Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_715.531281286572e-90
KLLA0C08349g1401285386e-72
Sklu_2193.31281285253e-70
Scas_704.341481265161e-68
Kwal_23.58041411285056e-67
YER057C (HMF1)1291284976e-66
ADL077C1421284986e-66
YIL051C (MMF1)1451284979e-66
CAGL0M12386g1421264874e-64
Kwal_23.28071291071791e-17
Kwal_47.165901261221632e-15
Kwal_55.212471341031572e-14
KLLA0B14817g1311181353e-11
KLLA0E03894g1371001214e-09
CAGL0M04521g6881091177e-08
YLR143W685119957e-05
AGL164W68683948e-05
KLLA0D16984g696106895e-04
Kwal_27.1131068887860.001
YNR001C (CIT1)47990710.11
CAGL0H03993g47293690.19
Scas_474.747670670.36
Sklu_2292.258034621.8
YOL089C (HAL9)103091621.9
KLLA0F12760g48290612.1
Kwal_34.1575162881612.2
YOL158C (ENB1)60634594.3
AAR004C47790594.5
Scas_715.33101847585.1
KLLA0F12056g36157576.2
YCR005C (CIT2)46086576.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_715.53
         (128 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_715.53                                                           257   2e-90
KLLA0C08349g 731629..732051 highly similar to sp|P40185 Saccharo...   211   6e-72
Sklu_2193.3 YIL051C, Contig c2193 5846-6232 reverse complement        206   3e-70
Scas_704.34                                                           203   1e-68
Kwal_23.5804                                                          199   6e-67
YER057C (HMF1) [1487] chr5 complement(270735..271124) Protein th...   196   6e-66
ADL077C [1664] [Homologous to ScYIL051C (MMF1) - SH; ScYER057C (...   196   6e-66
YIL051C (MMF1) [2616] chr9 complement(257842..258279) Protein im...   196   9e-66
CAGL0M12386g 1234993..1235421 similar to sp|P40037 Saccharomyces...   192   4e-64
Kwal_23.2807                                                           74   1e-17
Kwal_47.16590                                                          67   2e-15
Kwal_55.21247                                                          65   2e-14
KLLA0B14817g 1301705..1302100 similar to sp|Q8XCD0 Escherichia c...    57   3e-11
KLLA0E03894g complement(364475..364888) some similarities with s...    51   4e-09
CAGL0M04521g 496157..498223 similar to tr|Q12429 Saccharomyces c...    50   7e-08
YLR143W (YLR143W) [3552] chr12 (427330..429387) Protein containi...    41   7e-05
AGL164W [4148] [Homologous to ScYLR143W - SH] complement(388842....    41   8e-05
KLLA0D16984g 1439669..1441759 similar to sgd|S0004133 Saccharomy...    39   5e-04
Kwal_27.11310                                                          38   0.001
YNR001C (CIT1) [4585] chr14 complement(629621..631060) Citrate s...    32   0.11 
CAGL0H03993g complement(372155..373573) highly similar to sp|P00...    31   0.19 
Scas_474.7                                                             30   0.36 
Sklu_2292.2 YMR313C, Contig c2292 2329-4071                            28   1.8  
YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein i...    28   1.9  
KLLA0F12760g 1177776..1179224 gi|28565058|gb|AAO32612.1 Kluyvero...    28   2.1  
Kwal_34.15751                                                          28   2.2  
YOL158C (ENB1) [4667] chr15 complement(19490..21310) Protein inv...    27   4.3  
AAR004C [190] [Homologous to ScYNR001C (CIT1) - SH; ScYCR005C (C...    27   4.5  
Scas_715.33                                                            27   5.1  
KLLA0F12056g complement(1109801..1110886) similar to sp|P36156 S...    27   6.2  
YCR005C (CIT2) [540] chr3 complement(120943..122325) Citrate syn...    27   6.7  

>Scas_715.53
          Length = 128

 Score =  257 bits (657), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 128/128 (100%), Positives = 128/128 (100%)

Query: 1   MTTLTPVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIK 60
           MTTLTPVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIK
Sbjct: 1   MTTLTPVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIK 60

Query: 61  NVLEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEM 120
           NVLEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEM
Sbjct: 61  NVLEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEM 120

Query: 121 EVIAVEND 128
           EVIAVEND
Sbjct: 121 EVIAVEND 128

>KLLA0C08349g 731629..732051 highly similar to sp|P40185
           Saccharomyces cerevisiae YIL051c MMD1 required for
           maintenance of mitochondrial DNA, start by similarity
          Length = 140

 Score =  211 bits (538), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 112/128 (87%)

Query: 1   MTTLTPVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIK 60
           M TLTPV  + AP  AASYS A+K NNLIF+SGQIP TAENKPVEGSIADKAEQVIQN+K
Sbjct: 13  MNTLTPVKTQLAPPPAASYSQAIKVNNLIFVSGQIPYTAENKPVEGSIADKAEQVIQNVK 72

Query: 61  NVLEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEM 120
           N+L  +NS L+KIVKVNIFLADINSFAEFN+VYAKYFNVHKPARSCVA  ALPLN DLEM
Sbjct: 73  NILVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHKPARSCVAAKALPLNVDLEM 132

Query: 121 EVIAVEND 128
           EVIAVE D
Sbjct: 133 EVIAVEKD 140

>Sklu_2193.3 YIL051C, Contig c2193 5846-6232 reverse complement
          Length = 128

 Score =  206 bits (525), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 111/128 (86%)

Query: 1   MTTLTPVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIK 60
           M+TLTPV  + AP  AASYS A+K NN++F+SGQIP T ENKPVEGSIADKAEQVIQN+K
Sbjct: 1   MSTLTPVRTQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVK 60

Query: 61  NVLEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEM 120
           N+LE +NSSL KIVKVN+FLADIN FAEFN VYAKYFN HKPARSCVAV +LPLN DLEM
Sbjct: 61  NILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEM 120

Query: 121 EVIAVEND 128
           EVIAVE D
Sbjct: 121 EVIAVEKD 128

>Scas_704.34
          Length = 148

 Score =  203 bits (516), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 97/126 (76%), Positives = 111/126 (88%)

Query: 1   MTTLTPVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIK 60
           +TTLTPV+ K AP AAASYS AMKANN +++SGQIP T ENKPVEG+I+DKAEQV QNIK
Sbjct: 18  LTTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKPVEGTISDKAEQVFQNIK 77

Query: 61  NVLEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEM 120
           N+L+ S SS++KIVKVN+FLADIN+F EFN VYAKYFNVHKPARSCVAV  LPLN DLE+
Sbjct: 78  NILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPARSCVAVKDLPLNVDLEV 137

Query: 121 EVIAVE 126
           EVIAVE
Sbjct: 138 EVIAVE 143

>Kwal_23.5804
          Length = 141

 Score =  199 bits (505), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 93/128 (72%), Positives = 108/128 (84%)

Query: 1   MTTLTPVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIK 60
           M+TLTPV  + +P  AASYS AM+ N ++F+SGQIP TAENK VEG+IADKAEQVIQN++
Sbjct: 14  MSTLTPVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKRVEGTIADKAEQVIQNVR 73

Query: 61  NVLEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEM 120
           N+LE +NS L+KIVKVNIFLADI  FAEFN VY KYFN HKPARSCVAV ALPL+ DLEM
Sbjct: 74  NILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHKPARSCVAVKALPLDVDLEM 133

Query: 121 EVIAVEND 128
           EV+AVE D
Sbjct: 134 EVVAVEKD 141

>YER057C (HMF1) [1487] chr5 complement(270735..271124) Protein that
           inhibits cell growth and contributes to cell death at
           high temperature, member of the p14.5 family [390 bp,
           129 aa]
          Length = 129

 Score =  196 bits (497), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 106/128 (82%), Positives = 117/128 (91%)

Query: 1   MTTLTPVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIK 60
           +TTLTPV C++AP+AAASYSHAMK NNLIFLSGQIP+T +NK VEGSIADKAEQVIQNIK
Sbjct: 2   VTTLTPVICESAPAAAASYSHAMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIK 61

Query: 61  NVLEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEM 120
           NVLEASNSSL+++VKVNIFLADIN FAEFN+VYAKYFN HKPARSCVAVAALPL  D+EM
Sbjct: 62  NVLEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEM 121

Query: 121 EVIAVEND 128
           E IA E D
Sbjct: 122 EAIAAERD 129

>ADL077C [1664] [Homologous to ScYIL051C (MMF1) - SH; ScYER057C
           (HMF1) - SH] (549526..549954) [429 bp, 142 aa]
          Length = 142

 Score =  196 bits (498), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 107/128 (83%)

Query: 1   MTTLTPVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIK 60
           M++LTPV    AP  AASYS AM+AN ++F+SGQIP T +NKPVEGS+ADK EQVI N++
Sbjct: 15  MSSLTPVRTTAAPPPAASYSQAMRANGMVFVSGQIPYTPDNKPVEGSVADKTEQVIANVR 74

Query: 61  NVLEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEM 120
           NVLEASNS L+++ KVN+FLAD+  FAEFN+VYAKYF  HKPARSCVAV ALPLN DLEM
Sbjct: 75  NVLEASNSGLDRVAKVNVFLADMAYFAEFNSVYAKYFGEHKPARSCVAVRALPLNVDLEM 134

Query: 121 EVIAVEND 128
           EVIA+E D
Sbjct: 135 EVIALERD 142

>YIL051C (MMF1) [2616] chr9 complement(257842..258279) Protein
           important for maintenance of mitochondrial DNA, may be
           involved in isoleucine-dependent transaminase activity,
           member of the p14.5 family [438 bp, 145 aa]
          Length = 145

 Score =  196 bits (497), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 92/128 (71%), Positives = 112/128 (87%)

Query: 1   MTTLTPVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIK 60
           +TTLTPV+ K AP AAASYS AMKANN +++SGQIP T +NKPV+GSI++KAEQV QN+K
Sbjct: 18  ITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVK 77

Query: 61  NVLEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEM 120
           N+L  SNSSL+ IVKVN+FLAD+ +FAEFN+VYAK+F+ HKPARSCV VA+LPLN DLEM
Sbjct: 78  NILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEM 137

Query: 121 EVIAVEND 128
           EVIAVE +
Sbjct: 138 EVIAVEKN 145

>CAGL0M12386g 1234993..1235421 similar to sp|P40037 Saccharomyces
           cerevisiae YER057c HIG1 Heat-shock induceable Inhibiter
           of cell Growth, hypothetical start
          Length = 142

 Score =  192 bits (487), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 98/126 (77%), Positives = 111/126 (88%)

Query: 1   MTTLTPVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIK 60
           ++ LTPV   NAP AAASYSHAMK NNLI++SGQIP T +NKPVEGSI+DKAEQVIQN++
Sbjct: 15  LSKLTPVISANAPPAAASYSHAMKVNNLIYVSGQIPYTKDNKPVEGSISDKAEQVIQNVQ 74

Query: 61  NVLEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEM 120
           N+L+ SNS L +IVKVNIFLAD+N+FAEFN VYAKYFNVHKPARSCVAVAALPL  DLEM
Sbjct: 75  NILKDSNSDLNRIVKVNIFLADMNNFAEFNKVYAKYFNVHKPARSCVAVAALPLGVDLEM 134

Query: 121 EVIAVE 126
           EVIA E
Sbjct: 135 EVIATE 140

>Kwal_23.2807
          Length = 129

 Score = 73.6 bits (179), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 67/107 (62%), Gaps = 9/107 (8%)

Query: 22  AMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVI----QNIKNVLEASNSSLEKIVKVN 77
           A K+N+L+F SG +       PV G++ +  EQ I    +N+KNVL AS SSLE+++KV 
Sbjct: 25  ASKSNDLVFTSGCV----GTDPVTGNLPEDLEQQIINALENLKNVLHASGSSLERVLKVL 80

Query: 78  IFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEMEVIA 124
           +F++D +  +  N VY++YF  + PARSC+ VA       +E+E IA
Sbjct: 81  LFVSDASYASTVNEVYSRYFP-NAPARSCIVVAFPAPALKVELECIA 126

>Kwal_47.16590
          Length = 126

 Score = 67.4 bits (163), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 59/122 (48%), Gaps = 5/122 (4%)

Query: 3   TLTPVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIKNV 62
           T   +  K  P+ +  Y     +N  +F SG I        V   I D+    I+N++ V
Sbjct: 7   TWEAIKGKEHPTLSPGYV----SNGHVFTSGIIGANYGTGEVPHEIEDQVHLAIKNLETV 62

Query: 63  LEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEMEV 122
           L A  SSL K+ KV +F++  +     N +Y  YF  HKPARSCV VA +      E+E 
Sbjct: 63  LVAGGSSLSKVFKVTMFISHADYSKVVNEIYGHYFP-HKPARSCVVVAFMDAAIKYELEA 121

Query: 123 IA 124
           IA
Sbjct: 122 IA 123

>Kwal_55.21247
          Length = 134

 Score = 65.1 bits (157), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 61/103 (59%), Gaps = 9/103 (8%)

Query: 26  NNLIFLSGQIPMTAENKPVEGSIADKAEQ----VIQNIKNVLEASNSSLEKIVKVNIFLA 81
           ++L+F SG +       PV G +    EQ     ++N+KNVL AS SSLE+++KV +F++
Sbjct: 28  SDLVFTSGCV----GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVS 83

Query: 82  DINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEMEVIA 124
           D +     N VY++YF    PARSC+ V+    +  +E+E IA
Sbjct: 84  DGSYAPAVNKVYSEYFP-GAPARSCIVVSFPNASLKVELECIA 125

>KLLA0B14817g 1301705..1302100 similar to sp|Q8XCD0 Escherichia coli
           O157:H7 Orf, hypothetical protein, start by similarity
          Length = 131

 Score = 56.6 bits (135), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 60/118 (50%), Gaps = 1/118 (0%)

Query: 7   VTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIKNVLEAS 66
           V  ++ P+  A      K   L++ SG +        +   +  +    + N+  VL+AS
Sbjct: 10  VGVESGPTFLAPAYVTSKDTELVYTSGCVGSDLLTGEIPEDLEKQVRNALDNLGRVLKAS 69

Query: 67  NSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEMEVIA 124
           NSS + ++K+ +F+AD +  +  N VY +YF   +PARSC+ V+       +E+E +A
Sbjct: 70  NSSFDDVLKILLFVADGSYASTVNAVYKEYFP-ERPARSCIVVSFPDPTLKVELECVA 126

>KLLA0E03894g complement(364475..364888) some similarities with
           sp|Q87LF6 Vibrio parahaemolyticus Conserved hypothetical
           protein, hypothetical start
          Length = 137

 Score = 51.2 bits (121), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 55/100 (55%), Gaps = 1/100 (1%)

Query: 25  ANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIKNVLEASNSSLEKIVKVNIFLADIN 84
            N L+F SG +        +   +  +A   + N+K VLE S SS++ ++K+ +F++D +
Sbjct: 28  GNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGS 87

Query: 85  SFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEMEVIA 124
                N V+ ++F  ++PARSC+ VA       +E+E IA
Sbjct: 88  YAGIVNKVFKEFFP-NQPARSCIVVAFPNNKLKVELECIA 126

>CAGL0M04521g 496157..498223 similar to tr|Q12429 Saccharomyces
           cerevisiae YLR143w, hypothetical start
          Length = 688

 Score = 49.7 bits (117), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 25/109 (22%), Positives = 61/109 (55%), Gaps = 10/109 (9%)

Query: 20  SHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIKNVLEASNSSLEKIVKVNIF 79
           +H  +  NL+++S   P   +     G++ ++ + V+Q + N+L+ ++ + + ++  ++ 
Sbjct: 314 THTNRIGNLLYISNIQPQYKD-----GTVQEQVKDVLQQLDNILKDNHLTAKNVLYSSLL 368

Query: 80  LADINSFAEFNTVYAKYFNVHK-----PARSCVAVAALPLNADLEMEVI 123
           L D++ FA  N  Y+K+F++ K     PAR+C+    +   + L++ V+
Sbjct: 369 LTDMSLFASVNQEYSKFFDIWKNGPLPPARACIESNIINDGSALQLSVV 417

>YLR143W (YLR143W) [3552] chr12 (427330..429387) Protein containing
           an endoribonuclease L-PSP domain and a DUF71 domain of
           unknown function, has moderate similarity to
           uncharacterized C. albicans Orf6.3850p [2058 bp, 685 aa]
          Length = 685

 Score = 41.2 bits (95), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 22/119 (18%), Positives = 59/119 (49%), Gaps = 11/119 (9%)

Query: 10  KNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIKNVLEASNSS 69
           +N  S A   +   K N+ +++S      +E      ++  ++E +   + ++L ++   
Sbjct: 303 ENHMSNALPQTTINKTNDKLYISNLQSRKSE------TVEKQSEDIFTELADILHSNQIP 356

Query: 70  LEKIVKVNIFLADINSFAEFNTVYAKYFNVHK-----PARSCVAVAALPLNADLEMEVI 123
              I+  ++ + D+++F + N +Y ++ ++ K     P+R+CV    LP +  +++ V+
Sbjct: 357 RNHILSASLLIRDMSNFGKINKIYNEFLDLSKYGPLPPSRACVGSKCLPEDCHVQLSVV 415

>AGL164W [4148] [Homologous to ScYLR143W - SH]
           complement(388842..390902) [2061 bp, 686 aa]
          Length = 686

 Score = 40.8 bits (94), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 5/83 (6%)

Query: 46  GSIADKAEQVIQNIKNVLEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHK---- 101
           G +  +A  V   +   L        +++   + LAD+ +FAE NT Y  YF++ +    
Sbjct: 327 GPLEKQARDVFDQLNESLTRHGVVKAQVLSSVLLLADMGTFAEINTAYNGYFSIQEIGPL 386

Query: 102 -PARSCVAVAALPLNADLEMEVI 123
            P+R+C+   +L     L++ V+
Sbjct: 387 PPSRACIESKSLAPGIGLQLSVV 409

>KLLA0D16984g 1439669..1441759 similar to sgd|S0004133 Saccharomyces
           cerevisiae YLR143w, start by similarity
          Length = 696

 Score = 38.9 bits (89), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 54/106 (50%), Gaps = 14/106 (13%)

Query: 12  APSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIKNVLEASNSSLE 71
           +PS   S +   K   L+++S   P   E      S+ +K   V   + ++L + +    
Sbjct: 311 SPSVPVSINEVGK---LLYISNIAPSKGE------SLKEKCLDVFSQLTSILSSRSIFAC 361

Query: 72  KIVKVNIFLADINSFAEFNTVYAKYFNVHK-----PARSCVAVAAL 112
           +I+  ++ L+D+N+F E N+ Y +YFNV K     PAR+CV  + L
Sbjct: 362 QILSSSLLLSDMNNFQEVNSYYNEYFNVTKIGPLPPARACVESSFL 407

>Kwal_27.11310
          Length = 688

 Score = 37.7 bits (86), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 6/87 (6%)

Query: 43  PVEGSIAD-KAEQVIQNIKNVLEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHK 101
           P  GS  D K + V + + ++L     S  +I+   + LAD+  F++ N  Y ++F+V +
Sbjct: 326 PKGGSSPDEKVQDVFRQLSDILRDYELSPAQILSSLVLLADMGDFSKVNEHYNEFFHVAR 385

Query: 102 -----PARSCVAVAALPLNADLEMEVI 123
                P+R+CV  + +     L++ VI
Sbjct: 386 NGPLPPSRACVGSSLVGSENILQLSVI 412

>YNR001C (CIT1) [4585] chr14 complement(629621..631060) Citrate
           synthase, mitochondrial, converts acetyl-CoA and
           oxaloacetate into citrate plus CoA [1440 bp, 479 aa]
          Length = 479

 Score = 32.0 bits (71), Expect = 0.11,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 45/90 (50%), Gaps = 1/90 (1%)

Query: 6   PVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIKNVLEA 65
           P   +  P A  S     +A   + L+G+IP  A+ K +   +A ++E + +++  +L++
Sbjct: 111 PEIQRELPKAEGSTEPLPEALFWLLLTGEIPTDAQVKALSADLAARSE-IPEHVIQLLDS 169

Query: 66  SNSSLEKIVKVNIFLADINSFAEFNTVYAK 95
               L  + + +I +  + S ++F   YA+
Sbjct: 170 LPKDLHPMAQFSIAVTALESESKFAKAYAQ 199

>CAGL0H03993g complement(372155..373573) highly similar to sp|P00890
           Saccharomyces cerevisiae YNR001c CIT1, start by
           similarity
          Length = 472

 Score = 31.2 bits (69), Expect = 0.19,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 46/93 (49%), Gaps = 1/93 (1%)

Query: 6   PVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIKNVLEA 65
           P   K  P+   S     +A   + L+G++P  ++ K     +A ++E V +++  +L++
Sbjct: 104 PEIKKELPTIGGSSEPVPEALFWLLLTGEVPTESQVKAFSADLASRSE-VPEHVLKLLDS 162

Query: 66  SNSSLEKIVKVNIFLADINSFAEFNTVYAKYFN 98
               L  + +++I +  + + ++F   YA+  N
Sbjct: 163 LPKDLHPMAQLSIAVNALETESKFAKAYARGVN 195

>Scas_474.7
          Length = 476

 Score = 30.4 bits (67), Expect = 0.36,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 29  IFLSGQIPMTAENKPVEGSIADKAEQVIQNIKNVLEASNSSLEKIVKVNIFLADINSFAE 88
           + L+G+IP  A+ + +   +A +AE + +++ N+L      L  + + +I +  + S ++
Sbjct: 127 LLLTGEIPSRAQVEQLSADLASRAE-LPEHVVNLLNGLPKHLHPMAQFSIAVNALESESK 185

Query: 89  FNTVYAKYFN 98
           F   YA+  N
Sbjct: 186 FAKAYAQGVN 195

>Sklu_2292.2 YMR313C, Contig c2292 2329-4071
          Length = 580

 Score = 28.5 bits (62), Expect = 1.8,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 19/34 (55%)

Query: 1   MTTLTPVTCKNAPSAAASYSHAMKANNLIFLSGQ 34
           ++T T + CKN  +    Y H  K  +L+FL+ Q
Sbjct: 356 VSTDTKLMCKNLKNEVVEYLHTDKTKDLVFLTPQ 389

>YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein
           involved in salt tolerance, has similarity to
           transcription factors, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [3093 bp, 1030 aa]
          Length = 1030

 Score = 28.5 bits (62), Expect = 1.9,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 14/91 (15%)

Query: 32  SGQIPMTAENKPVEGSIADKAEQVIQNIKNVLEAS-NSSLEKIVKVNIFLADINSFAEF- 89
           SG+  +   N P+E +I DK    + NI+N L    NS +EK+ +   ++ D  +  E+ 
Sbjct: 211 SGRFELLNGNSPLESNIIDK----VSNIQNNLNKKMNSKIEKLDRKMSYIIDSVARLEWL 266

Query: 90  --------NTVYAKYFNVHKPARSCVAVAAL 112
                      Y +  N+ KPAR   + A L
Sbjct: 267 LDKAVKKQEGKYKEKNNLPKPARKIYSTALL 297

>KLLA0F12760g 1177776..1179224 gi|28565058|gb|AAO32612.1
           Kluyveromyces lactis CIT1, start by similarity
          Length = 482

 Score = 28.1 bits (61), Expect = 2.1,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 44/90 (48%), Gaps = 1/90 (1%)

Query: 6   PVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIKNVLEA 65
           P   K  P AA       +A   + L+G++P   + K +   +A ++E +  +++++L+ 
Sbjct: 114 PDIQKELPKAADGEEPLPEAIFWLLLTGEVPTETQVKALSADLASRSE-LPAHVESLLDN 172

Query: 66  SNSSLEKIVKVNIFLADINSFAEFNTVYAK 95
               L  + + ++ +  + S ++F   YA+
Sbjct: 173 LPKDLHPMAQFSMAVTALESESKFAKAYAQ 202

>Kwal_34.15751
          Length = 628

 Score = 28.1 bits (61), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 8/81 (9%)

Query: 29  IFLSGQIPMTAENKPVEGSIADK----AEQVIQNIKNVLEASNSSLEKIVKVNIFLADIN 84
           +F    IP    +KP E    +      + +++NI+N+ EA +    KI     FL DI 
Sbjct: 133 LFQQETIPQKTYSKPQELPATEDPSTLKKYLVENIENLAEAKSEFYNKIYNYYPFL-DIE 191

Query: 85  SFAEFNT---VYAKYFNVHKP 102
           SF +  T   ++ K   VH P
Sbjct: 192 SFEKLFTKVIIHHKEDGVHAP 212

>YOL158C (ENB1) [4667] chr15 complement(19490..21310) Protein
          involved in iron uptake via a siderophore enterobactin,
          member of the yeast-specific putative
          multidrug-resistance family of the major facilitator
          superfamily (MFS) [1821 bp, 606 aa]
          Length = 606

 Score = 27.3 bits (59), Expect = 4.3,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 20/34 (58%)

Query: 61 NVLEASNSSLEKIVKVNIFLADINSFAEFNTVYA 94
          NV +++ S L +I  VN  L+D +SF  F   ++
Sbjct: 27 NVEKSTTSGLRRIDAVNKVLSDYSSFTAFGVTFS 60

>AAR004C [190] [Homologous to ScYNR001C (CIT1) - SH; ScYCR005C
           (CIT2) - SH] (345034..346467) [1434 bp, 477 aa]
          Length = 477

 Score = 27.3 bits (59), Expect = 4.5,   Method: Composition-based stats.
 Identities = 16/90 (17%), Positives = 42/90 (46%), Gaps = 1/90 (1%)

Query: 6   PVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIKNVLEA 65
           P   K  P A        +A   + L+G++P   + K +   +  ++E +  +++ +L++
Sbjct: 109 PEVQKELPKAPNGREPLPEALFWLLLTGEVPTETQTKALSADLMSRSE-LPGHVEQLLDS 167

Query: 66  SNSSLEKIVKVNIFLADINSFAEFNTVYAK 95
               L  + + ++ +  + S ++F   YA+
Sbjct: 168 LPRDLHPMAQFSVAVTALESESKFAKAYAQ 197

>Scas_715.33
          Length = 1018

 Score = 26.9 bits (58), Expect = 5.1,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 18  SYSHAM--KANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIKNV 62
           SYS A+    N+L+  + ++P   E +  +G     AE V+  +KN+
Sbjct: 345 SYSKAIFNYTNSLLIATAELPEIDEIRVSQGGTESNAENVVTTLKNL 391

>KLLA0F12056g complement(1109801..1110886) similar to sp|P36156
           Saccharomyces cerevisiae YKR076w ECM4 involved in cell
           wall biogenesis and architecture, start by similarity
          Length = 361

 Score = 26.6 bits (57), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 9/57 (15%)

Query: 50  DKAEQVIQNIKNVLEASNSSLEKIVKVNIFLAD---------INSFAEFNTVYAKYF 97
           DK E +++     L++++SS E+IVK    L D           +   F+ VY ++F
Sbjct: 240 DKVEGILKKRYETLKSTHSSEEEIVKKLYLLGDQLTEADLRLYPTIVRFDPVYVQHF 296

>YCR005C (CIT2) [540] chr3 complement(120943..122325) Citrate
           synthase, peroxisomal (nonmitochondrial), converts
           acetyl-CoA and oxaloacetate into citrate plus CoA [1383
           bp, 460 aa]
          Length = 460

 Score = 26.6 bits (57), Expect = 6.7,   Method: Composition-based stats.
 Identities = 17/86 (19%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 10  KNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIKNVLEASNSS 69
           K+ P A  S     +A   + L+G++P  A+ + +   +  ++E +  ++  +L+     
Sbjct: 96  KDLPKAKGSSQPLPEALFWLLLTGEVPTQAQVENLSADLMSRSE-LPSHVVQLLDNLPKD 154

Query: 70  LEKIVKVNIFLADINSFAEFNTVYAK 95
           L  + + +I +  + S ++F   YA+
Sbjct: 155 LHPMAQFSIAVTALESESKFAKAYAQ 180

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.126    0.340 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,806,525
Number of extensions: 140662
Number of successful extensions: 538
Number of sequences better than 10.0: 41
Number of HSP's gapped: 533
Number of HSP's successfully gapped: 41
Length of query: 128
Length of database: 16,596,109
Length adjustment: 89
Effective length of query: 39
Effective length of database: 13,515,107
Effective search space: 527089173
Effective search space used: 527089173
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 55 (25.8 bits)