Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_715.521071074632e-61
YER058W (PET117)1071073225e-40
Sklu_2193.41021012922e-35
KLLA0C08327g1031012896e-35
CAGL0J02926g1271002803e-33
Kwal_23.5805102972601e-30
ADL076W1131002306e-26
KLLA0D05401g18965620.93
KLLA0E24849g33627592.3
YDL159W (STE7)51547592.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_715.52
         (107 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_715.52                                                           182   2e-61
YER058W (PET117) [1488] chr5 (271766..272089) Protein involved i...   128   5e-40
Sklu_2193.4 YER058W, Contig c2193 6568-6876                           117   2e-35
KLLA0C08327g complement(730884..731195) similar to sp|Q02771 Sac...   115   6e-35
CAGL0J02926g 281301..281684 similar to sp|Q02771 Saccharomyces c...   112   3e-33
Kwal_23.5805                                                          104   1e-30
ADL076W [1665] [Homologous to ScYER058W (PET117) - SH] complemen...    93   6e-26
KLLA0D05401g 466109..466678 similar to sp|Q12133 Saccharomyces c...    28   0.93 
KLLA0E24849g 2200867..2201877 similar to sp|Q92341 Schizosacchar...    27   2.3  
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    27   2.4  

>Scas_715.52
          Length = 107

 Score =  182 bits (463), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 91/107 (85%)

Query: 1   MSRASKITFALTCVFTITTTVGVHYVQGMERDTLHQGPIKDAKRVAEKKRLKESGLDPAK 60
           MSRASKITFALTCVFTITTTVGVHYVQGMERDTLHQGPIKDAKRVAEKKRLKESGLDPAK
Sbjct: 1   MSRASKITFALTCVFTITTTVGVHYVQGMERDTLHQGPIKDAKRVAEKKRLKESGLDPAK 60

Query: 61  EKKRMFNQSEHXXXXXXXXXXXXXXXXSGEVVTKDGEVVKEADKART 107
           EKKRMFNQSEH                SGEVVTKDGEVVKEADKART
Sbjct: 61  EKKRMFNQSEHELQKELKKQYEQQQPLSGEVVTKDGEVVKEADKART 107

>YER058W (PET117) [1488] chr5 (271766..272089) Protein involved in
           assembly of cytochrome oxidase [324 bp, 107 aa]
          Length = 107

 Score =  128 bits (322), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 67/107 (62%), Positives = 74/107 (69%), Gaps = 3/107 (2%)

Query: 1   MSRASKITFALTCVFTITTTVGVHYVQGMERDTLHQGPIKDAKRVAEKKRLKESG---LD 57
           MSRASKITFA +C+ T  T VGVHYVQ MER+TLHQGPIKDAKRV EK+  K +G   LD
Sbjct: 1   MSRASKITFAASCLITAATVVGVHYVQEMERETLHQGPIKDAKRVEEKRLRKTNGVASLD 60

Query: 58  PAKEKKRMFNQSEHXXXXXXXXXXXXXXXXSGEVVTKDGEVVKEADK 104
           P KE+KR FN SEH                SGEVVTKDGEVVKE+ K
Sbjct: 61  PTKERKRYFNMSEHEEQKELRKKYETMQPLSGEVVTKDGEVVKESKK 107

>Sklu_2193.4 YER058W, Contig c2193 6568-6876
          Length = 102

 Score =  117 bits (292), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 69/101 (68%), Gaps = 1/101 (0%)

Query: 1   MSRASKITFALTCVFTITTTVGVHYVQGMERDTLHQGPIKDAKRVAEKKRLK-ESGLDPA 59
           MSRASKIT AL+C+ T TT +GVH VQ MER TLHQGPIKDAKRVAEKK  K E   DP+
Sbjct: 1   MSRASKITLALSCLLTTTTVIGVHIVQDMERQTLHQGPIKDAKRVAEKKLAKEEQNQDPS 60

Query: 60  KEKKRMFNQSEHXXXXXXXXXXXXXXXXSGEVVTKDGEVVK 100
           K++ ++ N+ EH                SGEV+TKDGEVVK
Sbjct: 61  KQRMKLVNKGEHELQQELRKKYEAMQPLSGEVLTKDGEVVK 101

>KLLA0C08327g complement(730884..731195) similar to sp|Q02771
           Saccharomyces cerevisiae YER058w PET117 cytochrome c
           oxidase assembly factor singleton, start by similarity
          Length = 103

 Score =  115 bits (289), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 71/101 (70%)

Query: 1   MSRASKITFALTCVFTITTTVGVHYVQGMERDTLHQGPIKDAKRVAEKKRLKESGLDPAK 60
           MSRASKIT  LT +FT T  VGVH+VQ +ER TLHQGPIKDA+RVAEKK  +++G+DP K
Sbjct: 1   MSRASKITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQRVAEKKLARQNGVDPEK 60

Query: 61  EKKRMFNQSEHXXXXXXXXXXXXXXXXSGEVVTKDGEVVKE 101
           E++RM N++EH                SGEV TKD E++++
Sbjct: 61  ERQRMVNKNEHEYQLELRKKYEQMQPLSGEVRTKDNELIEQ 101

>CAGL0J02926g 281301..281684 similar to sp|Q02771 Saccharomyces
           cerevisiae YER058w PET117, start by similarity
          Length = 127

 Score =  112 bits (280), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 69/100 (69%), Gaps = 4/100 (4%)

Query: 1   MSRASKITFALTCVFTITTTVGVHYVQGMERDTLHQGPIKDAKRVAEKKRLKESGLDPAK 60
           MSRASKITF ++C  T+ T +GVHYVQ +ER+TLHQGPIKDAKRVAEKK+L  +G D   
Sbjct: 32  MSRASKITFGVSCAVTLATIIGVHYVQELERETLHQGPIKDAKRVAEKKKLMPAGTD--- 88

Query: 61  EKKRMFNQSEHXXXXXXXXXXXXXXXXSGEVVTKDGEVVK 100
            +K++ N+SEH                SGEVVT+DGE VK
Sbjct: 89  -EKKLLNRSEHELQQELRKKYESMQPLSGEVVTQDGERVK 127

>Kwal_23.5805
          Length = 102

 Score =  104 bits (260), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 53/97 (54%), Positives = 64/97 (65%), Gaps = 6/97 (6%)

Query: 1  MSRASKITFALTCVFTITTTVGVHYVQGMERDTLHQGPIKDAKRVAEKKRLKESGLDPAK 60
          MS ASKIT AL+CV T  T +GVHYVQ +ERDTLHQGPIKDAKR+A++K   E+      
Sbjct: 1  MSTASKITLALSCVLTTATVIGVHYVQELERDTLHQGPIKDAKRIADRKAEMEN------ 54

Query: 61 EKKRMFNQSEHXXXXXXXXXXXXXXXXSGEVVTKDGE 97
          E+K+ FN+SEH                SGEV+TKDGE
Sbjct: 55 ERKKRFNESEHELQQELRRKYEALQPLSGEVLTKDGE 91

>ADL076W [1665] [Homologous to ScYER058W (PET117) - SH]
           complement(550058..550399) [342 bp, 113 aa]
          Length = 113

 Score = 93.2 bits (230), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 58/100 (58%), Gaps = 2/100 (2%)

Query: 1   MSRASKITFALTCVFTITTTVGVHYVQGMERDTLHQGPIKDAKRVAEKKRLKESGLDPAK 60
           MSRASKIT AL    +  T V VH VQ MERD L QGPIKDA R AEK+   E   DP  
Sbjct: 14  MSRASKITLALCTAASAATVVTVHLVQEMERDALKQGPIKDALRTAEKR--AERDADPEA 71

Query: 61  EKKRMFNQSEHXXXXXXXXXXXXXXXXSGEVVTKDGEVVK 100
            +K+M N SEH                SGEVVT+DG+VV+
Sbjct: 72  ARKKMLNASEHELQLELRRKYAAMQPLSGEVVTQDGDVVE 111

>KLLA0D05401g 466109..466678 similar to sp|Q12133 Saccharomyces
          cerevisiae YLR066w SPC3 signal peptidase subunit
          singleton, start by similarity
          Length = 189

 Score = 28.5 bits (62), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 30/65 (46%), Gaps = 5/65 (7%)

Query: 8  TFALTCVFTITTTVGVHYVQGMERDTLHQ-----GPIKDAKRVAEKKRLKESGLDPAKEK 62
          + AL+C F +   +       + +D + +       I+ A R A++KR   S ++P +  
Sbjct: 13 SLALSCSFLVIALIAATSWLQLVKDNVFELESQLSHIRSATRFAKQKRYGGSAVNPTEVS 72

Query: 63 KRMFN 67
          K  FN
Sbjct: 73 KIRFN 77

>KLLA0E24849g 2200867..2201877 similar to sp|Q92341
           Schizosaccharomyces pombe Hypothetical protein C1F8.03c
           in chromosome I, hypothetical start
          Length = 336

 Score = 27.3 bits (59), Expect = 2.3,   Method: Composition-based stats.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 44  RVAEKKRLKESGLDPAKEKKRMFNQSE 70
           R A K      G+DP  EKKR+  QSE
Sbjct: 186 RKANKSGETPIGVDPLAEKKRLIKQSE 212

>YDL159W (STE7) [712] chr4 (172482..174029)
           Serine/threonine/tyrosine protein kinase of MAP kinase
           kinase (MAPKK or MEK) family, component of pheromone
           response, filamentous growth, and STE vegetative growth
           pathways [1548 bp, 515 aa]
          Length = 515

 Score = 27.3 bits (59), Expect = 2.4,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 22/47 (46%)

Query: 25  YVQGMERDTLHQGPIKDAKRVAEKKRLKESGLDPAKEKKRMFNQSEH 71
           YV   + D       K   ++ E KR+K   LD AK +K+   +S H
Sbjct: 469 YVSPSKDDKFRHWCRKIKSKIKEDKRIKREALDRAKLEKKQSERSTH 515

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.127    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,524,414
Number of extensions: 77983
Number of successful extensions: 236
Number of sequences better than 10.0: 14
Number of HSP's gapped: 225
Number of HSP's successfully gapped: 14
Length of query: 107
Length of database: 16,596,109
Length adjustment: 77
Effective length of query: 30
Effective length of database: 13,930,523
Effective search space: 417915690
Effective search space used: 417915690
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 54 (25.4 bits)