Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_715.54d23223212131e-171
Scas_715.47d152323112061e-166
YER056C (FCY2)5332366903e-88
YER060W-A (FCY22)5302146642e-84
YER060W (FCY21)5282316549e-83
Scas_715.495322276522e-82
Kwal_23.58195162266399e-81
CAGL0L00671g5432236411e-80
Sklu_1893.25132316293e-79
Scas_704.365452366141e-76
Scas_715.47d5332056112e-76
CAGL0J02948g5152206041e-75
Kwal_34.157305182105869e-73
KLLA0C08283g5192205721e-70
CAGL0C00231g5402305512e-67
ADL074W5242205406e-66
CAGL0L06138g6312282432e-23
KLLA0D05060g5232072387e-23
Kwal_47.172165422172388e-23
YGL186C (TPN1)5791861982e-17
Scas_710.305841111771e-14
AFR354C1210171870.005
ADL008W69540652.1
CAGL0F06171g103571652.3
Kwal_23.396255341643.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_715.54d
         (232 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_715.54d                                                          471   e-171
Scas_715.47d1                                                         469   e-166
YER056C (FCY2) [1485] chr5 complement(266511..268112) Cytosine/p...   270   3e-88
YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine p...   260   2e-84
YER060W (FCY21) [1490] chr5 (274565..276151) Protein with simila...   256   9e-83
Scas_715.49                                                           255   2e-82
Kwal_23.5819                                                          250   9e-81
CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomy...   251   1e-80
Sklu_1893.2 YER056C, Contig c1893 1725-3266                           246   3e-79
Scas_704.36                                                           241   1e-76
Scas_715.47d                                                          239   2e-76
CAGL0J02948g 282559..284106 highly similar to sp|P40039 Saccharo...   237   1e-75
Kwal_34.15730                                                         230   9e-73
KLLA0C08283g complement(725563..727122) similar to sp|P17064 Sac...   224   1e-70
CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces cer...   216   2e-67
ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH] complement(...   212   6e-66
CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces c...    98   2e-23
KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces c...    96   7e-23
Kwal_47.17216                                                          96   8e-23
YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of ...    81   2e-17
Scas_710.30                                                            73   1e-14
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    38   0.005
ADL008W [1734] [Homologous to ScYIL005W (EPS1) - SH] complement(...    30   2.1  
CAGL0F06171g 613189..616296 similar to sp|Q02630 Saccharomyces c...    30   2.3  
Kwal_23.3962                                                           29   3.0  

>Scas_715.54d
          Length = 232

 Score =  471 bits (1213), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 232/232 (100%), Positives = 232/232 (100%)

Query: 1   VMDKLFSSFKTTDLEKQDPAFVANEAISNDTTSEDDFSKTVSSEASNIAFLQKIATRLNA 60
           VMDKLFSSFKTTDLEKQDPAFVANEAISNDTTSEDDFSKTVSSEASNIAFLQKIATRLNA
Sbjct: 1   VMDKLFSSFKTTDLEKQDPAFVANEAISNDTTSEDDFSKTVSSEASNIAFLQKIATRLNA 60

Query: 61  ETRGIEPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFN 120
           ETRGIEPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFN
Sbjct: 61  ETRGIEPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFN 120

Query: 121 IIGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLL 180
           IIGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLL
Sbjct: 121 IIGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLL 180

Query: 181 NMVNLHGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232
           NMVNLHGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI
Sbjct: 181 NMVNLHGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232

>Scas_715.47d1
          Length = 523

 Score =  469 bits (1206), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 230/231 (99%), Positives = 230/231 (99%)

Query: 2   MDKLFSSFKTTDLEKQDPAFVANEAISNDTTSEDDFSKTVSSEASNIAFLQKIATRLNAE 61
           MDKLFSSFKTTDLEKQDPAFVANEAISNDTT EDDFSKTVSSEASNIAFLQKIATRLNAE
Sbjct: 1   MDKLFSSFKTTDLEKQDPAFVANEAISNDTTGEDDFSKTVSSEASNIAFLQKIATRLNAE 60

Query: 62  TRGIEPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNI 121
           TRGIEPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNI
Sbjct: 61  TRGIEPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNI 120

Query: 122 IGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLN 181
           IGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLN
Sbjct: 121 IGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLN 180

Query: 182 MVNLHGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232
           MVNLHGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI
Sbjct: 181 MVNLHGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 231

>YER056C (FCY2) [1485] chr5 complement(266511..268112)
           Cytosine/purine permease, member of the purine/cytosine
           permease family of membrane transporters [1602 bp, 533
           aa]
          Length = 533

 Score =  270 bits (690), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 136/236 (57%), Positives = 173/236 (73%), Gaps = 14/236 (5%)

Query: 9   FKTTDLEKQDPAFVANEAISND----------TTSEDDFSKTV-SSEASNIAFLQKIATR 57
           ++  DLEK+ P  V   ++ N+           TSEDD    V SSEA+ +++  K    
Sbjct: 9   YEIQDLEKRSP--VIGSSLENEKKVAASETFTATSEDDQQYIVESSEATKLSWFHKFFAS 66

Query: 58  LNAETRGIEPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIV 117
           LNAET+G+EPV +DEKTD +I N   +WFSAN VI++YA+GALGPMVFGLNFG + L I+
Sbjct: 67  LNAETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVII 126

Query: 118 FFNIIGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSA 177
           FFNI+G++ VA+FS+FG ELGLRQM+LSRYLVGN+  R FS IN IACVGW ++N+  SA
Sbjct: 127 FFNIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSA 186

Query: 178 QLLNMVNL-HGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232
           QLLNMVN   GH CP WAG ++++ GT+LVTFFG  VI A+E+WSWVPN AVFLVI
Sbjct: 187 QLLNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVI 242

>YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine
           permease with similarity to Fcy2p, member of the
           purine/cytosine subfamily of the nucleobase:cation
           symporter-1 (NCS1) family [1593 bp, 530 aa]
          Length = 530

 Score =  260 bits (664), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 128/214 (59%), Positives = 157/214 (73%), Gaps = 7/214 (3%)

Query: 26  AISNDTTSEDDFSKTVSSEASN------IAFLQKIATRLNAETRGIEPVRDDEKTDANIW 79
           A+   +++ D + + V    +N       +F  +IA  LNAET+GIEPV +DEK D +I 
Sbjct: 26  ALDTKSSAADVYYEGVELHRTNEFIDNKPSFFNRIAAALNAETKGIEPVTEDEKNDDSIL 85

Query: 80  NPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVVPVAYFSLFGPELGL 139
           N   +WFSAN VI AY+VGALGP+VFGLNFG + L I+FFNI+G++PVA FSLFG ELGL
Sbjct: 86  NAATIWFSANMVIVAYSVGALGPLVFGLNFGQSVLVIIFFNILGLIPVALFSLFGVELGL 145

Query: 140 RQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNL-HGHRCPFWAGIMV 198
           RQM+LSRYL GNI  RFFS +N IACVGWCVLN   SAQLLNMVN   GH CP WAG ++
Sbjct: 146 RQMILSRYLAGNITARFFSLVNVIACVGWCVLNISVSAQLLNMVNEGSGHNCPIWAGCLI 205

Query: 199 VVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232
           +  GT+LVTFFG  V+ A+E+WSWVPN A FLVI
Sbjct: 206 IAGGTVLVTFFGYSVVHAYEKWSWVPNFAAFLVI 239

>YER060W (FCY21) [1490] chr5 (274565..276151) Protein with
           similarity to Fcy2p, member of the purine/cytosine
           family of secondary active transporters [1587 bp, 528
           aa]
          Length = 528

 Score =  256 bits (654), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 166/231 (71%), Gaps = 7/231 (3%)

Query: 8   SFKTTDLEKQDPAFVANEAISNDTTSEDDFSKTVSSEAS------NIAFLQKIATRLNAE 61
           S   T   K +   + + A    T S ++F   V S  +       ++FL +IA  L+AE
Sbjct: 8   SLNGTQYLKYELKDLESRAHDAKTPSTNEFYDDVESHGTEELVEAKLSFLNRIAAGLSAE 67

Query: 62  TRGIEPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNI 121
           T+GIEP+ +DEKTD +I N   +WFSAN V+ AYA+GALGPMVF LNFG +   I+FFN+
Sbjct: 68  TKGIEPITEDEKTDDSILNAASMWFSANMVLPAYAIGALGPMVFDLNFGQSVFVIIFFNL 127

Query: 122 IGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLN 181
           +G+V VA+FS+FG ELGLRQM+LSRYLVGNI  R FSFIN IAC+GW ++N++ S+Q+LN
Sbjct: 128 LGLVSVAFFSVFGAELGLRQMILSRYLVGNIAARIFSFINFIACIGWGIVNTVASSQVLN 187

Query: 182 MVNLHGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232
           MVN  GH+CP WAG +V++  T++VTFFG  VI A+E+W+WVPN AVFLVI
Sbjct: 188 MVN-PGHQCPLWAGCIVIIGATVIVTFFGYGVIHAYEKWAWVPNFAVFLVI 237

>Scas_715.49
          Length = 532

 Score =  255 bits (652), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 167/227 (73%), Gaps = 1/227 (0%)

Query: 7   SSFKTTDLEKQDPAFVA-NEAISNDTTSEDDFSKTVSSEASNIAFLQKIATRLNAETRGI 65
           SS++  DLE+      + ++ +S+D   + D   +     + +    +IA  L+AET+GI
Sbjct: 15  SSYEMNDLERNSKDLKSPSKNLSSDYYVDIDSHASEEVLETKLNLFNRIAAGLSAETKGI 74

Query: 66  EPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVV 125
           EP+ D+EK DA++ N   +WFSAN VI+AYA+G LGP+VFGLNFG ++L I+FFNI+G++
Sbjct: 75  EPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIFFNILGLL 134

Query: 126 PVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNL 185
           PVA+FS+FG +LGLRQMVLSR+L+GN   R FS IN +ACVGW ++N++ S+QLLNMVN 
Sbjct: 135 PVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQLLNMVNQ 194

Query: 186 HGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232
             H+CP WAG +V++  TIL+TFFG +VI +FE+W WVPN A FLVI
Sbjct: 195 GPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVI 241

>Kwal_23.5819
          Length = 516

 Score =  250 bits (639), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 164/226 (72%), Gaps = 4/226 (1%)

Query: 8   SFKTTDLEKQDPAFVANEAISNDTTSEDDFSKTV-SSEASNIAFLQKIATRLNAETRGIE 66
           S +  + E QD   V     S    S+DD    V S+E + ++ + +IA  L AET+GIE
Sbjct: 2   SLQKEEYEIQD---VEKRLNSRFEISDDDSQPVVESTEYTKLSIVDRIAASLRAETKGIE 58

Query: 67  PVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVVP 126
           PV ++EK D +IWN   +WFSAN VI+A+++G LGP+V+GLNF    L +V F+ +GV+P
Sbjct: 59  PVTEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIP 118

Query: 127 VAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNLH 186
           VAY+S+FG ELGLRQMVLSR+L+GN+  R F+ IN IACVGW  +N+I SAQLL+M+N  
Sbjct: 119 VAYYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPG 178

Query: 187 GHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232
           G RCP WAG +++VL TILVTFFG +VI A+E+WSW+PN AVFLVI
Sbjct: 179 GARCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVI 224

>CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomyces
           cerevisiae YER056c FCY2 purine-cytosine permease or
           sp|P40039 Saccharomyces cerevisiae YER060w FCY21,
           hypothetical start
          Length = 543

 Score =  251 bits (641), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 164/223 (73%), Gaps = 5/223 (2%)

Query: 10  KTTDLEKQDPAFVANEAISNDTTSEDDFSKTVSSEASNIAFLQKIATRLNAETRGIEPVR 69
           KTT++   D  +   +  +N + +      TV      + F+ ++A ++NAET+G+EPV 
Sbjct: 35  KTTNVNTNDFEYDYGDDFTNSSEA-----ATVEETKLKLGFISRLALKMNAETKGVEPVT 89

Query: 70  DDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVVPVAY 129
           D+EKTD ++ N   +WFSAN V+++YA+GALGP+VF LNFG + LTIVFFN+IG+V VA+
Sbjct: 90  DEEKTDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTSVLTIVFFNMIGLVSVAF 149

Query: 130 FSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNLHGHR 189
           FS+FG E GLRQM+LSR+LVGN+  R F+ IN +ACVGW V+N++ +AQLL++VN   H+
Sbjct: 150 FSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVNTVVAAQLLHIVNQGSHQ 209

Query: 190 CPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232
            P W G +V+V GT++VTFFG  +I A+ERWSWVPN AVFLVI
Sbjct: 210 LPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVI 252

>Sklu_1893.2 YER056C, Contig c1893 1725-3266
          Length = 513

 Score =  246 bits (629), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 161/231 (69%), Gaps = 9/231 (3%)

Query: 2   MDKLFSSFKTTDLEKQDPAFVANEAISNDTTSEDDFSKTVSSEASNIAFLQKIATRLNAE 61
           M      +   D+EKQ+P          + T  D      S+E + ++F+ + A +L AE
Sbjct: 1   MSSSKEEYAIQDMEKQNPL---------ELTETDSTPVVESTEYTTVSFIDRWAAKLKAE 51

Query: 62  TRGIEPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNI 121
           T+GIEP+ D+EK D +I N   +WFSAN VI+AYA+G LG  VFGLNF  + LTI+FF+ 
Sbjct: 52  TKGIEPITDEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSF 111

Query: 122 IGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLN 181
           +G++PVA+FS+FG ELG+RQMVLSR+L+GN+  R F+ IN IACVGW  +N+I SA LL+
Sbjct: 112 LGLIPVAFFSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLH 171

Query: 182 MVNLHGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232
           M+N  G +CP WA  +++V  TI+VTFFG +VI A+E+WSWVPN AVFLVI
Sbjct: 172 MINPGGAQCPPWAACLIIVFSTIIVTFFGYRVIHAYEKWSWVPNFAVFLVI 222

>Scas_704.36
          Length = 545

 Score =  241 bits (614), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 162/236 (68%), Gaps = 14/236 (5%)

Query: 10  KTTDLEKQ---------DPAFVANEAISNDTTSEDDFSKTVSSEA----SNIAFLQKIAT 56
           + TDLE++         + A  A+  +       D++      E     + ++F  +   
Sbjct: 20  RNTDLERETGYEMNSFGEKASSADIKVIPGVPDYDEYESIQEPETYMEETKLSFFNRFVA 79

Query: 57  RLNAETRGIEPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTI 116
            LNAET+G+EPV D+EKTD +I N   +WFSAN VI++YA+G LGP+VF LNFG + L I
Sbjct: 80  SLNAETKGVEPVTDEEKTDDSIINAASMWFSANLVIASYALGGLGPIVFNLNFGTSVLVI 139

Query: 117 VFFNIIGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICS 176
           +FFNI+G++ +A+FS+FG E GLRQM+LSRYL+GNI  R F+ IN IACVGW V+N++ S
Sbjct: 140 IFFNILGLLSIAFFSVFGAEFGLRQMILSRYLLGNITARIFAIINIIACVGWGVVNTVAS 199

Query: 177 AQLLNMVNLHGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232
           +QLLNMVN   + CP WAG +++V  T+LVTFFG  VI A+E+WSWVPN AVFLVI
Sbjct: 200 SQLLNMVNTP-NNCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPNFAVFLVI 254

>Scas_715.47d
          Length = 533

 Score =  239 bits (611), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 114/205 (55%), Positives = 151/205 (73%), Gaps = 3/205 (1%)

Query: 28  SNDTTSEDDFSKTVSSEASNIAFLQKIATRLNAETRGIEPVRDDEKTDANIWNPCMLWFS 87
           SN+  S   F +      S  +F  ++A++LNAET+GIE + D+EKTD +I +   +WFS
Sbjct: 41  SNEPAS---FIEITEETGSKFSFFNRLASQLNAETKGIERITDEEKTDGSILDATSMWFS 97

Query: 88  ANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVVPVAYFSLFGPELGLRQMVLSRY 147
           AN VISAY +G +GP+V+GLNFG   LTI+FF+I+G++PVA+FS+FG + GLRQMVLSR+
Sbjct: 98  ANMVISAYTLGGIGPLVYGLNFGTCVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRF 157

Query: 148 LVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNLHGHRCPFWAGIMVVVLGTILVT 207
           L+GN   R  + IN I+ VGW V+NS+ S+QLLNMVN   H CP WAG ++++  TILVT
Sbjct: 158 LIGNSTARIIAVINVISSVGWGVVNSVASSQLLNMVNQGHHSCPLWAGCVIIIGATILVT 217

Query: 208 FFGIKVITAFERWSWVPNLAVFLVI 232
           FFG   I A+ERWSWVPN AVFLVI
Sbjct: 218 FFGYSYIHAYERWSWVPNFAVFLVI 242

>CAGL0J02948g 282559..284106 highly similar to sp|P40039
           Saccharomyces cerevisiae YER060w or sp|P17064
           Saccharomyces cerevisiae YER056c FCY2, hypothetical
           start
          Length = 515

 Score =  237 bits (604), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 112/220 (50%), Positives = 157/220 (71%), Gaps = 7/220 (3%)

Query: 13  DLEKQDPAFVANEAISNDTTSEDDFSKTVSSEASNIAFLQKIATRLNAETRGIEPVRDDE 72
           D+E Q       E+ +N     D ++     E + ++ L ++A  ++AET+GIEP+ DDE
Sbjct: 11  DMEMQV------ESSANSHVETDGYNDATVLE-TKLSLLNRLAAMISAETKGIEPITDDE 63

Query: 73  KTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVVPVAYFSL 132
           K D ++ N   +WFSAN V+ A A+G LGP+VFGLNFG++ LTIVFFNI+G+  VA+FS+
Sbjct: 64  KNDDSLINAASMWFSANMVLPALAIGGLGPLVFGLNFGVSVLTIVFFNILGLFAVAFFSV 123

Query: 133 FGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNLHGHRCPF 192
           FG + GLRQMVLSRYLVGNI  R F+ IN +ACVGW ++N++ ++QLLN +N   H+ P 
Sbjct: 124 FGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGSHQLPL 183

Query: 193 WAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232
           W G +V++  TILV+FFG KVI  +E++SWVPN AVFLV+
Sbjct: 184 WGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVL 223

>Kwal_34.15730
          Length = 518

 Score =  230 bits (586), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 150/210 (71%), Gaps = 5/210 (2%)

Query: 28  SNDTTSEDDFSKTVSS-----EASNIAFLQKIATRLNAETRGIEPVRDDEKTDANIWNPC 82
           S + TS DD ++  S          +A L ++A +L AET+GIEPV +DEK D++IWN  
Sbjct: 17  SQENTSADDATRGSSQAPEKLNGGGMAVLNRLAKKLRAETKGIEPVTEDEKDDSSIWNAA 76

Query: 83  MLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVVPVAYFSLFGPELGLRQM 142
            +WFSAN VI+A++VG LGP+VF LNF    ++IV F  IGV+PV  +S+FG +L LRQM
Sbjct: 77  FVWFSANMVIAAFSVGMLGPLVFSLNFWGCVVSIVIFTFIGVLPVCLYSVFGVQLSLRQM 136

Query: 143 VLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNLHGHRCPFWAGIMVVVLG 202
           VLSR+L+GN+  R F+ IN IAC+GW V+N++ SAQLL+M+N  G RCP WAG +++V  
Sbjct: 137 VLSRFLLGNVTARIFALINVIACIGWGVVNTVTSAQLLHMINPTGGRCPPWAGCLIIVFS 196

Query: 203 TILVTFFGIKVITAFERWSWVPNLAVFLVI 232
           TI VTFFG +VI  F ++SW+PN  VF+VI
Sbjct: 197 TIFVTFFGYRVIHTFGKYSWIPNFIVFIVI 226

>KLLA0C08283g complement(725563..727122) similar to sp|P17064
           Saccharomyces cerevisiae YER056c FCY2 purine-cytosine
           permease, start by similarity
          Length = 519

 Score =  224 bits (572), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 114/220 (51%), Positives = 161/220 (73%), Gaps = 5/220 (2%)

Query: 13  DLEKQDPAFVANEAISNDTTSEDDFSKTVSSEASNIAFLQKIATRLNAETRGIEPVRDDE 72
           D+EKQ+ +         D   E++     ++E + ++++  +A++L+AET+GIEP+ DDE
Sbjct: 14  DVEKQELS-----KTQFDEVLEEEPVIVETTEVTKLSWVDHLASKLHAETKGIEPITDDE 68

Query: 73  KTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVVPVAYFSL 132
           K D +I N   +W SAN VI+A+++G +G  VFGLNFG   L IVFF+ +G++PVA+FS+
Sbjct: 69  KDDDDILNAASMWLSANLVIAAFSLGCIGTSVFGLNFGEAVLVIVFFSFLGLLPVAFFSV 128

Query: 133 FGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNLHGHRCPF 192
           FG ELGLRQ+VLSR+L+GN+  R F FIN IACVGW  +N+I SA LL++VN  G  CP 
Sbjct: 129 FGAELGLRQLVLSRFLLGNVTARIFCFINIIACVGWGAVNTIASASLLHIVNPSGPDCPP 188

Query: 193 WAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232
           WAG ++++ GTI+VTFFG +VI A+E+WSWVPN AVFLVI
Sbjct: 189 WAGCLIIIFGTIIVTFFGYRVIHAYEKWSWVPNFAVFLVI 228

>CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces
           cerevisiae YER060w or sp|P17064 Saccharomyces cerevisiae
           YER056c, hypothetical start
          Length = 540

 Score =  216 bits (551), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 107/230 (46%), Positives = 152/230 (66%), Gaps = 5/230 (2%)

Query: 1   VMDKLFSSFKTTDLEKQDPAFVANEAISNDTTSEDDFSKTVSSEASNIAFLQKIATRLNA 60
           V D+L ++    DLE +D  F       ++ ++E D  +T         F+  +   LNA
Sbjct: 23  VTDRLGNN-HYEDLELKDITFKEKFNELDNKSTETDKDETCFKSP----FIIWLKRTLNA 77

Query: 61  ETRGIEPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFN 120
           ET+G+EP+ ++EK D NI+    +WFSAN V++AY VG+LGP V+ LNF I+ LTIVFFN
Sbjct: 78  ETKGVEPINENEKNDTNIFGSSFVWFSANLVLAAYGVGSLGPTVYHLNFAISVLTIVFFN 137

Query: 121 IIGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLL 180
           I+G+V V++FS+FG ELGLRQM++SRYLVGN+  R F+ +NCI CVGW VLN   +A+L 
Sbjct: 138 ILGLVSVSFFSVFGAELGLRQMIISRYLVGNVTARIFAALNCIGCVGWDVLNIYLAAKLF 197

Query: 181 NMVNLHGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFL 230
            ++   G+  P W G +V+V  T+ +   G K I  +E+WSW+PNLAVFL
Sbjct: 198 AIIKTGGNHLPLWGGCIVIVGSTVFIAALGYKFIHIYEKWSWIPNLAVFL 247

>ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH]
           complement(551981..553555) [1575 bp, 524 aa]
          Length = 524

 Score =  212 bits (540), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 107/220 (48%), Positives = 148/220 (67%), Gaps = 8/220 (3%)

Query: 13  DLEKQDPAFVANEAISNDTTSEDDFSKTVSSEASNIAFLQKIATRLNAETRGIEPVRDDE 72
           DLEK+   F+++       T + D      +E + ++++ + A RLNAET+G+ PV +DE
Sbjct: 25  DLEKKK-GFLSDA--EEPVTPQVD-----ETEYTTLSWVNRWAARLNAETKGVSPVTEDE 76

Query: 73  KTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVVPVAYFSL 132
             D+++ N   +WFSAN VI+A+AVG L   VF LN     L  V F+ +GV+ VA+FS+
Sbjct: 77  CHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVAFFSV 136

Query: 133 FGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNLHGHRCPF 192
           FG E GLRQM+LSRYL+GN   R F  IN IACVGW  +N+I S  LL+M+N  G RCP 
Sbjct: 137 FGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLHMINPTGARCPP 196

Query: 193 WAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232
           WA  +++VL T+ +TFFG +VI A+E+WSWVPNL VFL+I
Sbjct: 197 WAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLII 236

>CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, start by similarity
          Length = 631

 Score = 98.2 bits (243), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/228 (29%), Positives = 114/228 (50%), Gaps = 10/228 (4%)

Query: 13  DLEKQDPAFVANEAISNDTTSE----DDFSKTVSSEASNIAFLQKIATRLNA---ETRGI 65
           DLEK+       ++ +N    +    D     ++     +A+L  ++ +L++   ET GI
Sbjct: 35  DLEKRSTHKTDPDSRTNRRNKKLFDLDRHDPNLNIFMKGLAYLLWLSDKLDSFGVETSGI 94

Query: 66  EPVRDDEK-TDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGV 124
           E V   E+ T     +   LW SA   +S+ +   LGP++F L+F     + +    +G 
Sbjct: 95  ERVPPYERGTKKQFLHVAGLWLSATGGLSSMSSFLLGPLLFELSFQQALTSSMISVTVGC 154

Query: 125 VPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVN 184
           +  AY S+ GP+ G RQMV +RYL G    +F +    I  +GW V NS+   ++L  ++
Sbjct: 155 LVAAYCSIMGPQSGCRQMVTARYLFGWWFVKFVALAAIIGVMGWSVTNSVVGGEMLAAIS 214

Query: 185 LHGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232
               R P W GI++V + + +V  FGIK +   E +  VP L  FL++
Sbjct: 215 --NDRVPLWVGIVIVTVCSFVVAIFGIKQVLRIETYISVPVLTSFLLL 260

>KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, hypothetical start
          Length = 523

 Score = 96.3 bits (238), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 108/207 (52%), Gaps = 13/207 (6%)

Query: 30  DTTSEDDFSKTVSSEASNIAFLQKIATRLNA---ETRGIEPVRDDEK-TDANIWNPCMLW 85
           + T    F ++ SS       +++ + +L+A   E RGI+ ++  E+ T    W+   LW
Sbjct: 7   EVTERSIFVRSASS-------IRQFSDKLDALGVEARGIQRIQPYERGTAKQFWHVAGLW 59

Query: 86  FSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVVPVAYFSLFGPELGLRQMVLS 145
            SA   +S+ +   LGPMVF L F    ++ +    IG    AY S+ GP+ G RQ+V +
Sbjct: 60  LSAAGGLSSMSSYFLGPMVFQLTFNQCLVSGLISMWIGCGVAAYCSVMGPQSGCRQIVTA 119

Query: 146 RYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNLHGHRCPFWAGIMVVVLGTIL 205
           RYL G    +F +    +  +GW ++N +   Q+L  V+    + P W GI++V + ++L
Sbjct: 120 RYLFGWWFVKFIALAAIVGVMGWSIVNCVVGGQMLASVS--DGKVPLWVGIIIVTVVSLL 177

Query: 206 VTFFGIKVITAFERWSWVPNLAVFLVI 232
           V+ FGIK +   E    VP L  FL++
Sbjct: 178 VSIFGIKQVLKVETLFAVPVLTSFLLL 204

>Kwal_47.17216
          Length = 542

 Score = 96.3 bits (238), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 107/217 (49%), Gaps = 4/217 (1%)

Query: 18  DPAFVANEAISNDTTSEDDFSKTVSSEASN-IAFLQKIATRLNAETRGIEPVRDDEK-TD 75
           +P  V +   S    S  + ++TV  +  N ++   K    L  E RGI+ +   E+ T 
Sbjct: 2   EPEKVDDVVFSETEKSRGEGNQTVFGKVLNKLSVASKRLDALGVEIRGIQRIPAYERGTS 61

Query: 76  ANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVVPVAYFSLFGP 135
               +   LW SA   +S+ +   LGP++F L F  + ++ +    IG    AY S  GP
Sbjct: 62  KQFLSVAGLWLSAAGGLSSMSSYFLGPLLFELTFRQSLVSGLVSMAIGCAVAAYLSTMGP 121

Query: 136 ELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNLHGHRCPFWAG 195
           + G RQMV +RYL G    +F S  + I  +GW ++N +   Q+L  ++    + P W G
Sbjct: 122 QSGCRQMVTARYLFGWYFVKFVSLASIIGVMGWSIVNCVVGGQMLAAIS--NSKIPLWVG 179

Query: 196 IMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232
           I++V   + +V  FGIK +   E +  VP L  FL++
Sbjct: 180 IIIVTAVSFIVAIFGIKQVLRVETFLSVPVLTCFLLL 216

>YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of the
           purine/cytosine permease family of membrane transporters
           [1740 bp, 579 aa]
          Length = 579

 Score = 80.9 bits (198), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/186 (31%), Positives = 99/186 (53%), Gaps = 4/186 (2%)

Query: 49  AFLQKIATRLNAETRGIEPVRDDEK--TDANIWNPCMLWFSANFVISAYAVGALGPMVFG 106
           A+L K    +  E+ GI+ +   E+  +     +   LW SA   +S+ +   LGP++FG
Sbjct: 57  AWLSKKVDAMGVESTGIQRISPYERGTSKKQFLHVAGLWLSATGGLSSMSSFLLGPLLFG 116

Query: 107 LNFGITSLTIVFFNIIGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACV 166
           L+F  +  + +    IG +  AY S+ GP+ G RQMV +RYL G    +  +  + I  +
Sbjct: 117 LSFRESVASSLISVTIGCLIAAYCSIMGPQSGCRQMVTARYLFGWWFVKLVALASIIGVM 176

Query: 167 GWCVLNSICSAQLLNMVNLHGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNL 226
           GW V+NS+   ++L  ++    + P W GI++V + + LV  FGIK +   E +  VP L
Sbjct: 177 GWSVVNSVVGGEMLAAIS--NDKVPLWVGIVIVTVCSFLVAIFGIKQVIKVETYLSVPVL 234

Query: 227 AVFLVI 232
             FL++
Sbjct: 235 TAFLLL 240

>Scas_710.30
          Length = 584

 Score = 72.8 bits (177), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 63/111 (56%), Gaps = 2/111 (1%)

Query: 122 IGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLN 181
           IG +  AY S+ GP+ G RQMV +RYL G    +F +    I  +GW V+NS+   ++L 
Sbjct: 109 IGCLVAAYCSIMGPQSGCRQMVTARYLFGWWFVKFVALAAIIGVMGWSVVNSVVGGEML- 167

Query: 182 MVNLHGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232
             ++   + P W G+++V L + LV  FGIK +   E +  +P   +F+++
Sbjct: 168 -ASISNDKVPLWVGVLIVTLFSFLVAVFGIKQVLKVETYLSIPVWLMFILL 217

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
            (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 79/171 (46%), Gaps = 24/171 (14%)

Query: 7    SSFKTTDLEKQDPAFVANEAIS--NDTTSEDDFSKTVSSEASNIAFLQKIATRLNAETRG 64
            S+ K TD  KQ PA VA   +S  ND+ S+D  +  +   +    F  K+A  ++A T  
Sbjct: 920  STVKRTDPSKQSPADVAAMMLSGLNDSESDDAPTLKLGDASCAAPFTSKLAN-VSAVTNI 978

Query: 65   IEPVRDDEKTDANIWNPCMLW--FSANFVISAYAVGALGPMVFGLNFGITS-------LT 115
            I   R        + N   ++   + N +I+AY++  +   + G+ FG          +T
Sbjct: 979  IRQGR------CALINTIQMYKILALNCLITAYSLSVI--YLAGVKFGDVQATVSGLLIT 1030

Query: 116  IVFFNIIGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACV 166
            + F +I    P+   S   P+ G    + + Y++G+I+G+F   I  +A +
Sbjct: 1031 VCFLSISRGQPLEKLSKERPQPG----IFNVYIMGSILGQFAVHIAALAYI 1077

>ADL008W [1734] [Homologous to ScYIL005W (EPS1) - SH]
           complement(694508..696595) [2088 bp, 695 aa]
          Length = 695

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 3/40 (7%)

Query: 135 PELGLRQMVLSRYLVGNIVG---RFFSFINCIACVGWCVL 171
           PE G  +  L R+LVG+  G   RFF  I+    +GW +L
Sbjct: 615 PESGKSRNDLRRFLVGSPFGPRWRFFEHIHQYGFLGWFLL 654

>CAGL0F06171g 613189..616296 similar to sp|Q02630 Saccharomyces
           cerevisiae YMR047c NUP116 nuclear pore protein, start by
           similarity
          Length = 1035

 Score = 29.6 bits (65), Expect = 2.3,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 6/71 (8%)

Query: 10  KTTDLEKQDPAFVANEAISNDTTSEDDFSKTVSSEASNIAFLQKIATRLNAETRGIEPVR 69
           +  DL+ ++  F+AN A SN   ++ D +K   +E + +   Q +AT L +  R  E   
Sbjct: 808 RNKDLKSKEKLFIANVADSNLNEADKDKAK---NEIAKLNASQVVATTLASSVRETE--- 861

Query: 70  DDEKTDANIWN 80
             EK + +I N
Sbjct: 862 KQEKIETDICN 872

>Kwal_23.3962
          Length = 553

 Score = 29.3 bits (64), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%)

Query: 34 EDDFSKTVSSEASNIAFLQKIATRLNAETRGIEPVRDDEKT 74
          E+ + K  S++ASNI++ +K+ + L  E + ++  RD  KT
Sbjct: 25 EEVYDKFQSTDASNISYREKLESDLKREIKKLQKHRDQIKT 65

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.328    0.140    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,025,211
Number of extensions: 273630
Number of successful extensions: 1260
Number of sequences better than 10.0: 33
Number of HSP's gapped: 1250
Number of HSP's successfully gapped: 34
Length of query: 232
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 134
Effective length of database: 13,203,545
Effective search space: 1769275030
Effective search space used: 1769275030
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 60 (27.7 bits)