Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_715.54*125944922e-65
Scas_704.33*124944923e-65
CAGL0M12408g128944455e-58
YIL052C (RPL34B)121944202e-54
YER056C-A (RPL34A)121944184e-54
ADL078C126944133e-53
KLLA0C08371g125944046e-52
Kwal_23.579969381559e-15
Scas_20.1*59211034e-07
AER299C51258670.38
KLLA0C14278g54144650.59
Scas_430.144649650.59
CAGL0I07205g60334602.8
ADR374C164056593.8
KLLA0F13772g52038585.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_715.54*
         (125 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_715.54*                                                          194   2e-65
Scas_704.33*                                                          194   3e-65
CAGL0M12408g join(1236607..1236643,1237307..1237656) highly simi...   176   5e-58
YIL052C (RPL34B) [2615] chr9 complement(256224..256552,257025..2...   166   2e-54
YER056C-A (RPL34A) [1486] chr5 complement(269421..269749,270147....   165   4e-54
ADL078C [1663] [Homologous to ScYIL052C (RPL34B) - SH; ScYER056C...   163   3e-53
KLLA0C08371g join(732878..732914,733482..733822) highly similar ...   160   6e-52
Kwal_23.5799                                                           64   9e-15
Scas_20.1*                                                             44   4e-07
AER299C [2801] [Homologous to ScYHR170W (NMD3) - SH] (1186065..1...    30   0.38 
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    30   0.59 
Scas_430.1                                                             30   0.59 
CAGL0I07205g 694434..696245 similar to tr|Q12242 Saccharomyces c...    28   2.8  
ADR374C [2115] [Homologous to ScYOR341W (RPA190) - SH] (1372612....    27   3.8  
KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305 Saccha...    27   5.7  

>Scas_715.54*
          Length = 125

 Score =  194 bits (492), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 94/94 (100%), Positives = 94/94 (100%)

Query: 1  MAQRVTFRRRNPCNTKSNKIKVVKTPGGILRAQHVKKQASRPKCGDCGIPLPGVAALRPR 60
          MAQRVTFRRRNPCNTKSNKIKVVKTPGGILRAQHVKKQASRPKCGDCGIPLPGVAALRPR
Sbjct: 1  MAQRVTFRRRNPCNTKSNKIKVVKTPGGILRAQHVKKQASRPKCGDCGIPLPGVAALRPR 60

Query: 61 QYASISKTSKTVSRVYGGSRCSNCVKERIVRAFL 94
          QYASISKTSKTVSRVYGGSRCSNCVKERIVRAFL
Sbjct: 61 QYASISKTSKTVSRVYGGSRCSNCVKERIVRAFL 94

>Scas_704.33*
          Length = 124

 Score =  194 bits (492), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 94/94 (100%), Positives = 94/94 (100%)

Query: 1  MAQRVTFRRRNPCNTKSNKIKVVKTPGGILRAQHVKKQASRPKCGDCGIPLPGVAALRPR 60
          MAQRVTFRRRNPCNTKSNKIKVVKTPGGILRAQHVKKQASRPKCGDCGIPLPGVAALRPR
Sbjct: 1  MAQRVTFRRRNPCNTKSNKIKVVKTPGGILRAQHVKKQASRPKCGDCGIPLPGVAALRPR 60

Query: 61 QYASISKTSKTVSRVYGGSRCSNCVKERIVRAFL 94
          QYASISKTSKTVSRVYGGSRCSNCVKERIVRAFL
Sbjct: 61 QYASISKTSKTVSRVYGGSRCSNCVKERIVRAFL 94

>CAGL0M12408g join(1236607..1236643,1237307..1237656) highly
          similar to sp|P40525 Saccharomyces cerevisiae YIL052c
          RPL34B or sp|P87262 Saccharomyces cerevisiae YER056BC
          RPL34A
          Length = 128

 Score =  176 bits (445), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 89/94 (94%)

Query: 1  MAQRVTFRRRNPCNTKSNKIKVVKTPGGILRAQHVKKQASRPKCGDCGIPLPGVAALRPR 60
          MAQRVTFRRRNP NT+SNKIKVVKTPGGILRAQHVKK A+RPKCGDCGI LPG+A LRPR
Sbjct: 1  MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGIALPGIATLRPR 60

Query: 61 QYASISKTSKTVSRVYGGSRCSNCVKERIVRAFL 94
          QYASISKT KTVSRVYGGSRC+NCVKERIVRAFL
Sbjct: 61 QYASISKTHKTVSRVYGGSRCANCVKERIVRAFL 94

>YIL052C (RPL34B) [2615] chr9
          complement(256224..256552,257025..257061) Ribosomal
          protein L34 (rat L34), nearly identical to Rpl34Ap [366
          bp, 121 aa]
          Length = 121

 Score =  166 bits (420), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 86/94 (91%)

Query: 1  MAQRVTFRRRNPCNTKSNKIKVVKTPGGILRAQHVKKQASRPKCGDCGIPLPGVAALRPR 60
          MAQRVTFRRRNP NT+SNKIKVVKTPGGILRAQHVKK A+RPKCGDCG  L G++ LRPR
Sbjct: 1  MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR 60

Query: 61 QYASISKTSKTVSRVYGGSRCSNCVKERIVRAFL 94
          QYA++SKT KTVSR YGGSRC+NCVKERIVRAFL
Sbjct: 61 QYATVSKTHKTVSRAYGGSRCANCVKERIVRAFL 94

>YER056C-A (RPL34A) [1486] chr5
          complement(269421..269749,270147..270183) Ribosomal
          protein L34 (rat L34), nearly identical to Rpl34Bp [366
          bp, 121 aa]
          Length = 121

 Score =  165 bits (418), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 78/94 (82%), Positives = 86/94 (91%)

Query: 1  MAQRVTFRRRNPCNTKSNKIKVVKTPGGILRAQHVKKQASRPKCGDCGIPLPGVAALRPR 60
          MAQRVTFRRRNP NT+SNKIKVVKTPGGILRAQHVKK A+RPKCGDCG  L G++ LRPR
Sbjct: 1  MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR 60

Query: 61 QYASISKTSKTVSRVYGGSRCSNCVKERIVRAFL 94
          QYA++SKT KTVSR YGGSRC+NCVKERI+RAFL
Sbjct: 61 QYATVSKTHKTVSRAYGGSRCANCVKERIIRAFL 94

>ADL078C [1663] [Homologous to ScYIL052C (RPL34B) - SH;
          ScYER056C-A (RPL34A) - SH]
          (548697..549040,549209..549245) [381 bp, 126 aa]
          Length = 126

 Score =  163 bits (413), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 78/94 (82%), Positives = 87/94 (92%)

Query: 1  MAQRVTFRRRNPCNTKSNKIKVVKTPGGILRAQHVKKQASRPKCGDCGIPLPGVAALRPR 60
          MAQRVTFRRRNP NTK+NKIKVVKTPGG+LRAQHVKK A+R KCGDCGI L G+++LRPR
Sbjct: 1  MAQRVTFRRRNPFNTKTNKIKVVKTPGGVLRAQHVKKLATRHKCGDCGIALDGISSLRPR 60

Query: 61 QYASISKTSKTVSRVYGGSRCSNCVKERIVRAFL 94
          QYAS+SKT KTVSR YGGSRC+NCVK+RIVRAFL
Sbjct: 61 QYASVSKTHKTVSRPYGGSRCANCVKQRIVRAFL 94

>KLLA0C08371g join(732878..732914,733482..733822) highly similar
          to sp|P40525 Saccharomyces cerevisiae YIL052c RPL34B
          ribosomal protein or sp|P87262 Saccharomyces cerevisiae
          YER056ca ribosomal protein, start by similarity
          Length = 125

 Score =  160 bits (404), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 75/94 (79%), Positives = 84/94 (89%)

Query: 1  MAQRVTFRRRNPCNTKSNKIKVVKTPGGILRAQHVKKQASRPKCGDCGIPLPGVAALRPR 60
          MAQRVTFRRRNP NTKSNKIKVVKTPGG LR+QHVKK A+RPKCGD G+PL GV+ LRPR
Sbjct: 1  MAQRVTFRRRNPYNTKSNKIKVVKTPGGALRSQHVKKLATRPKCGDTGVPLQGVSTLRPR 60

Query: 61 QYASISKTSKTVSRVYGGSRCSNCVKERIVRAFL 94
          QYA++S+T KTVSR YGGS+ +N VKERIVRAFL
Sbjct: 61 QYATVSRTKKTVSRAYGGSKSANAVKERIVRAFL 94

>Kwal_23.5799
          Length = 69

 Score = 64.3 bits (155), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 28/38 (73%), Positives = 33/38 (86%)

Query: 57 LRPRQYASISKTSKTVSRVYGGSRCSNCVKERIVRAFL 94
          +RPR+YA++SKT KTVSR YGG  C+N VKERIVRAFL
Sbjct: 1  MRPREYATVSKTHKTVSRAYGGVLCANAVKERIVRAFL 38

>Scas_20.1*
          Length = 59

 Score = 44.3 bits (103), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%)

Query: 74 RVYGGSRCSNCVKERIVRAFL 94
          R YGGSRC+NCVKERIVRAFL
Sbjct: 39 RAYGGSRCANCVKERIVRAFL 59

>AER299C [2801] [Homologous to ScYHR170W (NMD3) - SH]
          (1186065..1187603) [1539 bp, 512 aa]
          Length = 512

 Score = 30.4 bits (67), Expect = 0.38,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 30 LRAQHVKKQASRPKCGDCGIPLPGVAALRPRQYASISKT---SKTVSRVYGGSRCSNC 84
          L   H+++QA+   C +CG+P+ G + L    Y  I  T   ++ + R    S C NC
Sbjct: 6  LDPNHMQQQAATVLCCNCGVPMDGSSGL-VMCYDCIKMTVDITEGIPREANVSFCRNC 62

>KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces
           cerevisiae YKL116c, hypothetical start
          Length = 541

 Score = 29.6 bits (65), Expect = 0.59,   Method: Composition-based stats.
 Identities = 11/44 (25%), Positives = 26/44 (59%)

Query: 14  NTKSNKIKVVKTPGGILRAQHVKKQASRPKCGDCGIPLPGVAAL 57
           N  ++ ++V K+PGG      V+K+ ++    + G+P P ++++
Sbjct: 61  NVFTSPVRVNKSPGGFDAGLQVEKRRNKDSASNSGVPSPTISSV 104

>Scas_430.1
          Length = 446

 Score = 29.6 bits (65), Expect = 0.59,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 6/49 (12%)

Query: 3   QRVTFRRRNPCNTKSNKIKVVKTP------GGILRAQHVKKQASRPKCG 45
           Q +T + RNP  T ++     K P       G++R  H+    S P CG
Sbjct: 206 QVITVKERNPQETVTDDASFSKIPEDYDMTNGVIRTIHIGNLDSNPCCG 254

>CAGL0I07205g 694434..696245 similar to tr|Q12242 Saccharomyces
           cerevisiae YOR138c, hypothetical start
          Length = 603

 Score = 27.7 bits (60), Expect = 2.8,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 17/34 (50%)

Query: 9   RRNPCNTKSNKIKVVKTPGGILRAQHVKKQASRP 42
           R NP NT  +KI V K  G     QHVK   + P
Sbjct: 514 RFNPFNTAEDKISVGKCDGPGEVIQHVKNSTTVP 547

>ADR374C [2115] [Homologous to ScYOR341W (RPA190) - SH]
           (1372612..1377534) [4923 bp, 1640 aa]
          Length = 1640

 Score = 27.3 bits (59), Expect = 3.8,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 36  KKQASRPKCGDCGIPLPGVAALRPRQYASISKTSKTVSRVYGGSRCSNCVKERIVR 91
           KK  +RPKC +CG+  P     R   +  I +T+ T  ++   +R    ++E ++R
Sbjct: 210 KKILARPKCDNCGMFSP---KFRKDGFTKIFETALTEKQL-TNNRVKGLIREDMIR 261

>KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305
           Saccharomyces cerevisiae YMR093w singleton, start by
           similarity
          Length = 520

 Score = 26.9 bits (58), Expect = 5.7,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 28  GILRAQHVKKQASRPKCG-DCGIPLPGVAALRPRQYAS 64
           G++R   ++ ++ +P+   D G+P+  + A+ P Q AS
Sbjct: 191 GVVRLYDIRTKSDKPQTTLDHGLPVEDITAISPTQLAS 228

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.133    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,568,525
Number of extensions: 79194
Number of successful extensions: 186
Number of sequences better than 10.0: 16
Number of HSP's gapped: 186
Number of HSP's successfully gapped: 16
Length of query: 125
Length of database: 16,596,109
Length adjustment: 89
Effective length of query: 36
Effective length of database: 13,515,107
Effective search space: 486543852
Effective search space used: 486543852
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.8 bits)