Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_716.2668668632570.0
YGR099W (TEL2)68868713740.0
KLLA0D15158g6666839991e-126
Kwal_55.205296916789511e-118
CAGL0G07755g6856918451e-103
AAR090W6596757937e-96
CAGL0A03322g45074684.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_716.26
         (686 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_716.26                                                          1259   0.0  
YGR099W (TEL2) [2059] chr7 (687901..689967) Protein involved in ...   533   0.0  
KLLA0D15158g 1281895..1283895 similar to sp|P53038 Saccharomyces...   389   e-126
Kwal_55.20529                                                         370   e-118
CAGL0G07755g 736112..738169 similar to sp|P53038 Saccharomyces c...   330   e-103
AAR090W [276] [Homologous to ScYGR099W (TEL2) - SH] complement(5...   310   7e-96
CAGL0A03322g 333824..335176 highly similar to sp|P53096 Saccharo...    31   4.5  

>Scas_716.26
          Length = 686

 Score = 1259 bits (3257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 627/686 (91%), Positives = 627/686 (91%)

Query: 1   MSDFKVLKDHPDAQVIEDVLQQLSNETDAPTLEVCLLIIQHVIPIYPSLSKHTRDLTQSL 60
           MSDFKVLKDHPDAQVIEDVLQQLSNETDAPTLEVCLLIIQHVIPIYPSLSKHTRDLTQSL
Sbjct: 1   MSDFKVLKDHPDAQVIEDVLQQLSNETDAPTLEVCLLIIQHVIPIYPSLSKHTRDLTQSL 60

Query: 61  VSRSFTFMSQLVNYASTVMKDKPEGKLYRNFIKEVLATQPECLHNYLIHMSSSRMEKNYL 120
           VSRSFTFMSQLVNYASTVMKDKPEGKLYRNFIKEVLATQPECLHNYLIHMSSSRMEKNYL
Sbjct: 61  VSRSFTFMSQLVNYASTVMKDKPEGKLYRNFIKEVLATQPECLHNYLIHMSSSRMEKNYL 120

Query: 121 KTLFFGSRVFNSLGNDIDIIEYLELLRSQWKSVLDDDILIETLVLDSFLGELLVSSLILN 180
           KTLFFGSRVFNSLGNDIDIIEYLELLRSQWKSVLDDDILIETLVLDSFLGELLVSSLILN
Sbjct: 121 KTLFFGSRVFNSLGNDIDIIEYLELLRSQWKSVLDDDILIETLVLDSFLGELLVSSLILN 180

Query: 181 PTYAMDLLFGDLFLSTETYATILNKIILNASNLDQQRLVNKFLLPYLEPLTNTSNFKSTN 240
           PTYAMDLLFGDLFLSTETYATILNKIILNASNLDQQRLVNKFLLPYLEPLTNTSNFKSTN
Sbjct: 181 PTYAMDLLFGDLFLSTETYATILNKIILNASNLDQQRLVNKFLLPYLEPLTNTSNFKSTN 240

Query: 241 HILRELPLHKCITLDVILRMKSHILQEIIIRQMSEFASSIIPSLISKFGTLDESQDEDIC 300
           HILRELPLHKCITLDVILRMKSHILQEIIIRQMSEFASSIIPSLISKFGTLDESQDEDIC
Sbjct: 241 HILRELPLHKCITLDVILRMKSHILQEIIIRQMSEFASSIIPSLISKFGTLDESQDEDIC 300

Query: 301 IIFVMVLKFNLNEEQREQLAHDGNFLDAITKRLSHKNSEFRERTMFIAKLASNNELEYDS 360
           IIFVMVLKFNLNEEQREQLAHDGNFLDAITKRLSHKNSEFRERTMFIAKLASNNELEYDS
Sbjct: 301 IIFVMVLKFNLNEEQREQLAHDGNFLDAITKRLSHKNSEFRERTMFIAKLASNNELEYDS 360

Query: 361 DFVIKLPDLDITNNEKIEIDPALFXXXXXXXXXXXXXXXXXXFHEMVLXXXXXXXXXXXX 420
           DFVIKLPDLDITNNEKIEIDPALF                  FHEMVL            
Sbjct: 361 DFVIKLPDLDITNNEKIEIDPALFKRSSSGVSASKVSRISSGFHEMVLQEDSDDEVQDDE 420

Query: 421 XXIINRIVFLKDLVKEFEKNGNDGPAESIPLLKKTITLVRQKEHFPLEVDYYFSGLLTNI 480
             IINRIVFLKDLVKEFEKNGNDGPAESIPLLKKTITLVRQKEHFPLEVDYYFSGLLTNI
Sbjct: 421 QEIINRIVFLKDLVKEFEKNGNDGPAESIPLLKKTITLVRQKEHFPLEVDYYFSGLLTNI 480

Query: 481 AYXXXXXXXXXXXXWRINALVSLLVVVPEKVQELIKIFLSSELSLQQRMSILSSLGLSAR 540
           AY            WRINALVSLLVVVPEKVQELIKIFLSSELSLQQRMSILSSLGLSAR
Sbjct: 481 AYLNNNLEESNFEEWRINALVSLLVVVPEKVQELIKIFLSSELSLQQRMSILSSLGLSAR 540

Query: 541 ELRGMDDKVITKPKLDFPTSRLPWDKKTKEQHDKKRITELGNSNSTLIEXXXXXXXXXXX 600
           ELRGMDDKVITKPKLDFPTSRLPWDKKTKEQHDKKRITELGNSNSTLIE           
Sbjct: 541 ELRGMDDKVITKPKLDFPTSRLPWDKKTKEQHDKKRITELGNSNSTLIETKTTWKSKKLT 600

Query: 601 XXXXEDKPNRFREYATLFFYPLAHIWLNGIDVGTFDDLFKNHFLTTLRIIYMCAHPVHDY 660
               EDKPNRFREYATLFFYPLAHIWLNGIDVGTFDDLFKNHFLTTLRIIYMCAHPVHDY
Sbjct: 601 LAAKEDKPNRFREYATLFFYPLAHIWLNGIDVGTFDDLFKNHFLTTLRIIYMCAHPVHDY 660

Query: 661 ESMTQLMEQIIYQATEQGVIQPSINT 686
           ESMTQLMEQIIYQATEQGVIQPSINT
Sbjct: 661 ESMTQLMEQIIYQATEQGVIQPSINT 686

>YGR099W (TEL2) [2059] chr7 (687901..689967) Protein involved in
           controlling telomere length and telomere position effect
           [2067 bp, 688 aa]
          Length = 688

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/687 (42%), Positives = 413/687 (60%), Gaps = 19/687 (2%)

Query: 5   KVLKDHPDAQVIEDVLQQLSNETDAPT-LEVCLLIIQHVIPIYPSLSKHTRDLTQSLVSR 63
           + LK   D+  I + L QL +    P  L+  +++I+ VIP+YPSL + ++ + + L S+
Sbjct: 4   ETLKQGLDSSQIHEALIQLDSYPREPVDLDASMVLIKFVIPVYPSLPERSKVILRRLASK 63

Query: 64  SFTFMSQLVNYASTVMKDKP--EGKLYRNFIKEVLATQPECLHNYLIHMSSSRMEKNYLK 121
           SFTF+ Q+V ++ T+       E ++Y+  ++++++ +P CL  YL   ++S+ +++ +K
Sbjct: 64  SFTFLCQIVTFSRTISGRDGLQEIRIYQEILEDIISFEPGCLTFYLKASTTSKADRDSIK 123

Query: 122 TLFFGSRVFNSLGNDIDIIEYLELLRSQWKSVLDDDILIETLVLDSFLGELLVSSLILNP 181
            LFFGS++FN L N ID+ +YL  LR QWK +L+ +   ET     FLGE LVSS +LNP
Sbjct: 124 ALFFGSKLFNVLANRIDMAKYLGYLRLQWKFLLESN---ETDP-PGFLGEWLVSSFLLNP 179

Query: 182 TYAMDLLFGDLFLSTETYATILNKIILNASNLDQQRLVNKFLLPYLEPLTNTSNFKSTNH 241
             A D+L G+LFL  E+Y     KII  +S +DQ+RL+ KFLLPY++ +    N      
Sbjct: 180 VLAADMLLGELFLLKESYFFSFQKIISASSLIDQKRLIAKFLLPYIQVIVTLENLNDVRK 239

Query: 242 ILRELPLHKCITLDVILRMKSHILQEIIIRQMSEFASS-IIPSLISKFGTL-DESQDEDI 299
           ILR   L K I+L V+  ++S  L+E+I+R MS  +S+  + +L+SKF    DE  D   
Sbjct: 240 ILRRFDLDKIISLSVLFEIQSLPLKEVIVRLMSNHSSTKFVSALVSKFADFTDEEVDTKT 299

Query: 300 CIIFVMVLKFNLNEEQREQLAHDGNFLDAITKRLSHKNSEFRERTMFIAKLASNNELEYD 359
           C + V+    NLN  QRE++AHD  FL+ +TK L     E RER MFIAKL S   L+Y+
Sbjct: 300 CELLVLFAVHNLNHSQREEIAHDERFLNGVTKHLGSNEREARERAMFIAKLLSGGHLKYE 359

Query: 360 SDFVIKLPDLDITNNEKIEI-------DPALFXXXXXXXXXXXXXXXXXXFHEMVLXXXX 412
           SDF I +P++   +N   +I       +P++                       +     
Sbjct: 360 SDFKINIPNVKFESNSDDKIIDFQSLKNPSICNTQTDVGKDKITEVSGHVQSLTLDCSDS 419

Query: 413 XXXXXXXXXXIINRIVFLKDLVKEFEKNGNDGPAESIPLLKKTITLVRQKEHFPLEVDYY 472
                     I+ RIVFLKDL+KE+EK G    A  IPLLK+T+ L+RQK  F LEV YY
Sbjct: 420 DDEDENDEREIVKRIVFLKDLMKEYEKTGESRKAPLIPLLKQTVKLIRQKADFQLEVGYY 479

Query: 473 FSGLLTNIAYXXXXXXXXXXXXWRINALVSLLVVVPEKVQELIKIFLSSELSLQQRMSIL 532
             G+L++I              WRINAL S+LVV+PEKV   I I  +SELSLQQRMS+L
Sbjct: 480 AQGILSSIVCLNNEFDEPLFEQWRINALTSILVVLPEKVNGAINILFNSELSLQQRMSLL 539

Query: 533 SSLGLSARELRGMDDKVITKPKLDFPTSRLPWDKKTKEQHDKKRITELGNSNSTLIEXXX 592
           S+LGLSARELRG+DD  I KPK DFPT+RLPWD ++   H   R+ E+  S S + +   
Sbjct: 540 SALGLSARELRGLDDPTIVKPKFDFPTNRLPWDDQS---HHNSRLVEVQESTSMIKKTKT 596

Query: 593 XXXXXXXXXXXXEDKPNRFREYATLFFYPLAHIWLNGIDVGTFDDLFKNHFLTTLRIIYM 652
                       +   NRFR+YA LFFYPLAH WLNGIDVGT++ LFK+H+LTTLRIIY 
Sbjct: 597 VWKSRKLGKDREKGTQNRFRKYAGLFFYPLAHGWLNGIDVGTYNQLFKSHYLTTLRIIYS 656

Query: 653 CAHPVHDYESMTQLMEQIIYQATEQGV 679
           CA+PVHD+ESMT+LM  II  A E+G+
Sbjct: 657 CANPVHDFESMTELMNHIISSAIEEGI 683

>KLLA0D15158g 1281895..1283895 similar to sp|P53038 Saccharomyces
           cerevisiae YGR099w TEL2 involved in controlling telomere
           length and position effect singleton, start by
           similarity
          Length = 666

 Score =  389 bits (999), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 244/683 (35%), Positives = 378/683 (55%), Gaps = 30/683 (4%)

Query: 3   DFKVLKDHPDAQVIEDVLQQLSNETDAPTLEVCLLIIQHVIPIYPSLSKHTRDLTQSLVS 62
           D  +L +  D   I  VL+++S++    + E+ L II++V+PIYPSL +  +   + L  
Sbjct: 5   DSTLLNEKCDKDTIYQVLERMSSKKQHSSNEI-LPIIKNVVPIYPSLPRELKMALRRLCG 63

Query: 63  RSFTFMSQLVNYASTVMKDKPEGKLYRNFIKEVLATQPECLHNYLIHMSSSRMEKNYLKT 122
            ++ F+S ++ YA  + K++ E  ++  F+ +VL  + +CL NYL H  SSR +  ++K+
Sbjct: 64  NNYIFISLVIEYAKELGKNR-ETSIFYGFLTDVLKYESDCLFNYLEH--SSRRDLPFIKS 120

Query: 123 LFFGSRVFNSLGNDIDIIEYLELLRSQWKSVLDDDILIETLVLDSFLGELLVSSLILNPT 182
           + FGSR +N+L + I I+EYL+ ++ QW+ V       ET   D    E+ VS L LN  
Sbjct: 121 ILFGSRCYNALSSSISIVEYLKFMKMQWEFVFK-----ETKQYDKTHLEMFVSCLQLNIP 175

Query: 183 YAMDLLFGDLFLSTETYATILNKIILNASNLDQQRLVNKFLLPYLEPLTNTSNFKSTNHI 242
           Y +D+    L  ++E     L  ++   +++ Q+R     L+P+LE +TN  N  +   +
Sbjct: 176 YGVDIFIEGLATTSEFSWNALIMMLSKGTSVQQRRFFMYHLVPFLEKVTNPDNSSTIFTL 235

Query: 243 LRELPLHKCITLDVILRMKSHILQEIIIRQMSEFA-SSIIPSLISKFGTLDESQDEDICI 301
           L +LP     ++D   +  +   + + +  MSE   + +   L+  F  +D   D+ +  
Sbjct: 236 LSQLPFDIPTSIDC-FKWGNPYFKIVYLHGMSEAKRAQLFRELLPCFELMDLYTDDSLAE 294

Query: 302 IFVMVLKFNLNEEQREQLAHDGNFLDAITKRLSHKNSEFRERTMFIAKLASNNELEYDSD 361
           I VM+L   ++++ R++L+HD   L+ +TKRL  ++   RERTMF+AK  +N++L+Y+SD
Sbjct: 295 ILVMILD-AMSKDSRDELSHDAISLNFVTKRLHSEDHLVRERTMFVAKKLTNDQLQYESD 353

Query: 362 FVIKLPDLDITNNEKIEIDPALFXXXXXXXXXXXXXXXXXXFHEMVLXXXXXXXXXXXXX 421
           F I LP +++    K+E  P                     F+ + L             
Sbjct: 354 FTIDLPRIELIKLSKLEF-PIKEGLQNLPKGNSTKNELVQQFNTITLQDSDDESDEEDSR 412

Query: 422 XIINRIVFLKDLVKEFEKN-GNDGPAESIPLLKKTITLVRQKEHFPLEVDYYFSGLLTNI 480
            I+    FLKDL+ EFEK   NDG    + LLK+T+ LVRQK++FP EV +Y   LL  I
Sbjct: 413 DIL----FLKDLLLEFEKVIKNDG--SELRLLKETVKLVRQKKNFPTEVSFYSKELLKKI 466

Query: 481 AYXXXXXXXXXXXXWRINALVSLLVVVPEKVQELIKIFLSSELSLQQRMSILSSLGLSAR 540
           A             W+ NALVS+LVV P+K+ +L  I  ++ELSLQQRM IL+S  LSAR
Sbjct: 467 ATISNKFDEKSFEEWKANALVSILVVCPDKIVDLYAILFNNELSLQQRMVILTSAALSAR 526

Query: 541 ELRGMDDKVITKPKLDFPTSRLPWDKKTKEQHDK----KRITELGNSNSTLIEXXXXXXX 596
           ELRG DD+ + KPK DFPT+RLPWD+   EQ  +    + ITE+  S  T          
Sbjct: 527 ELRGFDDEFVVKPKYDFPTNRLPWDESATEQQPENNKIQDITEITGSKVTW------RSK 580

Query: 597 XXXXXXXXEDKPNRFREYATLFFYPLAHIWLNGIDVGTFDDLFKNHFLTTLRIIYMCAHP 656
                     + N FR+YATLFFYPLAH WLNGI++G FD +FK H+++ L+II  CA P
Sbjct: 581 RLETDSKITQQQNNFRKYATLFFYPLAHAWLNGINLGAFDKVFKRHYISMLKIILTCASP 640

Query: 657 VHDYESMTQLMEQIIYQATEQGV 679
            ++ E M  LM++I+  A +Q V
Sbjct: 641 HYELEEMQILMQEILSDAVKQQV 663

>Kwal_55.20529
          Length = 691

 Score =  370 bits (951), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 232/678 (34%), Positives = 373/678 (55%), Gaps = 19/678 (2%)

Query: 5   KVLKDHPDAQVIEDVLQQLSNETDAPTLEVCLLIIQHVIPIYPSLSKHTRDLTQSLVSRS 64
           + LK  P A+VI++ L  + ++  + T+E   ++ ++VIP+Y SL   ++ L  ++   S
Sbjct: 15  ETLKTQPSAEVIQECLSVIQSQA-SLTVESAAVLARYVIPVYTSLPSASKMLLFTIFEES 73

Query: 65  FTFMSQLVNYASTVMKDKPEGKLYRNFIKEVLATQPECLHNYLIHMSSSRMEKNYLKTLF 124
           F  +  ++N+   + K   E K+Y+ F+ E L+    C++ Y I  +    E   L++ F
Sbjct: 74  FLLLGHVLNFIKLLQKSS-EAKIYKRFLIEGLSHNHGCIYKY-IRGAEHITELQMLRSAF 131

Query: 125 FGSRVFNSLGNDIDIIEYLELLRSQWKSVLDDDILIETLVLDSFLGELLVSSLILNPTYA 184
           FGS++ NS+G++IDI  YL+++R+Q+K + D     E    D    + L + + L+   A
Sbjct: 132 FGSKILNSVGDEIDIENYLDIVRAQFKFIFDQTPQFE----DKVYADFLCAFISLHSLLA 187

Query: 185 MDLLFGDLFLSTETYATILNKIILNASNLDQQRLVNKFLLPYLEPLTNTSNFKSTNHILR 244
            +++FG L LS+E + +   +I+  AS L Q++LV K L+ +L+   + +N  S  +I +
Sbjct: 188 PEVVFGGLVLSSEDHFSKFVQILRCASLLSQKKLV-KALIFFLDSRVSQANTDSAFNIFQ 246

Query: 245 ELPLHKCITLDVILRMKSHILQEIIIRQMSE-FASSIIPSLISKFGTLDESQDEDICIIF 303
            + + + ++ D++L++ + IL  +++R ++E  A  +  SL+  F   +   D   C + 
Sbjct: 247 RVGV-ELLSTDILLKVHNEILSAVLVRNLTEEQALKLYHSLLVFFHRHEAESDGTACFLL 305

Query: 304 VMVLKFNLNEEQREQLAHDGNFLDAITKRLSHKNSEFRERTMFIAKLASNNELEYDSDFV 363
            + L+  L    + +L H   FL+A+T RL+ +++  RERTM+IAK  +N+  EY+SDF 
Sbjct: 306 CLALQ-RLPHSVKAELGHAEEFLNAVTFRLTSQDAAIRERTMYIAKKITNDSFEYESDFT 364

Query: 364 IKLPDLDITNNEKIEIDPALFXXXXXXXXXXXXXXXXXXFHEMVLXXXXXXXXXXXXXXI 423
           I+ P +    +  I+    L                    + MV               +
Sbjct: 365 IETPHIKTPKSSIIDFS-TLQAVKPLHDHERNFKPSASLDNTMVRLSLSESETDENGVTL 423

Query: 424 INRIVFLKDLVKEFEKNGNDGPAESIPLLKKTITLVRQKEHFPLEVDYYFSGLLTNIAYX 483
               VFLKDL++EFE   N   A  + LLK T+ L+RQK+ F LE+  Y   LL  I   
Sbjct: 424 ----VFLKDLIREFELLSNQ-TASRLHLLKSTVRLIRQKKDFTLEISTYSPQLLAVITSL 478

Query: 484 XXXXXXXXXXXWRINALVSLLVVVPEKVQELIKIFLSSELSLQQRMSILSSLGLSARELR 543
                      WRINALVS+L   PEKV ELIKI    ELSLQQRMSILS+L L+ARELR
Sbjct: 479 ANNLEEPAFEEWRINALVSILFAAPEKVIELIKILFGQELSLQQRMSILSALSLAARELR 538

Query: 544 GMDDKVITKPKLDFPTSRLPWDKKTKEQHDKKRITELGNSNSTLIEXXXXXXXXXXXXXX 603
           G+DD VI K ++DFPT RLPWDK   E     +++    ++ +L++              
Sbjct: 539 GIDDSVIMKLQVDFPTKRLPWDKGKPEGMKNDKLSASVPTSKSLLQENKTTWKSKKLTTS 598

Query: 604 XED--KPNRFREYATLFFYPLAHIWLNGIDVGTFDDLFKNHFLTTLRIIYMCAHPVHDYE 661
            +D    NRFR+ A  FF+PLAH WLNGI++GT+D +FK H+LTT++++   A+P H++ 
Sbjct: 599 AKDILSENRFRKVAAKFFFPLAHGWLNGINMGTYDLMFKKHYLTTMQMVLSAAYPHHEFN 658

Query: 662 SMTQLMEQIIYQATEQGV 679
           SM Q M  I+  A +QGV
Sbjct: 659 SMCQQMAIIVQDAIDQGV 676

>CAGL0G07755g 736112..738169 similar to sp|P53038 Saccharomyces
           cerevisiae YGR099w TEL2 involved in controlling telomere
           length and position effect, hypothetical start
          Length = 685

 Score =  330 bits (845), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 232/691 (33%), Positives = 361/691 (52%), Gaps = 27/691 (3%)

Query: 1   MSDFKVLKDHPDAQVIEDVLQQLSNETDAPT-LEVCLLIIQHVIPIYPSLSKHTRDLTQS 59
           + ++K L    +   +   L  +  E D+ T ++V L +I++V+  +  + K        
Sbjct: 5   LEEYKKLTTQLEVDELVTTLDTVFQEKDSLTNIDVILTVIKYVVSHHQVMPKSVILKLNW 64

Query: 60  LVSRSFTFMSQLVNYASTVMKDKPEGKLYRNFIKEVLATQPECLHNYLIHMSSSRMEKNY 119
             + S    SQL+ + S +   + E  +Y  ++ + L +    L NYLI  + +R ++  
Sbjct: 65  FFAHSLIGFSQLIKFGSDIDAKQSEQLIYIEYVTQFLKSSTTYLQNYLIECTENRTKELI 124

Query: 120 LKTLFFGSRVFNSLGNDIDIIEYLELLRSQWKSVLDDDILIETLVLDS-------FLGEL 172
           LK  F GS VFN +   ++ +EY+ELL +Q    LD         LDS       +LG  
Sbjct: 125 LKRTFTGSTVFNFVKGKLNPLEYIELLNNQLVFALDK--------LDSRSGDFHKYLGNH 176

Query: 173 LVSSLILNPTYAMDLLFGDLFLSTETYATILNKIILNASNLDQQRLVNKFLLPYLEPLTN 232
           + S    +  +A D++    FL  +     L+  +   S   + ++  K+LLPYL+ + +
Sbjct: 177 IASLCDFHNIFAPDVILSKTFLIKQERLETLSLFMKKTSEYTRYKIGIKYLLPYLDKVCS 236

Query: 233 TSNFKSTNHILRELPLHKCITLDVILRMKSHILQEIIIRQM-SEFASSIIPSLISKFGTL 291
            +N +  +HIL  L + K I +  I R+ S  LQ+ I+  + S+   S++  L+ KF ++
Sbjct: 237 DTNAQLVHHILGTLGIGKLILVQDIFRLNSFTLQKTILAILDSKKIDSVMDFLLMKFHSI 296

Query: 292 DESQDEDICIIFVMVLKFNLNEEQREQLAHDGNFLDAITKRLSHKNSEFRERTMFIAKLA 351
           +   D + C + V +LK +LN+  + ++ H   FL+AITKRLS ++   RER+M+IAK+A
Sbjct: 297 EYESDNNTCQLIVTILKNHLNDSGKIKVCHSDQFLNAITKRLSDQDKIIRERSMYIAKIA 356

Query: 352 SNNELEYDSDFVIKL-PDLDITNNEKIEIDPALFXXXXXXXXXXXXXXXXXXFHEMVLXX 410
           SN++++Y+SDF I +   +   N E  E D +L                        L  
Sbjct: 357 SNHKIDYESDFTIDIGKSIAHENYEVPESDWSLILNSVNSNVNTNSSDTNISTSTHALEA 416

Query: 411 XXXXXXXXXXXXIINRI--VFLKDLVKEFEKNGNDGPAESIPLLKKTITLVRQKEHFPLE 468
                         +++  VFLKDL    E     G      +LK T+ LVRQK+ F  E
Sbjct: 417 LNLDDSDDEEDEEGDQLKYVFLKDLTAALENKSQRGLTN---ILKNTVKLVRQKKLFRSE 473

Query: 469 VDYYFSGLLTNIAYXXXXXXXXXXXXWRINALVSLLVVVPEKVQELIKIFLSSELSLQQR 528
           V YY   ++ NI               R+NALVS+LVVVPEK+ EL+K+  ++ELSLQQR
Sbjct: 474 VAYYAGAMIRNIVILNNDLDEKQFEELRVNALVSILVVVPEKIDELLKMLFTAELSLQQR 533

Query: 529 MSILSSLGLSARELRGMDDKVITKPKLDFPTSRLPWDKKTKEQHDKKRITELGNSNSTLI 588
           +S+L S+ +SARELRG DDK I KP+ DFPTS LPWD++     +  RI E+ ++ S   
Sbjct: 534 LSLLLSVSMSARELRGYDDKQILKPQFDFPTSMLPWDRR----QENNRIEEIDDNGSDNT 589

Query: 589 EXXXXXXXXXXXXXXXEDKPNRFREYATLFFYPLAHIWLNGIDVGTFDDLFKNHFLTTLR 648
                           E+  NRFREYA+ FFYPLA+ WLNGID+GTFD LFK ++L+TL+
Sbjct: 590 SGGKVLWKSSKLTKNTEEINNRFREYASKFFYPLANGWLNGIDLGTFDKLFKTYYLSTLK 649

Query: 649 IIYMCAHPVHDYESMTQLMEQIIYQATEQGV 679
            +Y CA+ VHD+E MT  M+ I+  A    +
Sbjct: 650 TVYNCAYLVHDFEDMTTTMDTILQDAVNNNI 680

>AAR090W [276] [Homologous to ScYGR099W (TEL2) - SH]
           complement(506082..508061) [1980 bp, 659 aa]
          Length = 659

 Score =  310 bits (793), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 228/675 (33%), Positives = 344/675 (50%), Gaps = 30/675 (4%)

Query: 4   FKVLKDHPDAQVIEDVLQQLSNETDAPTLEVCLLIIQHVIPIYPSLSKHTRDLTQSLVSR 63
           F+VL+   + +V+E VL +L     AP  E  L+++Q V+  Y SL    + + + L  +
Sbjct: 3   FQVLETTSNVEVMEQVLSELEQSPMAP--EAALVVLQRVVTAYESLPSRLQAMLRRLCGK 60

Query: 64  SFTFMSQLVNYASTVMKDKPEGKLYRNFIKEVLATQPECLHNYLIHMSSSRMEKNYLKTL 123
           S   MSQ+V  A  V + +PE  +Y+  ++E L  +P  L + L        ++  +  L
Sbjct: 61  SSVLMSQVVVAAQQV-RGRPEAGIYQRVLRETLEREPGALAHQL--AGGGPTQRRLVTAL 117

Query: 124 FFGSRVFNSLGNDIDIIEYLELLRSQWKSVLDDDILIETLVLDSFLGELLVSSLILNPTY 183
           FFGSRVFN L + +    Y+ LL  Q ++  +          D+   E+LV+ L  +PT 
Sbjct: 118 FFGSRVFNVLAHTLSAAAYVSLLTPQLQTWFEKGAGAPE---DA---EVLVALLRFHPTQ 171

Query: 184 AMDLLFGDLFLSTETYATILNKIILNASNLDQQRLVNKFLLPYLEPLTNTSNFKSTNHIL 243
           A D L  DL L  E    I  KI      + Q++LVN FLL  L  L   SN ++   +L
Sbjct: 172 AADALV-DLVL-CEVRWQIFCKICNQRVGVVQRQLVNGFLLRTLGRLVEASNVQAAYDLL 229

Query: 244 RELPLHKCITLDVILRMKSHILQEIIIRQMSEFAS-SIIPSLISKFGTLDESQDEDICII 302
             L  ++   L  + ++ S  LQ  I++ + E    +++   +  FGT D + DE  C +
Sbjct: 230 LTLD-YRLFNLLELHKVNSVHLQSAIVQVLPESGCEALLKICLGMFGTPD-TDDEKRCNL 287

Query: 303 FVMVLKFNLNEEQREQLAHDGNFLDAITKRLSHKNSEFRERTMFIAKLASNNELEYDSDF 362
           F +++   +   + E++ HD  FL A+T RL+ ++   R+RTM IAK  +   L+Y++  
Sbjct: 288 FAILIA-RMAGPELEKIVHDQQFLSAVTFRLASEDGAVRDRTMSIAKAVAGESLKYEAAH 346

Query: 363 VIKLPDLDITNNEKIEIDPALFXXXXXXXXXXXXXXXXXXFHEMVLXXXXXXXXXXXXXX 422
            IKLP   +     I  +                         + L              
Sbjct: 347 -IKLPVPPLRPKGTICFEE---ITTPRASAYVNNSAVEPQLGALTLEDSDDSDVDSDGER 402

Query: 423 IINRIVFLKDLVKEFEKN--GNDGPAESIPLLKKTITLVRQKEHFPLEVDYYFSGLLTNI 480
               IVFLKDL+ E E       GP   + LLK TI LVRQK+ F  EV +Y   +LT +
Sbjct: 403 RGREIVFLKDLLVELEAPDLSERGP---LRLLKLTIKLVRQKQAFVSEVSFYAPAMLTAV 459

Query: 481 AYXXXXXXXXXXXXWRINALVSLLVVVPEKVQELIKIFLSSELSLQQRMSILSSLGLSAR 540
           A             +RINALVSLLV VPEKV +L+ +   ++LSLQQRM+ILS+L L+AR
Sbjct: 460 ATISNSQSEQDFEEYRINALVSLLVAVPEKVTDLLHLLFQADLSLQQRMAILSALALAAR 519

Query: 541 ELRGMDDKVITKPKLDFPTSRLPW-DKKTKEQHDKKRITELGNSNSTLIEXXXXXXXXXX 599
           ELRG++DK + KP  DFPT RLP  D  ++    ++  T   +S  T+            
Sbjct: 520 ELRGLEDKYVLKPVFDFPTRRLPRNDAPSRALESRESGT---SSEGTISAHHTVWRSRKL 576

Query: 600 XXXXXEDKPNRFREYATLFFYPLAHIWLNGIDVGTFDDLFKNHFLTTLRIIYMCAHPVHD 659
                 ++PN FR++A  FF+PLAH WLNGID+GTFD LFK H+L+TLR+I   A+P  +
Sbjct: 577 DSAPAPERPNAFRKHAPAFFFPLAHAWLNGIDLGTFDALFKKHYLSTLRLILAAANPHAE 636

Query: 660 YESMTQLMEQIIYQA 674
           ++ M++LM  ++  A
Sbjct: 637 FDRMSELMSYVLQDA 651

>CAGL0A03322g 333824..335176 highly similar to sp|P53096
           Saccharomyces cerevisiae YGL194c HOS2 or sp|P32561
           Saccharomyces cerevisiae YNL330c RPD3, start by
           similarity
          Length = 450

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 2/74 (2%)

Query: 239 TNHILRELPLHKCITLDVILRMKSHILQEIIIRQMSEFASSIIPSLISKF--GTLDESQD 296
           T+H++    LHK + L    +  +  ++E        F S + P  +SK   GTL++   
Sbjct: 55  TDHLVSGYGLHKIMDLYKTRKATAEEMEEFHSEDYVNFLSKVTPENLSKLPRGTLEKFNI 114

Query: 297 EDICIIFVMVLKFN 310
            D C IF  + +++
Sbjct: 115 GDDCPIFPNIFQYS 128

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,748,928
Number of extensions: 875321
Number of successful extensions: 2763
Number of sequences better than 10.0: 20
Number of HSP's gapped: 2839
Number of HSP's successfully gapped: 25
Length of query: 686
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 578
Effective length of database: 12,857,365
Effective search space: 7431556970
Effective search space used: 7431556970
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)