADPSLAGLWDVCLNKSLKCFKKLGLTSYTDFKASSEPMLVL 518

Query: 529  LYGN--SSITNIPHGDWNNLTEMLFFCVSGRFEINAININQVTTKWYYLYKYKDLIKSIY 586
            +Y    S I  IP+  W  L++MLF  ++G ++   ++++        L KY+ LIKS Y
Sbjct: 519  VYSGFVSDIFTIPYNGWAPLSKMLFMALNGVYKFGYMDVDCKIKSVDVLAKYEMLIKSTY 578

Query: 587  VLNLDMKKHXXXXXXXXXXXXXXKWVQKTSLLNEGISSIEVTFITMLFQYLGFNNFNKCI 646
             LN++M+ H              +WV      +E IS +EV F+  L QYL FN F+K +
Sbjct: 579  SLNMEMETHGTLQLSKIANMYVSRWVSSLPT-DERISGLEVRFVKALVQYLRFNKFHKKL 637

Query: 647  LTLSAALRDHINYFAPLKLEISRWNIQSSINLQLMEQINDEAKLLSTIAPTYTI--CKLE 704
            + L   L+    Y+   K +I  W +++   L++++    + + +  I  +++I     +
Sbjct: 638  IELCQLLKSKGEYYESFKNDIRVWLLEAYTALKMVQATKLQIQSVLKIHSSFSIERATFD 697

Query: 705  KLLTFLEAKLDVFTWTNDYEGFQELFMEELPSVRLEVFDLNNQSKMPASQYIKVLLFMTK 764
             L  +L A+L + +W  D + F  L ++EL   +   FD+NN S +P SQ++K+LL   +
Sbjct: 698  SLYEYLYARLLIISWERDNDSFNHL-VQELRVSQTNFFDINNNSNLPVSQFLKLLLLNIR 756

Query: 765  LFNHSSRLHLARDDITASVIESKRALKLATSLIKKQNKLSQSSRIRLINLVLNSFTQLIE 824
            +   +S L    +++  S++E+K+ALKL  SLIKKQ KLSQ  R+ +I+L+ + F Q+I 
Sbjct: 757  IEKLASLLQFHNNNMFESLLEAKKALKLCQSLIKKQQKLSQFHRLEVISLLQDLFAQVIG 816

Query: 825  IYIRLGLAKEADYYADQLSKVICDLGEPSVVYRGLHFLHNYYKLVKHEALEIITLQKANK 884
            IYI++G++K+ ++Y     +V+ +L + + +Y  L F+++YYKL +   L   TL + N+
Sbjct: 817  IYIQVGVSKDCEFYVKDFMRVVGELQDWTPIYDCLCFVYDYYKLTEQNQLASATLSRLNR 876

Query: 885  TFDYLDGESDIESVLMFLFDNSEFKKISESLNLFFQDDFNNSFLPLYWQLKMGRPIDDSL 944
            TFD LDG  +I+++  F++ N E  K+  SL LFF  D  ++FL   W L++G  I+++ 
Sbjct: 877  TFDMLDGSENIDALAKFMYYNDEPDKLRNSLALFFSGDLEDTFLVDEWNLRLGIVIENTR 936

Query: 945  CLTTLKSTNSIKKLERDYKHVLGQLESDPFFKNLFESILAVPAVTNIHNTQSDGTMCLME 1004
                LK+ + + K    Y  +L Q+E DPFF N+ ES++A+P+  +    +    +  + 
Sbjct: 937  EQPQLKALSDVNKSNELYLRILKQMELDPFFSNMCESVIAIPSCFSPKVEEIRPAVSNVW 996

Query: 1005 TPTKKKLAFKVNDSPRPSNMTPKSKNLKQKFDKAVALSNLNRIKCCIXXXXXXXXXXXXX 1064
            +P     A     SPRPS++TP+ K L+QKFD++ A++NL  IK  I             
Sbjct: 997  SP-----AGSPYHSPRPSSLTPRGKCLRQKFDRSNAINNLQMIKRLIESVNLDEMQNHEV 1051

Query: 1065 XXISSLFSLTVTMLSNISKNALEDATLFQRFNLIDLPKRVPMYYDKLLSSIDDDLYT--- 1121
               S L+SL+++ LSNIS        L +RF + +LPK +PMYYDK+ S + +++Y    
Sbjct: 1052 SKTSCLYSLSLSFLSNISSKTDFRHALIKRFTMAELPKYMPMYYDKMFSRMGNEVYGSFM 1111

Query: 1122 --DIKLL--PFSSNHEQTRKKQALLSLNESTEFCGLSFDVITIDICSITGNLLLSKLSAT 1177
              ++K +  PF +  ++    Q   + N   E     F  I++DIC   G+LLLSK+ +T
Sbjct: 1112 PMEVKSMCTPFFTVQQKVDGIQT--NFNSWDE----PFQAISVDICKYNGDLLLSKVVST 1165

Query: 1178 NGHKSHLSIPLNRANLRDLDAYSLTFVEAVKELAYIIDXXXXXXXXXXXXXIKTKEDRKT 1237
             G   HL +PLNR   RDL   +LTF   ++EL  II+             IKTKEDR+ 
Sbjct: 1166 TGKHFHLRLPLNRHESRDLSQETLTFALLMEELNDIIEKNNRTTSIEVTSVIKTKEDRRE 1225

Query: 1238 WWKSRYELDNRLSSLLHNIETSWFAGLKGLFDQSVVDPSLFEEFKKKFYGILHSNLPSRK 1297
            WW+ RY LD R+  L+  IE SW  G  G F Q  +D + F  FK  F  +L  NLP+R+
Sbjct: 1226 WWEERYSLDKRMCDLMRRIEDSWICGFCGFFSQKQLDKNHFALFKLGFQKVLQQNLPTRR 1285

Query: 1298 QMGKPMTFLQINDWIIELFLKLD----PQDDEFISMIEDMIYFTLDILLFQGEENAYDEI 1353
            Q G P  FLQ++D+I+ELFLK+D    P + + +  +ED+IYF  DILLF GEENAYDEI
Sbjct: 1286 QYGNPSMFLQVDDFILELFLKVDWDALPHEKK-VEFMEDLIYFIFDILLFHGEENAYDEI 1344

Query: 1354 DLSMVHIQLEEQIKRYHSKVISNSHKVDHTFLVIGSACHTFPWESLSFMNDLSLSRIPSI 1413
            D+ ++HIQLEE I  YH+K    + ++ HTFLVI S C   PWESLS  +D S+SR+PSI
Sbjct: 1345 DVHLIHIQLEELIHDYHAKA-PEAPRLGHTFLVISSECSLVPWESLSIFSDASVSRVPSI 1403

Query: 1414 KWLESAITRHYEQLIKGVPLTEKISMILNPHGDXXXXXXXXXXXXXXIVAKRPSSSLIVN 1473
             +L   +T+   ++   + L  ++S++LNPHGD              +     S+ ++  
Sbjct: 1404 NFLHELLTKFRGEISPKINLDSRLSIVLNPHGDLTRTELRFKEHFTRLCCDLGSTRIVTG 1463

Query: 1474 EKPDEEKMLHMMSNCNLFIYVGHGGGEQYVRTREIKRCDNVGPSFLLGCSSASLKYYGGL 1533
             KP+E++ + M++N + FIY+GHGGGEQY R++ +K  DN  PSFLLGCSSA +  YG L
Sbjct: 1464 SKPEEDEFVRMITNSSTFIYIGHGGGEQYFRSKTLKLQDNAAPSFLLGCSSAYMIQYGKL 1523

Query: 1534 EPTGTVNSYLLAGSPLVLGNLWDVTDKDIDKFSQSVFEKIGLVMGE-DEIIHKRSISRAV 1592
            EP+  + SYLL GSP+V+GNLWDVTDKDID F++++  K+G+   + D  ++   +S AV
Sbjct: 1524 EPSSVLYSYLLGGSPMVIGNLWDVTDKDIDAFTEAMSHKLGIFPSQRDRFLN---VSEAV 1580

Query: 1593 NESRQLCHLKFLNGAAPVVYGLPLHFFT 1620
            + SR +CHL++LNGAAPVVYGLP  + T
Sbjct: 1581 SSSRDVCHLRYLNGAAPVVYGLPFRYNT 1608

>Kwal_55.20535
          Length = 1636

 Score =  908 bits (2346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/1662 (34%), Positives = 908/1662 (54%), Gaps = 79/1662 (4%)

Query: 1    MSKQEDPLNEVSLNTTTWHSPSKRGQNNE---LKN---FNAYPNKENIP-----QLHTGR 49
            M+ +   LN++SLN+      S  G  ++   LKN    N   + EN+           R
Sbjct: 1    MAGKNIALNDISLNSPCKIVSSLEGDTSDCVKLKNAEILNTRMDGENMVYDSFWGFECSR 60

Query: 50   LEKDLDLYYKQISEFIKAQSLQKPQIERIHAV---FTTXXXXXXXXXXXXXXXXXVKEHL 106
            +  + D+  K++ +F     LQ+P IE +  V   F                   VK+++
Sbjct: 61   IAPNSDIIRKRVRDF-----LQRPCIEDVQEVSLGFKRLYRTYLWKHQFNLVKELVKQNM 115

Query: 107  IVVVKLINNNFYDYSQSGILCLYNTTNLFKAHDLKDVILADFSESNEFYLSTLKILSFQV 166
            + ++K++    YD +   +L +YN TN  KA  L+  +LAD + SN++YLS LK+L+ Q+
Sbjct: 116  LAIIKIVELQSYDAAVQEVLNIYNETNHHKAESLEQFLLADLTTSNDYYLSALKLLALQI 175

Query: 167  ILKKKNLKMYEDTIIQAFSHDERYILKDPNIKIHTVVKLLLNFFSILPTFKTLFGLKFLQ 226
            I+K K    Y +TI++ F++D RYIL+   IKI  + K+LLNFFS+LP FK LF LKF+Q
Sbjct: 176  IIKGKRQDFYGETILKLFANDSRYILRTEKIKIQPLTKILLNFFSLLPDFKALFSLKFMQ 235

Query: 227  YIKQFNLSFQTYIKNMDSITFEKQLVRYGSKNIQQLKPYLNSYYINYSKFNSHLTKLMLT 286
            Y+KQF+L+F++YIKNMD   F++ ++ +  ++  +   +L  +Y +YS++   + K+ML 
Sbjct: 236  YVKQFDLNFESYIKNMDMPKFQEMILIWAQRSPTKTNGFLGLFYSSYSQYFQSVDKIMLH 295

Query: 287  DFV---GRD-LQSHKKTFALLKDHKEISSTSTECYCCLSHSQMDNFVISCHALMS-NNDQ 341
            D V    RD ++   K F  L  H+   S   E +  LS       +I  ++L+     Q
Sbjct: 296  DLVNPSSRDRIKVISKGFNSLSSHE--WSQGIETFTNLS-------IIERNSLLEFIESQ 346

Query: 342  IHLHTID----AVTFGW--SIIRSENFPRNKKMLALLDSTLIFLNSQMKHLEKMQISLVK 395
            +     D    A+   W   +  +E  P  +++  ++D   +F+NS   +L  + I +VK
Sbjct: 347  LEEKKFDSQKVAILLRWFLQLANNELSPATRQLWRIVDRITVFINS---NLHSLSIHIVK 403

Query: 396  -LIKMLAEVCMDYQEYKRMTNVIXXXXXXXXXXXXXXXLKLTAELESKHYLVCHDKSQWK 454
             L+ ++ ++C+   E KR+ NV                +   A+ +     +     Q  
Sbjct: 404  ELLDIIYDLCIVNLEPKRLLNVANVAFNSFIVFKNDIFVLQAAKFDLARQTIFK---QGG 460

Query: 455  KLIQKFEKFIGSAPEQYQKIELFSYVFNTFLLFNDDSLSFVVEFTETIFLRCFSRLKLTY 514
              + + EKF+ SA   + +I+LF+ VFN F  F  +SL  + E T   F +C   + +  
Sbjct: 461  LDLTRLEKFLSSASNGH-RIKLFTDVFNVFTCFEYESLGSLTEVTSR-FAKCLRSVNIRA 518

Query: 515  FIDFHDVSEPMLSILYGNSSITNIPHGDWNNLTEMLFFCVSGRFEINAININQVTTKWY- 573
              +    SE M+ +L     +       W+ LT ML+  ++     N    N  T K   
Sbjct: 519  STELSGASELMICLLSTLRPLEPDSISCWSPLTRMLYHSLT-----NYAKDNNKTEKCRD 573

Query: 574  ---YLYKYKDLIKSIYVLNLDMKKHXXXXXXXXXXXXXXKWVQKTSLLNEGISSIEVTFI 630
                L  Y+ LIK+IY L L++KK                WV++ +     + S+E + I
Sbjct: 574  TLDPLKHYEVLIKTIYSLGLEIKKSSSHCLAKVSDNFTENWVKRLNFRESTMISLEYSAI 633

Query: 631  TMLFQYLGFNNFNKCILTLSAALRDHIN-YFAPLKLEISRWNIQSSINLQLMEQINDEAK 689
              LF YL FN F+K ++ L+ AL++  + Y+           I+  + LQ+  +I +   
Sbjct: 634  RTLFGYLRFNKFHKKVIDLALALKNSPHPYYEYCAENAQEQLIRGYVGLQMKTRILEGCS 693

Query: 690  LLSTIA--PTYTICKLEKLLTFLEAKLDVFTWTNDYEGFQELFMEELPSVRLEVFDLNNQ 747
             L  +A  P     K +++  + E +L++  W  D++ F ++F+E LP    EV D+ N 
Sbjct: 694  ELMRLAQNPRLENLKRDQIFMYAETQLEICFWKRDFDTFNKIFVEGLPITNPEVMDVTNT 753

Query: 748  SKMPASQYIKVLLFMTKLFNHSSRLHLARDDITASVIESKRALKLATSLIKKQNKLSQSS 807
             K+P   Y+K L+    +   +S L +   ++  +++E+KR++KL  +L+KK  +L Q  
Sbjct: 754  LKLPTKLYLKCLVLSINIVGIASNLQIHAGNLIEALVEAKRSIKLCQTLLKKVTQLDQEI 813

Query: 808  RIRLINLVLNSFTQLIEIYIRLGLAKEADYYADQLSKVICDLGEPSVVYRGLHFLHNYYK 867
            + +++  +  +F  +I IY +LG++++ D+Y  +  +V C + +P V++  L     YY+
Sbjct: 814  KWKVLTSLGTAFANIINIYTQLGVSRDCDFYVTEYLRVSCSMKDPVVIHECLQKCVGYYR 873

Query: 868  LVKHEALEIITLQKANKTFDYLDGESDIESVLMFLFDNSEFKKISESLNLFFQDDFNNSF 927
            L    +L    L+KAN  F+ LDG  + + + +FL +N E +K++ SL LFF+D F+ S 
Sbjct: 874  LTDQLSLADALLRKANGIFNQLDGSENFDDLALFLLNNGEHEKLANSLRLFFKDYFSESL 933

Query: 928  LPLYWQLKMGRPIDDSLCLTTLKSTNSIKKLERDYKHVLGQLESDPFFKNLFESILAVPA 987
            L   W L +G  ++      TL+  + I + ++ Y+ +  Q+++D FF ++ ES+  +P+
Sbjct: 934  LVDIWSLALGGTLNRYHEDATLRRLSGINEGKQLYEKISKQMDTDAFFGSVKESVTTIPS 993

Query: 988  VT--NIHNTQSDGT-MCLMETPTKKK-LAFKVNDSPRPSNMTPKSKNLKQKFDKAVALSN 1043
                 +   +   T +C   TPTK K + F   +SPRPS++TP+ K+LKQKFD+A AL++
Sbjct: 994  CVLPALEVRKHPATSVCEFGTPTKNKGIPFTNLNSPRPSSLTPRGKSLKQKFDRAKALND 1053

Query: 1044 LNRIKCCIXXXXXXXXXXXXXXXISSLFSLTVTMLSNISKNALEDATLFQRFNLIDLPKR 1103
            L  +K  +                S L+SL +++LS+I+ + L  + + Q   L +LPK 
Sbjct: 1054 LETVKRLVGSLSTDGMKNYEIVEASDLYSLVLSLLSSITTSRLSSSAIEQMLTLAELPKM 1113

Query: 1104 VPMYYDKLLSSIDDDLY-------TDIKLLPFSSNHEQTRKKQALLSLNESTEFCGLSFD 1156
             P+++DK+LSS  +++Y        D K +   +  +   + Q  +S N         F+
Sbjct: 1114 RPLHFDKILSSQGNEIYGSFIPLQVDCKRISIDNQLQDIVRNQTDMSFNSDPHL----FN 1169

Query: 1157 VITIDICSITGNLLLSKLSATNGHKSHLSIPLNRANLRDLDAYSLTFVEAVKELAYIIDX 1216
            V+ ID+C ITG+L+L++  +       L +PL+R + RD+D  +L+F +A++EL  II  
Sbjct: 1170 VVCIDVCGITGDLILTRTDSGRNKVMCLRLPLSRGSSRDVDEVALSFHDAMEELKSIIKE 1229

Query: 1217 XXXXXXXXXXXXIKTKEDRKTWWKSRYELDNRLSSLLHNIETSWFAGLKGLFDQSVVDPS 1276
                        I TK+DRK WW+ RY+LD RL +L+  IE SWF+G K  F Q  ++  
Sbjct: 1230 SNITTSSDVTAAINTKDDRKQWWQRRYDLDARLRNLILKIENSWFSGFKTFFKQETIEQR 1289

Query: 1277 LFEEFKKKFYGILHSNLPSRKQMGKPMTFLQINDWIIELFLKLDPQDDEFISMIEDMIYF 1336
              + F+ K   IL  +LP+RKQ G P  F +I+D +++LFLKLDP D +F+ M+ED+I+F
Sbjct: 1290 HLDRFRVKLEEILQESLPTRKQFGNPANFFRIDDVVLDLFLKLDPSDSDFMEMMEDLIFF 1349

Query: 1337 TLDILLFQGEENAYDEIDLSMVHIQLEEQIKRYHSKVISNSHKVDHTFLVIGSACHTFPW 1396
              D+LLF GEENAYDEID++M+HIQ+EE IK + + V     K+ HTFLV+ SA H  PW
Sbjct: 1350 VFDLLLFHGEENAYDEIDVNMIHIQIEEFIKEFRTTV-PPPPKLAHTFLVVCSAGHLMPW 1408

Query: 1397 ESLSFMNDLSLSRIPSIKWLESAITRHYEQLIKGVPLTEKISMILNPHGDXXXXXXXXXX 1456
            ESL F+   S+SRIPS + L   I +    +   V L + IS+ILNP GD          
Sbjct: 1409 ESLEFLAKNSISRIPSTQILFDLIEKEQHLISPLVELEQNISVILNPDGDLVRTQADFIC 1468

Query: 1457 XXXXIVAKRPSSSLIVNEKPDEEKMLHMMSNCNLFIYVGHGGGEQYVRTREIKRCDNVGP 1516
                  +  P S LIV EKPDE+  L M++    FIYVGHGGGEQ+VR ++IK+ + + P
Sbjct: 1469 PFEEWCSHAPGSRLIVGEKPDEKTFLEMLTKAKTFIYVGHGGGEQFVRLKKIKQQNCIAP 1528

Query: 1517 SFLLGCSSASLKYYGGLEPTGTVNSYLLAGSPLVLGNLWDVTDKDIDKFSQSVFEKIGLV 1576
            SFLLGCSSA ++ +G LEP+G   SYLL GS +V+GNLWDVTDKDIDKFS+++FEK+GLV
Sbjct: 1529 SFLLGCSSAYMQNFGKLEPSGIAYSYLLGGSSMVVGNLWDVTDKDIDKFSRTMFEKLGLV 1588

Query: 1577 MGEDEIIHKRSISRAVNESRQLCHLKFLNGAAPVVYGLPLHF 1618
              E+E     ++S AV  +R  C LK+LNGAAPVVYGLPL F
Sbjct: 1589 REEEETY---TVSDAVASARYSCQLKYLNGAAPVVYGLPLRF 1627

>KLLA0D15136g complement(1276819..1281594) similar to sp|Q03018
            Saccharomyces cerevisiae YGR098c ESP1 required for sister
            chromatid separation singleton, hypothetical start
          Length = 1591

 Score =  879 bits (2272), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/1549 (34%), Positives = 854/1549 (55%), Gaps = 96/1549 (6%)

Query: 103  KEHLIVVVKLINNNFYDYSQSGILCLYNTTNLFKAHDLKDVILADFSESNEFYLSTLKIL 162
            K+H+  ++ L+  N    + + IL LYN TNL KA  + DV+L+DFS  NE YL+TLK++
Sbjct: 97   KKHMNWIIFLMERNKLTQASNQILMLYNETNLIKAKGIDDVLLSDFSAGNENYLATLKVI 156

Query: 163  SFQVILKKKNLKMYEDTIIQAFSHDERYILKDPNIKIHTVVKLLLNFFSILPTFKTLFGL 222
            + Q+ILK    + + +++++ F+HD RY+LKDPN+K+H +VKL+LNFF++L  FK LFGL
Sbjct: 157  TMQLILKTGTTERHAESLLECFAHDTRYLLKDPNVKVHALVKLILNFFTLLTGFKPLFGL 216

Query: 223  KFLQYIKQFNLSFQTYIKNMDSITFEKQLVRYGSKNIQ-QLKPYLNSYYINYSKF----N 277
            KF+QY+ QF L F  YIKNMDS TF++Q+ +   K+I      YL  YY  Y+K      
Sbjct: 217  KFVQYVNQFKLEFGNYIKNMDSSTFQRQITKLLRKDISVNCHIYLPKYYDEYTKHMENDQ 276

Query: 278  SHLTKLMLTDFVGRDLQSHKKTFALLKDHKEISSTSTECYCCLSHSQMDNFVISCHALMS 337
             +LT+ + TD +G+D+ +  +                                       
Sbjct: 277  VNLTEFLRTDVIGKDVCTEIR--------------------------------------- 297

Query: 338  NNDQIHLHTIDAVTFGWSIIRSENFPR--NKKMLALLDSTLIFLNSQMKHLEKMQISLVK 395
              +Q+ L +  A     +++R   +    NK    L DS +I +N+ +K L +  +  + 
Sbjct: 298  --NQLRLQSFSAGKID-ALLRPFLYQAALNKSSSRLCDSLIISVNNSIKDLNEEAV--IY 352

Query: 396  LIKMLAEVCMDYQEYKRMTNVIXXXXXXXXXXXXXXXLKLTAELESKHYLVCHDKSQWKK 455
            ++  L+++ + ++++KR  NV                L+  A +  + YL     S   +
Sbjct: 353  VLVYLSKIFLSFEDFKRTDNVAAVLYNCFVTKRKLLFLEHAAMVNYRAYL---RTSNILE 409

Query: 456  LIQKFEKFIGSAPEQYQKIELFSYVFNTFLLFNDDSLSFVVEFTETIFLRCFSRLKLTYF 515
              +KFE+ IG   ++  +  LFSYV N F++F +++L  +   T    + CF R+KL  F
Sbjct: 410  HFKKFERIIGCCQDRNVQKLLFSYVCNVFMIFKENTLQDMWNLTRKSLVPCFRRMKLDKF 469

Query: 516  IDFHDVSEPMLSILYGNSSITNIPHGDWNNLTEMLFFCVSGRFEINAININQVTTKWYYL 575
              F+  SEPML +LY  S  +      W++L +ML   V+   + + + I+         
Sbjct: 470  EIFNFSSEPMLCLLYSGSHFS--YQFKWSHLCQMLTDIVTD-VKQSDLQIDMKINTLDSF 526

Query: 576  YKYKDLIKSIYVLNLDMKKHXXXXXXXXXXXXXXKWVQKTSLLNEGISSIEVTFITMLFQ 635
             KY+ LIKS++ LN +M ++              KWV K +     +S +E+  +  +  
Sbjct: 527  SKYEVLIKSMFCLNSEMNRNSCLKLQKVSNIYLEKWVNKGN--ETKLSDLELMLLESMMP 584

Query: 636  YLGFNNFNKCILTLSAALRDHINYFAPLKLEISRWNIQSSINLQLMEQINDEAKLLSTIA 695
            +L  N   K    +   LR  +  +A +   IS W ++S + LQ+  ++  E  ++ T++
Sbjct: 585  FLLQNKIYKLTAEICTQLRS-VQRYASIPDLISYWLLESYVGLQIGPKV--ELSIMETVS 641

Query: 696  P------TYTICKLEKLLTFLEAKLDVFTWTNDYEGFQELFMEELPSVRLEVFDLNNQSK 749
                   ++T   +++L T L   L    W  D E F +L  ++L   R  +FD+ N++K
Sbjct: 642  ALKYQPSSFTEMNVDQLHTTLCILLTQVLWKKDIETFNKLIHDDLTRFRPNLFDIQNKTK 701

Query: 750  MPASQYIKVLLFMTKLFNHSSRLHLARDDITASVIESKRALKLATSLIKKQNKLSQSSRI 809
            MP ++Y+K+L+   K+   +S L L+++++  S+ E KR+LK+   LIKK+  LS   R 
Sbjct: 702  MPVAEYLKILMLNIKITRCASILQLSQNNVYMSLKECKRSLKICRLLIKKEAVLSAKYRF 761

Query: 810  RLINLVLNSFTQLIEIYIRLGLAKEADYYADQLSKVICDLGEPSVVYRGLHFLHNYYKLV 869
             +I+L+ + F ++I IY+  G+ K+  ++  +  +VI  L  P+ ++     L +YY+L+
Sbjct: 762  EVISLLDDIFQRIISIYVHTGIFKDCAFFITEYQEVIGSLDNPTALFNMFSCLCSYYQLI 821

Query: 870  KHEALEIITLQKANKTFDYLDGESDIESVLMFLFDNSEFKKISESLNLFFQDDFNNSFLP 929
            +      ++L K N  FD +DG ++IE++  FL+ N E +K++ S+ LFF DD   S + 
Sbjct: 822  EESENASLSLTKMNAAFDQIDGSANIEALATFLYFNKESEKLNNSMRLFFGDDVFISDIV 881

Query: 930  LYWQLKMGRPIDDSLCLTTLKSTNSIKKLERDYKHVLGQLESDPFFKNLFESILAVPAVT 989
             YW L+  +           ++   +   +  Y  V  Q+ +D FF+++ ES++A+PA  
Sbjct: 882  EYWLLRSCQKTSTETTRKDFEAMVCMNNAKILYNKVQKQMATDTFFRSMGESVMAIPACY 941

Query: 990  NIHNTQSDG---TMCLMETPTKKKLAFKVNDSPRPSNMTPKSKNLKQKFDKAVALSNLNR 1046
            +  +   DG   ++ L    T K     VNDSPRPS++TP+ K+L   FD++ A++NL  
Sbjct: 942  DCDSISVDGRHKSLSLTSVQTLKS----VNDSPRPSSLTPRGKSLAYSFDRSTAINNLQM 997

Query: 1047 IKCCIXXXXXXXXXXXXXXXISSLFSLTVTMLSNISKNALEDATLFQRFNLIDLPKRVPM 1106
                I               ++SL SLT+++  N+S     ++ L Q F L D P+ + +
Sbjct: 998  TDRFIQNADIKALKAHEIRELASLHSLTLSLFFNMSTKTRLESQLGQNFRLRDHPRSLSL 1057

Query: 1107 YYDKLLSSIDDDLYTDIKLLPFSSNHEQTRKKQALLSLNE-----STEFCGLSFDVITID 1161
             Y+K  S +  ++Y     +P +   E     +  ++L         ++  LSF+V+ ID
Sbjct: 1058 LYEKAFSDMGTEIYD--SFIPETIATESVEMSECNMNLATIHSEFGKKWSHLSFNVVEID 1115

Query: 1162 ICSITGNLLLSKLSATNGHKSHLSIPLNRANLRDLDAYSLTFVEAVKELAYIIDXXXXXX 1221
            IC +TG+LL+++         HL +PLNR N RDL    L F  A+ EL +II       
Sbjct: 1116 ICQLTGDLLITRFDTVRNKHLHLRLPLNRHNSRDLSEEVLGFEAALDELNHIISSNNCTT 1175

Query: 1222 XXXXXXXIKTKEDRKTWWKSRYELDNRLSSLLHNIETSWFAGLKGLFDQSVVDPSLFEEF 1281
                   I TKE RK WW  RY L+NRL +LL  IE SWF G KG+F+  +VD   FE F
Sbjct: 1176 SIEVTSVITTKEQRKNWWDERYALNNRLQTLLTKIEDSWFCGFKGVFNPRIVDQQQFEIF 1235

Query: 1282 KKKFYGILHSNLPSRKQMGKPMTFLQINDWIIELFLKLD---PQDDEFISMIEDMIYFTL 1338
            KK F  ILH++LPSRK   +  +FLQ+++ +IELF+ LD      ++ +SM+ED+IYF  
Sbjct: 1236 KKGFQSILHTHLPSRKSSRQSDSFLQVDNMLIELFVLLDVINQPTEKAVSMMEDLIYFVF 1295

Query: 1339 DILLFQGEENAYDEIDLSMVHIQLEEQIKRYHSKVISNSHKVDHTFLVIGSACHTFPWES 1398
            DILLF GE+NAYDEID++++H++ EE ++ Y+++  +    +DHTFL++G+ CH+ PWES
Sbjct: 1296 DILLFHGEQNAYDEIDVNLMHVKFEELLQEYNAESKTKDQTLDHTFLILGNKCHSIPWES 1355

Query: 1399 LSFMNDLSLSRIPSIKWLESAITRHYEQLIKGVPLTEKISMILNPHGDXXXXXXXXXXXX 1458
            L F+  +S+SR+PSIK L+  +T+H E L   V ++E +S +LNP G+            
Sbjct: 1356 LDFLKSISISRVPSIKMLDELLTKHSE-LSPCVNVSENLSFVLNP-GNDLGRTETVFSSE 1413

Query: 1459 XXIVAKRPSSSLIVNEKPDEEKMLHMMSNCNLFIYVGHGGGEQYVRTREIKRCDNVGPSF 1518
               +A R +S   + + P  ++  H +++ NLF+YVGH GGEQYV+ +++++C+++ PS 
Sbjct: 1414 FIAMASRTNSKAFIGKPPTVDEFFHSVADSNLFVYVGHSGGEQYVKLKDLRKCNHLAPSL 1473

Query: 1519 LLGCSSASLKYYGGLEPTGTVNSYLLAGSPLVLGNLWDVTDKDIDKFSQSVFEKIGL--- 1575
            LLGCSSA LKY G  E +GT+ SYLL GSP+V+GNLWDVTDKD DK S SVFEK G    
Sbjct: 1474 LLGCSSAHLKYCGTFESSGTIYSYLLGGSPMVVGNLWDVTDKDTDKLSVSVFEKTGFFNS 1533

Query: 1576 --VMGEDE----IIHKRSISRAVNESRQLCHLKFLNGAAPVVYGLPLHF 1618
              +   DE    I    ++S A+++SR  C++K+L GAA V+YGLP+ F
Sbjct: 1534 KPISRTDESDATIKQFLNVSEAISQSRDECNMKYLIGAAMVIYGLPMRF 1582

>CAGL0G03223g complement(300119..304933) similar to sp|Q03018
            Saccharomyces cerevisiae YGR098c ESP1 required for sister
            chromatid separation, hypothetical start
          Length = 1604

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/1560 (31%), Positives = 788/1560 (50%), Gaps = 94/1560 (6%)

Query: 103  KEHLIVVVKLINNNFYDYSQSGILCLYNTTNLFKAHDLKDVILADFSESNEFYLSTLKIL 162
            K+HL+++VKLIN N  + +   I+ LYN TN     +++ ++L D++++N+ YLS+LKIL
Sbjct: 94   KQHLLLIVKLINGNCLNSASRNIISLYNNTNRNSISEIQQLLLCDYTKNNKEYLSSLKIL 153

Query: 163  SFQVILKKKNLKMYEDTIIQAFSHDERYILKDPNIKIHTVVKLLLNFFSILPTFKTLFGL 222
              Q +LKK ++     ++I+ F++D + +L+D  +K +TV+KL+LN++S    ++ LFGL
Sbjct: 154  VLQTLLKKHDVSESIISVIKLFAYDRKLLLEDHKLKKNTVIKLILNYYSKFKEYRLLFGL 213

Query: 223  KFLQYIKQFNLSFQTYIKNMDSITFEKQLVRYGSKNIQQLKPYLNSYYINYS-KFNSHLT 281
            KFLQYI QFN  +  +IKNM    F +QL R  + N      YL+ +Y +Y  ++ S+  
Sbjct: 214  KFLQYIAQFNFRYDEFIKNMTRDAFLQQLGRQKTSNNTLTSRYLSMFYFSYQMQYKSNND 273

Query: 282  KLMLTDFVGRDLQSHKKTFALLKDHKEISSTSTECYCCLSHSQMDNFVISCHALMSNNDQ 341
            +L    F     +   + F  L++      T+ E     +    D +++S   L   ND 
Sbjct: 274  QL----FSSTSAEHVPEGFFNLQN----VVTNLE----RNERFFDKYMMSTKQL---NDL 318

Query: 342  IHLHTIDAVTFG--------------WSIIRSENFPRNKKMLALLDSTLIFLNSQMKHLE 387
            I++   +   F                SI + + +  +K +L  LD  +I LNS +K+L 
Sbjct: 319  INIIAEEGRVFEKELDEKSILLIQRILSIFQIKCYEISKPVLKFLDKIIILLNSNVKYLS 378

Query: 388  KMQISLVKLIKMLAEVCMDYQEYKRMTNVIXXXXXXXXXXXXXXXLKLTAELESKHYLVC 447
                 L+KLI+ + + C     +K   N +               L L ++ E    L+ 
Sbjct: 379  NDISPLIKLIESMIQFCTTNSLHKTFENTMAVAYNIALKTKNSELLLLVSKFEFSRLLLN 438

Query: 448  HDKSQWKKL--IQKFEKFIGSAPE---QYQKIELFSY--VFNTFLLFNDDSLSFVVEFTE 500
            + +++  K   + KF  F+ +  E   +Y+ +++F +  +F+    FN+  +  V E+  
Sbjct: 439  YKETEKIKPSDLNKFNVFLSATKEIRNRYKILQIFYHHTLFDGKEHFNE--VYAVCEYIA 496

Query: 501  TIFLRCFSRLKLTYFIDFHDVSEPMLSILYGNSSITNIPHGDWNNLTEMLFFCVSGRFE- 559
             I  R    LK   + +    SE M  I+ G   +TN  + +   +   +    S  F  
Sbjct: 497  AIVKRKIGTLK---WENLECKSEVMKGIIAG---VTNDRYPNNECMEPCILLLQSSFFPE 550

Query: 560  --INAININQVTTKWYYLYKYKDLIKSIYVLNLDMKKHXXXXXXXXXXXXXXKWVQKTSL 617
              + +   N  + +   +Y    L+K  Y+LN D+ K               ++  K + 
Sbjct: 551  KVLTSEEYNDSSNQDGIVYDVFPLLKCNYLLNNDIAKGRTMYLVQVTKTFC-QFATKDNK 609

Query: 618  LNEGISSIEVTFITMLFQYLGFNNFNKCILTLSAALRDHINYFAPLKLEISRWNIQSSIN 677
            +N   S IE  FI  L  YL  N ++K +L++   L     Y+  L  +   +   S + 
Sbjct: 610  VNY-CSRIENDFIKKLLNYLSINGYHKLLLSVVGILEKRTEYYKTLSNDYITYKAHSCMR 668

Query: 678  LQLMEQINDEAKLLSTIAPTYTICKLEKLLTFLEAKLDVFTWTNDYEGFQELFM---EEL 734
            L+L  +        +           + +   L   L   +W    E   ELF    E +
Sbjct: 669  LKLKNRTKHVFDQFTNQKGEIKFDDEKDIYNHLIMSLLYASW----EDSPELFTSSNERV 724

Query: 735  P-SVRLEVFDLNNQSKMPASQYIKVLLFMTKLFNHSSRLHLARDDITASVIESKRALKLA 793
            P  ++  + D +   K   ++Y + L+F  K  N+ + L   +   + +V  SK+ LK+ 
Sbjct: 725  PKDIKEHILDFSTNDKSNLNKYFQKLIFNIKFANYYASLLNQKKCYSYAVEVSKKGLKIG 784

Query: 794  TSLIKKQNKLSQSSRIRLINLVLNSFTQLIEIYIRLGLAKEADYYADQLSKVICDLGEPS 853
             S++K   KL  + R+ ++N +++S++ LI+IY  +GLAK A YY  +++K++    +P 
Sbjct: 785  KSVLKIIEKLDLNDRLTVLNQLVSSYSNLIKIYTAVGLAKGAQYYCKEVTKLLPVFDQPI 844

Query: 854  VVYRGLHFLHNYYKLVKHEALEIITLQK-ANKTFDYLDGESDIESVLMFLFDNSEFKKIS 912
             ++  +H L   + L   +    +T +K AN  FD L+ E DI +   FL+ N E+ KI 
Sbjct: 845  FLF-SVHVLLFEFYLENGDYDSALTHKKNANYVFDNLNAEHDIINTTSFLYINEEYDKIQ 903

Query: 913  ESLNLFFQDDFNNSFLPLYWQLKMGRPIDDSLCLTTLKSTNSIKKLERDYKHVLGQLESD 972
            ESL L+F  D N++   L W+LK+G   D+  C T   + N   K+    + ++ ++++D
Sbjct: 904  ESLRLYFGYDLNDTDFFLSWKLKLGNICDE--CPTQYSNMNFFNKIVHINQRLVLEIDAD 961

Query: 973  PFFKNLFESILAVPAVTNIHNTQSDGTMC-LMETPTKKKLAFKVNDSPRPSNMTPKSKNL 1031
            PF K+L E+ILA     N+ N  S G++  +++           N + R SNMTPK +  
Sbjct: 962  PFLKSLNETILA-----NL-NCVSPGSLSNILDVG-----MISSNSTNRSSNMTPKRRPT 1010

Query: 1032 KQKFDKAVALSNLNRIKCCIXXXXXXXXXXXXXXXISSLFSLTVTMLSNI-----SKNAL 1086
              K +K + +  L+                     +S ++ L    L ++     S+  L
Sbjct: 1011 SFKTNKHIVMDILDEFFTTFNAMRQELTERNVILKVSDIYRLNYFYLISLLSVPESRKQL 1070

Query: 1087 EDATLFQRFNLIDLPKRVPMYYDKLLSSIDDDLYTDIKLLPFSSNHEQTRKKQALLSLNE 1146
             + T+ Q   L +LP  +   Y+ LL+  + D+Y        SSN+E  + K   L+  E
Sbjct: 1071 IEETITQ---LNELPSEITHTYESLLADKNCDIYGKTIFELESSNYEIMKSKNVTLNWEE 1127

Query: 1147 ST------EFCGLSFDVITIDICSITGNLLLSKLSATNGHKSHLSIPLNRANLRDLDAYS 1200
                    + C ++ +VI IDIC +T  L++ ++S  +       IP++R   RDLDA S
Sbjct: 1128 QIGKDRLLDLCNITVEVICIDICKLTNTLIIRRISNLDSKNIMAKIPIDRNVSRDLDADS 1187

Query: 1201 LTFVEAVKELAYIIDXXXXXXXXXXXXXIKTKEDRKTWWKSRYELDNRLSSLLHNIETSW 1260
            LTF +A + L  II+             IK K D + WWK RY+LD  L +L+  IE +W
Sbjct: 1188 LTFQQASESLQKIINDSNESVSKNVTETIKDKNDVRNWWKRRYDLDELLGNLIERIEKTW 1247

Query: 1261 FAGLKGLFDQSVVDPSLFEEFKKKFYGILHSNLPSRKQMGKPMTFLQINDWIIELFLKLD 1320
              GL G+ +    D     EF+ K   IL+  LPSR+       FLQ+++WII L L LD
Sbjct: 1248 LNGLSGILNGLYCDKDALLEFQSKITAILNQILPSRRNCCNRANFLQLDEWIISLLLDLD 1307

Query: 1321 PQDDEFISMIEDMIYFTLDILLFQGEENAYDEIDLSMVHIQLEEQIK--RYHSKVISNSH 1378
            P D  F + +ED+IYF LD L  +GEENAYDEID  ++H+ LEE+I+  R + K+ +   
Sbjct: 1308 PSDLGFFTALEDVIYFILDTLSHKGEENAYDEIDFGLLHVLLEEEIRKVRVNKKLFT--- 1364

Query: 1379 KVDHTFLVIGSACHTFPWESLSFMNDLSLSRIPSIKWLESAITRHYEQLIKGVPLTEKIS 1438
            K++HTFLV+G +CHTFPWE +  +   S++R+PS+  L + ++     L   +  T  IS
Sbjct: 1365 KIEHTFLVVGPSCHTFPWEIMKPLKGRSVTRVPSLTILSNLLSSIKGNLPVKIERTNDIS 1424

Query: 1439 MILNPHGDXXXXXXXXXXXXXXIVAKRPSSSLIVNEKPDEEKMLHMMSNCNLFIYVGHGG 1498
            MILN + D              I   R  S L+VN+KP EE+ +  ++N  +F+YVGHGG
Sbjct: 1425 MILNSNSDLVRTEKTFKDIFERIQDSRAGSRLLVNQKPTEEEYMDYLTNSKVFLYVGHGG 1484

Query: 1499 GEQYVRTREIKRCDNVGPSFLLGCSSASLKYYGGLEPTGTVNSYLLAGSPLVLGNLWDVT 1558
            GEQYVR   I+RCD + P FL+GCSSA+ K  G L P     SY+   S +VLGNLWDVT
Sbjct: 1485 GEQYVRNCTIERCDKLPPVFLMGCSSAATKLNGNLNPNCVAESYMYGNSVMVLGNLWDVT 1544

Query: 1559 DKDIDKFSQSVFEKIGLVMGEDEIIHKRSISRAVNESRQLCHLKFLNGAAPVVYGLPLHF 1618
            DKDIDKFS  + EK  L+  +   +    + +AV +SR +CHLK+LNGAAPVVYGLP+ F
Sbjct: 1545 DKDIDKFSIEMLEKCNLLDAKPNTV-ITGVPQAVADSRTVCHLKYLNGAAPVVYGLPVVF 1603

>Kwal_34.15777
          Length = 499

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 48/101 (47%), Gaps = 17/101 (16%)

Query: 706 LLTFLEAKLDVFTWTNDYEGFQELFMEELPSVRLEVFDLNNQSKMPASQYIKVLLFMT-- 763
           L +F+ +  D ++ TNDY  F        P+     F+L+ Q+K P++ Y+ + L  +  
Sbjct: 246 LKSFVASAADEWSATNDYGPFSNPLYYMNPT-----FELSIQTKGPSTHYVNIQLVSSGS 300

Query: 764 -----KLFNHSSRLHLAR----DDITASVIESKRALKLATS 795
                +LF HS    L R    D      + SKRAL LAT+
Sbjct: 301 APVNLQLF-HSEDNQLLRPLVFDGQYQEKVYSKRALPLATN 340

>KLLA0F27797g complement(2572415..2575720) similar to sp|P40541
           Saccharomyces cerevisiae YIL026c IRR1 essential protein
           singleton, start by similarity
          Length = 1101

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 75/167 (44%), Gaps = 27/167 (16%)

Query: 617 LLNEGISSIEVTFITMLFQYLGFNNFNKCILTLSAALRDHINYFAPLKLEISRWNIQSSI 676
           LL++  +S+ +  I  L   + F+N        +AALR     F    LEI+  +I   +
Sbjct: 403 LLSDSSNSVRLQVIRSLHDLIKFSNKRNKNTVDNAALRQFFERFKDRMLEIAGRDIDIQV 462

Query: 677 NL---QLMEQIN-----DEAKLLSTIAPTYTICKLEKLLTFLEAKLDVFTWTNDYEGFQE 728
            L   Q++  IN     D+ +++  I+           L F + ++ V + + D +   E
Sbjct: 463 RLTSVQVLSSINGLGYLDDHEIIDIIS-----------LIFFDHEVKVSSSSRDVKFLNE 511

Query: 729 L--FMEELPSVRLEVFDLNNQS-KMPA-----SQYIKVLLFMTKLFN 767
           +  F+  + S + E F +NN+  K+P       Q++KV + M  L N
Sbjct: 512 VTKFLANIVSEKTEEFLINNERFKVPVISVTEEQFVKVGVLMRLLHN 558

>Scas_638.10
          Length = 1081

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 1317 LKLDPQDDEFISMIEDMIYFTLDILLFQGEENAYDEIDLSMVHIQLEEQIKRYHSK-VIS 1375
            L ++P  DE I+   +       +LLF G   AY+E+ L    I +E+  K    K  I+
Sbjct: 165  LGMNPHTDEIITEAINCTIPYQQLLLFIGSNPAYNELLLIFTEIIVEDLTKLQSKKHAIA 224

Query: 1376 NSHKVDHTFLVIGS 1389
              H   HT+L + +
Sbjct: 225  KIHTTVHTYLYVST 238

>AGL287W [4025] [Homologous to ScYBL088C (TEL1) - SH]
            complement(166008..174314) [8307 bp, 2768 aa]
          Length = 2768

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 10/59 (16%)

Query: 491  SLSFVVEFTETIFLRCFSRLKLTYFIDFHDVSEPMLSILYGNSSIT------NIPHGDW 543
            +L F V++TE++FL  F++L        H+     LSIL  + S T      NI HG W
Sbjct: 1336 ALGFNVKYTESLFLCIFAKL----LPQLHEAKTANLSILLNDISNTLTINNSNIIHGKW 1390

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 51,530,445
Number of extensions: 2289344
Number of successful extensions: 6853
Number of sequences better than 10.0: 30
Number of HSP's gapped: 7024
Number of HSP's successfully gapped: 33
Length of query: 1620
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1505
Effective length of database: 12,615,039
Effective search space: 18985633695
Effective search space used: 18985633695
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 69 (31.2 bits)