Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_715.5134134116630.0
Scas_704.354482115536e-67
Kwal_23.58074652185502e-66
ADL075W2072065013e-62
CAGL0M12342g4572185181e-61
KLLA0C08305g4092135114e-61
YER059W (PCL6)4202524984e-59
YIL050W (PCL7)2852364701e-56
ACR001C3461891862e-15
Sklu_2373.43071881782e-14
KLLA0D01287g3451771703e-13
Kwal_56.224432802061622e-12
CAGL0E02541g3421881623e-12
Scas_392.13031911613e-12
YOL001W (PHO80)2931881604e-12
Scas_706.34511411271e-07
Kwal_56.24151480791215e-07
CAGL0H08998g5471531181e-06
YPL219W (PCL8)4921461172e-06
YGL134W (PCL10)4331491134e-06
CAGL0E05918g4811491119e-06
Scas_720.47473591021e-04
KLLA0B02024g5271541002e-04
AFL115W38653958e-04
YNL289W (PCL1)27961920.002
KLLA0E13255g28261780.077
Scas_674.71146114710.92
YAL040C (CLN3)58028672.4
CAGL0J08734g74258662.9
ADL149W1211123663.0
Scas_654.27161581654.0
Scas_706.36108644645.2
Kwal_14.2619116771646.6
Scas_718.121446125637.5
CAGL0J09328g297150619.2
YHL019C (APM2)60549629.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_715.51
         (341 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_715.51                                                           645   0.0  
Scas_704.35                                                           217   6e-67
Kwal_23.5807                                                          216   2e-66
ADL075W [1666] [Homologous to ScYIL050W (PCL7) - SH; ScYER059W (...   197   3e-62
CAGL0M12342g complement(1232642..1234015) weakly similar to sp|P...   204   1e-61
KLLA0C08305g complement(728996..730225) some similarities with s...   201   4e-61
YER059W (PCL6) [1489] chr5 (272622..273884) Cyclin that associat...   196   4e-59
YIL050W (PCL7) [2617] chr9 (258912..259769) Cyclin, associates w...   185   1e-56
ACR001C [1049] [Homologous to ScYOL001W (PHO80) - SH] (357962..3...    76   2e-15
Sklu_2373.4 YOL001W, Contig c2373 11960-12883                          73   2e-14
KLLA0D01287g 112866..113903 some similarities with sp|P20052 Sac...    70   3e-13
Kwal_56.22443                                                          67   2e-12
CAGL0E02541g 244577..245605 similar to sp|P20052 Saccharomyces c...    67   3e-12
Scas_392.1                                                             67   3e-12
YOL001W (PHO80) [4815] chr15 (325249..326130) Cyclin that intera...    66   4e-12
Scas_706.3                                                             54   1e-07
Kwal_56.24151                                                          51   5e-07
CAGL0H08998g 877952..879595 weakly similar to tr|Q08966 Saccharo...    50   1e-06
YPL219W (PCL8) [5230] chr16 (136749..138227) Cyclin that associa...    50   2e-06
YGL134W (PCL10) [1853] chr7 (255666..256967) Cyclin that associa...    48   4e-06
CAGL0E05918g complement(585723..587168) some similarities with t...    47   9e-06
Scas_720.47                                                            44   1e-04
KLLA0B02024g 176585..178168 some similarities with sp|P53124 Sac...    43   2e-04
AFL115W [3080] [Homologous to ScYPL219W (PCL8) - SH; ScYGL134W (...    41   8e-04
YNL289W (PCL1) [4322] chr14 (87895..88734) G1/S-specific cyclin ...    40   0.002
KLLA0E13255g 1170139..1170987 weakly similar to sp|P24867 Saccha...    35   0.077
Scas_674.7                                                             32   0.92 
YAL040C (CLN3) [27] chr1 complement(65781..67523) G1/S-specific ...    30   2.4  
CAGL0J08734g 860389..862617 highly similar to sp|P31382 Saccharo...    30   2.9  
ADL149W [1592] [Homologous to ScYHR158C (KEL1) - SH; ScYGR238C (...    30   3.0  
Scas_654.27                                                            30   4.0  
Scas_706.36                                                            29   5.2  
Kwal_14.2619                                                           29   6.6  
Scas_718.12                                                            29   7.5  
CAGL0J09328g 918579..919472 similar to sp|P25693 Saccharomyces c...    28   9.2  
YHL019C (APM2) [2267] chr8 complement(67727..69544) Clathrin-ass...    28   9.2  

>Scas_715.51
          Length = 341

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/341 (94%), Positives = 322/341 (94%)

Query: 1   MISAGDAFTYKDDTTMLPPSLSRTTDQNRDLHNTISMTRXXXXXXXXXXXXXXXXXXXLK 60
           MISAGDAFTYKDDTTMLPPSLSRTTDQNRDLHNTISMTR                   LK
Sbjct: 1   MISAGDAFTYKDDTTMLPPSLSRTTDQNRDLHNTISMTRITTEEAISSSESSMASESSLK 60

Query: 61  NTKESIGPETFSTNGRSTVIKWRQNPMEVDIPSPRSIAITRKQIEKIPLSTRLNSSYDEN 120
           NTKESIGPETFSTNGRSTVIKWRQNPMEVDIPSPRSIAITRKQIEKIPLSTRLNSSYDEN
Sbjct: 61  NTKESIGPETFSTNGRSTVIKWRQNPMEVDIPSPRSIAITRKQIEKIPLSTRLNSSYDEN 120

Query: 121 ASVNDFIDITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRS 180
           ASVNDFIDITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRS
Sbjct: 121 ASVNDFIDITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRS 180

Query: 181 IKSFRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNIST 240
           IKSFRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNIST
Sbjct: 181 IKSFRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNIST 240

Query: 241 HHHLLRNYDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMN 300
           HHHLLRNYDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMN
Sbjct: 241 HHHLLRNYDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMN 300

Query: 301 YLELQFLLISNFDLIISSEEIQRYSGLLSKFYISITDLTAS 341
           YLELQFLLISNFDLIISSEEIQRYSGLLSKFYISITDLTAS
Sbjct: 301 YLELQFLLISNFDLIISSEEIQRYSGLLSKFYISITDLTAS 341

>Scas_704.35
          Length = 448

 Score =  217 bits (553), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 107/211 (50%), Positives = 152/211 (72%), Gaps = 14/211 (6%)

Query: 124 NDFIDITKLSTKKLIKMISTILEKLIKSNDELR--ERNETSLNDRTDDDNSDESKLVRSI 181
           N+ I+I +  T KL++M++ +L+K++KSND+L     N  S++D    +++  +  V SI
Sbjct: 221 NESINIAEFPTNKLLEMLTALLDKIVKSNDKLNVSSSNSESIDDILRSEDNSNNAYVGSI 280

Query: 182 KSFRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTH 241
            +FRGKH+P I L QYF RIQKYCPT N V L++L+YFDRISK  N S  ++ D    T+
Sbjct: 281 LAFRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDS--PTN 338

Query: 242 HHLLRNYDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNY 301
              L          F++DSYNIHRLII+ +TV TKF+SDFFYSNSRYA+VGG+SL E+N+
Sbjct: 339 KSQL----------FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNH 388

Query: 302 LELQFLLISNFDLIISSEEIQRYSGLLSKFY 332
           LELQFL++ +F+L+I +EE+QRY+ LLS+F+
Sbjct: 389 LELQFLVLCDFELMIPTEELQRYADLLSRFW 419

>Kwal_23.5807
          Length = 465

 Score =  216 bits (550), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 111/218 (50%), Positives = 148/218 (67%), Gaps = 28/218 (12%)

Query: 121 ASVNDFIDITKLSTKKLIKMISTILEKLIKSNDEL-RER----NETSLNDRTDD-DNSDE 174
           + V + I I    T +L+ M++ +L+K++KSND+L R+R    ++   + RT+D DN   
Sbjct: 255 SEVPELIQIATFPTDRLLSMLTALLDKIVKSNDQLNRDRPFDEDQFLASARTEDADNDTR 314

Query: 175 SKLVRSIKSFRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENES 234
             +   I SFRGKH+P I L+QYF RIQKYCPT N V L++L+YFDRI+K  N  KE   
Sbjct: 315 PNIASEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQ-- 372

Query: 235 DPNISTHHHLLRNYDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGI 294
                                F++DSYNIHRLIISA+TVSTKF+SDFFYSNSRYA+VGGI
Sbjct: 373 --------------------LFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGI 412

Query: 295 SLDEMNYLELQFLLISNFDLIISSEEIQRYSGLLSKFY 332
           SL E+N+LELQFL++ +F+LIIS EE+Q+YS LL  F+
Sbjct: 413 SLKELNHLELQFLVLCDFELIISVEELQKYSDLLRDFW 450

>ADL075W [1666] [Homologous to ScYIL050W (PCL7) - SH; ScYER059W
           (PCL6) - SH] complement(550944..551567) [624 bp, 207 aa]
          Length = 207

 Score =  197 bits (501), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 142/206 (68%), Gaps = 30/206 (14%)

Query: 127 IDITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRG 186
           +DI +  T KL++M++ +L K+IKSND L+  ++    ++ D +N    K V  + SFRG
Sbjct: 16  MDIAQFPTDKLLEMLTGLLYKIIKSNDRLKPFDQ----EKHDINN----KYVAHVLSFRG 67

Query: 187 KHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLR 246
           KHIP I L  YF RIQKYCP  N V L++L+YFDRI+K     + N  DP +        
Sbjct: 68  KHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAK-----RCNALDPQL-------- 114

Query: 247 NYDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQF 306
                    F++DSYNIHRLII+A+TVSTKF+SDFFYSNSRYA+VGGISL+E+N LELQF
Sbjct: 115 ---------FVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQF 165

Query: 307 LLISNFDLIISSEEIQRYSGLLSKFY 332
            ++ +F+LI+S +E+QRY+ LL KF+
Sbjct: 166 SILCDFELIVSIQELQRYADLLYKFW 191

>CAGL0M12342g complement(1232642..1234015) weakly similar to
           sp|P40038 Saccharomyces cerevisiae YER059w PCL6 cyclin
           like protein interacting with PHO85P, hypothetical start
          Length = 457

 Score =  204 bits (518), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 102/218 (46%), Positives = 147/218 (67%), Gaps = 25/218 (11%)

Query: 127 IDITKLSTKKLIKMISTILEKLIKSNDELR----------ERNETSLNDR--TDDDNSDE 174
           ++I +  T KL++M++ +L K+IKSND++             ++ SL D        +D+
Sbjct: 236 LNIAEFPTDKLLEMLTALLNKIIKSNDQMEPYKDKDKDEDHDDDESLTDSKLMSVKGTDK 295

Query: 175 SKLVRSIKSFRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENES 234
            K ++SI SF+GKH+P I L QYF RIQKYCPT N V L++L+YFDRISK  N S    +
Sbjct: 296 EKYLKSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESA 355

Query: 235 DPNISTHHHLLRNYDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGI 294
           D +               +  F++DSYNIHRL+I+ +TV TKF+SDFFYSNSRYA+VGGI
Sbjct: 356 DTS-------------PADQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGI 402

Query: 295 SLDEMNYLELQFLLISNFDLIISSEEIQRYSGLLSKFY 332
           SL E+N+LELQFL++ +F+L+IS +++QRY+ LL +F+
Sbjct: 403 SLSELNHLELQFLVLCDFELLISVDKLQRYANLLLRFW 440

>KLLA0C08305g complement(728996..730225) some similarities with
           sp|P40038 Saccharomyces cerevisiae YER059w PCL6 cyclin
           like protein interacting with PHO85P, hypothetical start
          Length = 409

 Score =  201 bits (511), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 144/213 (67%), Gaps = 13/213 (6%)

Query: 124 NDFIDITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESK---LVRS 180
           N  +DI    T KL+ M++ +L K+IKSND L           T +  + + K   L+R 
Sbjct: 186 NHHMDIATFPTYKLLDMLTGLLTKIIKSNDSL---------GSTPNFETSQGKNIPLMRE 236

Query: 181 IKSFRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNIST 240
           I SFRGK +P I L+QYF RIQKYCPT N VLL++L++FDRI+K  N   +      +ST
Sbjct: 237 ILSFRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVST 296

Query: 241 HHHLLRNYDCKIEDK-FLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEM 299
                 +   +   + F++DS+NIHRLII+AITVSTKF SDFFYSNSRYA+VGGISL E+
Sbjct: 297 PDKTTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQEL 356

Query: 300 NYLELQFLLISNFDLIISSEEIQRYSGLLSKFY 332
           N+LELQFL++ +F LIIS EE+QRY+ LL KF+
Sbjct: 357 NHLELQFLILCDFRLIISVEELQRYADLLYKFW 389

>YER059W (PCL6) [1489] chr5 (272622..273884) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           utilization of alternative carbon and nitrogen sources
           [1263 bp, 420 aa]
          Length = 420

 Score =  196 bits (498), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 110/252 (43%), Positives = 150/252 (59%), Gaps = 39/252 (15%)

Query: 120 NASVNDFIDITKLSTKKLIKMISTILEKLIKSNDELRERNETSL----NDRTDDDNSDES 175
           N+ V   ++I +  T KL+KM++ +L K+IKSND     N +      N R    + +E 
Sbjct: 155 NSQVTPSLNIAEFPTDKLLKMLTALLTKIIKSNDRTAATNPSLTQEIENGRCLALSDNEK 214

Query: 176 KLVRSIKSFRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNG------- 228
           K +  +  FRGKH+P I L+QYF RIQKYCPT N V L++L+YFDRISK  N        
Sbjct: 215 KYLSPVLGFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSVTTTPKT 274

Query: 229 -SKENESDPNISTHHHLLRNYD----CKIE-----------------------DKFLLDS 260
            + ++ES  N S+     R  D    C                            F++DS
Sbjct: 275 NTAKHESPSNESSLDKANRGADKMSACNSNENNENDDSDDENTGVQRDSRAHPQMFVMDS 334

Query: 261 YNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFLLISNFDLIISSEE 320
           +NIHRLII+ ITVSTKF SDFFYSNSRY++VGGISL E+N+LELQFL++ +F+L+IS  E
Sbjct: 335 HNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELLISVNE 394

Query: 321 IQRYSGLLSKFY 332
           +QRY+ LL +F+
Sbjct: 395 LQRYADLLYRFW 406

>YIL050W (PCL7) [2617] chr9 (258912..259769) Cyclin, associates with
           the Pho85p cyclin-dependent kinase, involved in
           utilization of alternate carbon sources [858 bp, 285 aa]
          Length = 285

 Score =  185 bits (470), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 103/236 (43%), Positives = 146/236 (61%), Gaps = 24/236 (10%)

Query: 97  IAITRKQIEKIPLSTRLNSSYDENASVNDFIDITKLSTKKLIKMISTILEKLIKSNDELR 156
           +   +K +E    +  L+   +E   V   ++I    T +LI MIS +L ++I +NDE  
Sbjct: 71  VQAVKKSLESEAKTHSLDEETNEQTDVK-ILNIADFPTDELILMISALLNRIITANDE-- 127

Query: 157 ERNETSLNDRTDDDNSDESKLVRSIKSFRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAIL 216
               T ++ +  D+  DE  L+  I +F GK++P I + QY  RIQKYCPT N + L++L
Sbjct: 128 ---TTDVSQQVSDETEDE--LLTPILAFYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLL 182

Query: 217 IYFDRISKVLNGSKENESDPNISTHHHLLRNYDCKIEDKFLLDSYNIHRLIISAITVSTK 276
           +YFDRISK    S E              RN   K    F++DS NIHRL+I+ +T+ TK
Sbjct: 183 VYFDRISKNYGHSSE--------------RNGCAK--QLFVMDSGNIHRLLITGVTICTK 226

Query: 277 FWSDFFYSNSRYAKVGGISLDEMNYLELQFLLISNFDLIISSEEIQRYSGLLSKFY 332
           F SDFFYSNSRYAKVGGISL E+N+LELQFL++ +F L++S EE+Q+Y+ LL KF+
Sbjct: 227 FLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLLVSVEEMQKYANLLYKFW 282

>ACR001C [1049] [Homologous to ScYOL001W (PHO80) - SH]
           (357962..359002) [1041 bp, 346 aa]
          Length = 346

 Score = 76.3 bits (186), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 83/189 (43%), Gaps = 44/189 (23%)

Query: 137 LIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRGKHIPPIKLEQ 196
           L+ +IS +L  LI  ND                D S   KL R    F  +  P I +  
Sbjct: 30  LVVLISRMLTSLIGMND-------------AQGDKSKPIKLTR----FHSRVPPAISVYN 72

Query: 197 YFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRNYDCKIEDKF 256
           Y  R+ KY    + VLLA + Y D ++ V                             +F
Sbjct: 73  YLIRLTKYSSLEHCVLLASVYYIDLLTNVY---------------------------PEF 105

Query: 257 LLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFLLISNFDLII 316
            LDS  +HR +++A TV++K   D F +N+ YAKVGG+   E+N LE +FL   N+ ++ 
Sbjct: 106 RLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILP 165

Query: 317 SSEEIQRYS 325
             + I+R S
Sbjct: 166 RDDNIRRCS 174

>Sklu_2373.4 YOL001W, Contig c2373 11960-12883
          Length = 307

 Score = 73.2 bits (178), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 81/188 (43%), Gaps = 45/188 (23%)

Query: 128 DITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRGK 187
           +  K S   L+ +IS +L  LI+ ND +             D N    KL R    F  +
Sbjct: 52  EFLKCSRTALVVLISRMLSSLIQMNDSM-----------CKDKNL---KLTR----FHSR 93

Query: 188 HIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRN 247
             P I +  Y  R+ KY      VL+A + Y D +S V                      
Sbjct: 94  VPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVY--------------------- 132

Query: 248 YDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFL 307
                   F L+S  +HR +++A TV++K  SD F +N  YAKVGG+   E+N LE +FL
Sbjct: 133 ------PSFTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFL 186

Query: 308 LISNFDLI 315
              N+ +I
Sbjct: 187 KRVNYRII 194

>KLLA0D01287g 112866..113903 some similarities with sp|P20052
           Saccharomyces cerevisiae YOL001w PHO80 cyclin,
           hypothetical start
          Length = 345

 Score = 70.1 bits (170), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 79/177 (44%), Gaps = 44/177 (24%)

Query: 131 KLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRGKHIP 190
           + S   L+ +IS +L  LI+ ND     N+T              +L R    F  K  P
Sbjct: 27  RCSRTHLVVIISRMLSFLIQINDANNAGNQTM-------------ELTR----FHSKAAP 69

Query: 191 PIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRNYDC 250
            I + QY  R+ KY    + VLL+ + Y D +S V                         
Sbjct: 70  SITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVY------------------------ 105

Query: 251 KIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFL 307
               +F L+S  +HR +++A T+++K   D F +N+ Y+KVGG+   E+N LE +FL
Sbjct: 106 ---PEFTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFL 159

>Kwal_56.22443
          Length = 280

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 90/206 (43%), Gaps = 50/206 (24%)

Query: 128 DITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRGK 187
           D ++ S   L+ +IS +L  L            T +ND    D++ E      +  F  +
Sbjct: 37  DFSQCSRTDLVILISRMLSFL------------TRINDSVPKDDAKE------LTRFHSR 78

Query: 188 HIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRN 247
             P I +  Y  R+ +Y      VL+A + Y D +S +                      
Sbjct: 79  VPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMY--------------------- 117

Query: 248 YDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFL 307
                   F L+S  +HR +++A TV++K   D F +NS YAKVGG+   E++ LE +FL
Sbjct: 118 ------PSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFL 171

Query: 308 LISNFDLI-----ISSEEIQRYSGLL 328
              N+ ++     IS+ + ++ +GL 
Sbjct: 172 KKVNYRILPRDDNISNCKAEKKAGLF 197

>CAGL0E02541g 244577..245605 similar to sp|P20052 Saccharomyces
           cerevisiae YOL001w PHO80 cyclin, start by similarity
          Length = 342

 Score = 67.0 bits (162), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 83/188 (44%), Gaps = 43/188 (22%)

Query: 128 DITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRGK 187
           D  K     L+ +I+ +L+ +I+            +ND    +N  +  L R    F  K
Sbjct: 22  DFLKCPKGDLVILIARMLQFIIQ------------INDSNIKENERKYGLTR----FHSK 65

Query: 188 HIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRN 247
             P I +  YF R+ KY    + VLL+ + Y D +S V                      
Sbjct: 66  IAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPA------------------- 106

Query: 248 YDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFL 307
                   F L+S   HR +++A T+++K   D F +N+ Y+KVGG+  +E+N LE +FL
Sbjct: 107 --------FNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFL 158

Query: 308 LISNFDLI 315
              N+ +I
Sbjct: 159 RKVNYRII 166

>Scas_392.1
          Length = 303

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 83/191 (43%), Gaps = 39/191 (20%)

Query: 131 KLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRGKHIP 190
           K S   L+ ++S +L  LI+SND             T + ++  S     +  F  +  P
Sbjct: 59  KCSRSDLVVLVSRMLVLLIQSND------------MTSNTSNSSSDSNMHLTRFHSRIPP 106

Query: 191 PIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRNYDC 250
            I +  Y  R+ KYC   + VLL+I+ Y D  +                           
Sbjct: 107 NISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAA------------------------- 141

Query: 251 KIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFLLIS 310
                F  +S   HR +++AITV+ K   D F + ++YAK+GG+  +E+N LE  FL I 
Sbjct: 142 --YPTFTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIV 199

Query: 311 NFDLIISSEEI 321
           N+ +I  S  +
Sbjct: 200 NYRIIPRSSNV 210

>YOL001W (PHO80) [4815] chr15 (325249..326130) Cyclin that interacts
           with Pho85p cyclin-dependent kinase, regulates the
           phosphate pathway through phosphorylation of Pho4p [882
           bp, 293 aa]
          Length = 293

 Score = 66.2 bits (160), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 82/188 (43%), Gaps = 42/188 (22%)

Query: 128 DITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRGK 187
           D  K S   L+ +IS +L  LI  N       E S   ++DD    +  L R    +  K
Sbjct: 26  DFNKCSRTDLVVLISRMLVSLIAIN-------ENSATKKSDD----QITLTR----YHSK 70

Query: 188 HIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRN 247
             P I +  YF R+ K+    + VL+  L Y D +  V          P+          
Sbjct: 71  IPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVY---------PD---------- 111

Query: 248 YDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFL 307
                   F L+S   HR +++A TV+TK   D F +N+ YAKVGG+   E+N LE  FL
Sbjct: 112 --------FTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFL 163

Query: 308 LISNFDLI 315
              N+ +I
Sbjct: 164 KRVNYRII 171

>Scas_706.3
          Length = 451

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 67/141 (47%), Gaps = 20/141 (14%)

Query: 182 KSFRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTH 241
           K++   ++P +    + +RIQ  C    +V ++    F  +  +L+    +E D  I   
Sbjct: 316 KNYTMHNVPSLSYTDFINRIQSKCMFGAIVYMSATYLFQIL--LLD---RDERDGPIKLK 370

Query: 242 HHLLRNYDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNY 301
           H L  N               +HR+II+ I V TK   DF +S+  + KV G+S   ++ 
Sbjct: 371 HKLQEN--------------EVHRMIIATIRVGTKLVEDFVHSHQYFCKVCGVSRKLLSK 416

Query: 302 LELQFLLISNFD-LIISSEEI 321
           LE+  LL    D +II++EE+
Sbjct: 417 LEVTLLLCLKHDKIIITTEEL 437

>Kwal_56.24151
          Length = 480

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 48/79 (60%), Gaps = 5/79 (6%)

Query: 240 THHHLLRNY-----DCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGI 294
           T  HLL++      D K+  K+ LD+  +HRLII++I ++TK   D  +S++ ++++ GI
Sbjct: 378 TAAHLLQSLFLTRKDNKLCCKYHLDNCQVHRLIIASIRLATKLLEDCVHSHTCFSRICGI 437

Query: 295 SLDEMNYLELQFLLISNFD 313
           S   +  LE+ FL   NF+
Sbjct: 438 SKKLLTKLEIAFLNCINFE 456

>CAGL0H08998g 877952..879595 weakly similar to tr|Q08966
           Saccharomyces cerevisiae YPL219w PCL8, hypothetical
           start
          Length = 547

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 70/153 (45%), Gaps = 20/153 (13%)

Query: 184 FRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHH 243
           F  K  P +  E +  RIQ  C    ++ LA         ++L  +++N  D NI     
Sbjct: 414 FTMKSKPSVSAEIFLGRIQNKCEFGPIIYLAAAYLL----QILFLTRDN-PDSNIRVRLK 468

Query: 244 LLRNYDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLE 303
           L  N               IHRLIIS + VS K   DF +S+  ++KV G+S   ++ LE
Sbjct: 469 LREN--------------EIHRLIISTVRVSAKLVEDFVHSHEYFSKVCGVSKKLLSKLE 514

Query: 304 LQFLL-ISNFDLIISSEEIQRYSGLLSKFYISI 335
           +  ++ I N  L+I+ +++     +L +   ++
Sbjct: 515 VSLIMCIKNERLMITKQKLTASQKILDELQSAL 547

>YPL219W (PCL8) [5230] chr16 (136749..138227) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           control of glycogen accumulation [1479 bp, 492 aa]
          Length = 492

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 61/146 (41%), Gaps = 30/146 (20%)

Query: 184 FRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAI-----LIYFDRISKVLNGSKENESDPNI 238
           F  K+ P +    +  RIQ  C    +V L       L++  R                 
Sbjct: 356 FVMKNPPSLSFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTR----------------- 398

Query: 239 STHHHLLRNYDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDE 298
                     D  I+ K  L     HR+IIS I ++TK   DF +S +   KV GIS   
Sbjct: 399 -------DEMDGPIKLKAKLQEDQAHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRL 451

Query: 299 MNYLELQFLLISNFD-LIISSEEIQR 323
           +  LE+ F+   NFD L+I+ E++++
Sbjct: 452 LTKLEISFMASVNFDGLMITCEKLEK 477

>YGL134W (PCL10) [1853] chr7 (255666..256967) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           glycogen accumulation [1302 bp, 433 aa]
          Length = 433

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 65/149 (43%), Gaps = 21/149 (14%)

Query: 184 FRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHH 243
           F  K  P +    +  RIQ  C     V L      D +                     
Sbjct: 300 FYMKSKPTLSSADFLKRIQDKCEYQPTVYLVATFLIDTL--------------------F 339

Query: 244 LLRNYDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLE 303
           L R+ +  ++ K  L    +HR+II+A+ +STK   DF +S+  ++KV GIS   +  LE
Sbjct: 340 LTRDGNNILQLKLNLQEKEVHRMIIAAVRLSTKLLEDFVHSHEYFSKVCGISKRLLTKLE 399

Query: 304 LQFLL-ISNFDLIISSEEIQRYSGLLSKF 331
           +  L+ + N  L++S+ ++     LL++ 
Sbjct: 400 VSLLICVCNTKLMVSNRKLAASKLLLNEL 428

>CAGL0E05918g complement(585723..587168) some similarities with
           tr|Q08966 Saccharomyces cerevisiae YPL219w PCL8,
           hypothetical start
          Length = 481

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 66/149 (44%), Gaps = 20/149 (13%)

Query: 184 FRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHH 243
           F  K  P I    +  RIQ  C   +++ L          ++L  ++E    P +   H 
Sbjct: 346 FSMKSAPSISHHDFIQRIQNKCMFGSIIYLGATYLL----QILFLTREYNDGP-LRLKHK 400

Query: 244 LLRNYDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLE 303
           L +N               +HR+I+  I ++TK   DF +S+    KV GIS   M  LE
Sbjct: 401 LQQN--------------EVHRVIVGTIRIATKLLEDFVHSHQYICKVCGISKKLMTKLE 446

Query: 304 LQFLL-ISNFDLIISSEEIQRYSGLLSKF 331
           L  +  + + +L+I+SE++   + +L + 
Sbjct: 447 LALIFCLKDNNLLINSEKLSATACILEEL 475

>Scas_720.47
          Length = 473

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 36/59 (61%)

Query: 251 KIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFLLI 309
           K++ +F  +  ++HRLII+ + ++TK   D  +S+  + KV GIS   ++ LE+  LL 
Sbjct: 388 KLKLRFKFEKSDVHRLIIATVRIATKLLEDHVHSHEYFCKVSGISKKLLSKLEVSLLLC 446

>KLLA0B02024g 176585..178168 some similarities with sp|P53124
           Saccharomyces cerevisiae YGL134w PCL10 cyclin like
           protein interacting with PHO85P, hypothetical start
          Length = 527

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 67/154 (43%), Gaps = 38/154 (24%)

Query: 165 DRTDDDNSDESKLVRSIKSFRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISK 224
           D    +N +E+  +R+I  F+ K  P + + QY  RI+  C          +IY      
Sbjct: 375 DHWSHENLEETSNIRAI--FQMKSAPTLSISQYLDRIESKCS------FPPIIYL----- 421

Query: 225 VLNGSKENESDPNISTHHHLLRNYDCKIE-----DKFLLDS----YNIHRLIISAITVST 275
                          T   LL  Y C I+      KF L++       HRL+I+ I ++ 
Sbjct: 422 ---------------TASFLLVTY-CDIKFDTGSGKFHLENPITESMTHRLLIAFIRLAA 465

Query: 276 KFWSDFFYSNSRYAKVGGISLDEMNYLELQFLLI 309
           K   D  +S+S ++KV GIS   ++ LEL  +LI
Sbjct: 466 KLLEDHVHSHSYFSKVCGISKKLLSKLELNLVLI 499

>AFL115W [3080] [Homologous to ScYPL219W (PCL8) - SH; ScYGL134W
           (PCL10) - SH] complement(221235..222395) [1161 bp, 386
           aa]
          Length = 386

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 257 LLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFLLI 309
           + +SY +HRLI++ I VSTK   D  +S+  ++KV GIS   +  LEL  +L+
Sbjct: 300 IAESY-VHRLIVALIRVSTKIVEDTVHSHEYFSKVCGISKKLLMRLELALILV 351

>YNL289W (PCL1) [4322] chr14 (87895..88734) G1/S-specific cyclin
           that interacts with the Cdc28p-like kinase Pho85p [840
           bp, 279 aa]
          Length = 279

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 39/61 (63%), Gaps = 2/61 (3%)

Query: 263 IHRLIISAITVSTKFWSDFFYSNSRYAKV--GGISLDEMNYLELQFLLISNFDLIISSEE 320
           IHR+ ++ + +S KF +D    N  +A+   G  +L+++N +E Q L + N+DL +++E+
Sbjct: 98  IHRIFLACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNWDLRVNTED 157

Query: 321 I 321
           +
Sbjct: 158 L 158

>KLLA0E13255g 1170139..1170987 weakly similar to sp|P24867
           Saccharomyces cerevisiae YNL289w PCL1 cyclin,
           G1/S-specific, start by similarity
          Length = 282

 Score = 34.7 bits (78), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 263 IHRLIISAITVSTKFWSDFFYSNSRYAKV--GGISLDEMNYLELQFLLISNFDLIISSEE 320
            HR+ ++ + +S K+ +D    N  + K   G  +L ++N +E Q L +  +DL + SEE
Sbjct: 102 CHRIFLACLILSAKYHNDSSPLNKHWTKYTDGMFTLRDVNLMERQLLQLFEWDLRVESEE 161

Query: 321 I 321
           +
Sbjct: 162 L 162

>Scas_674.7
          Length = 1146

 Score = 32.0 bits (71), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 54/114 (47%), Gaps = 16/114 (14%)

Query: 69  ETFST-NGRSTVIKWRQNPMEVDIPSPRSIAITRKQIEKIPLSTRLNSSYDENASVNDFI 127
           E F T NG + ++KWR N + +   SP    I  ++I+ +P             + ND++
Sbjct: 103 EQFDTLNGDNILVKWRNNFLVLLSGSPNRQKIKIERIQVLP-------------NFNDYL 149

Query: 128 DITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSI 181
             +      L+ +   +++ +I+ NDEL   +  +L+D   D + D   L++ +
Sbjct: 150 QGSTYFI--LVHIDKPLMKDVIRLNDELECFDTLTLHDNDGDSSPDARPLIQDM 201

>YAL040C (CLN3) [27] chr1 complement(65781..67523) G1/S-specific
           cyclin that interacts with Cdc28p protein kinase to
           control events at START [1743 bp, 580 aa]
          Length = 580

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 251 KIEDKFLLDSYNIHRLIISAITVSTKFW 278
           K   +F++ SYN   L ++A+ +S+KFW
Sbjct: 138 KYSSRFIIKSYNYQLLSLTALWISSKFW 165

>CAGL0J08734g 860389..862617 highly similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2 or sp|P47190
           Saccharomyces cerevisiae YOR321w PMT3, hypothetical
           start
          Length = 742

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 140 MISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRGKHIPPIKLEQY 197
           M ST  +   KS+ EL+ R +TS++D   ++  D SKL    K  +    P ++LE Y
Sbjct: 1   MSSTGFQGSEKSDAELKARKQTSVDDVLIEEKEDTSKL----KDAKVSQSPLLQLEAY 54

>ADL149W [1592] [Homologous to ScYHR158C (KEL1) - SH; ScYGR238C (KEL2)
            - SH] complement(427098..430733) [3636 bp, 1211 aa]
          Length = 1211

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 63/123 (51%), Gaps = 12/123 (9%)

Query: 133  STKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRS-IKSFRGKHIPP 191
            S K+  + I   L+ L K N+ELR +N + +N +   D S+ S+ +R  +K +R + +  
Sbjct: 974  SYKEKFEQIQKKLDALKKENEELRCKNISQMN-KLQQDISNHSQAMRDMLKHWRAQGL-S 1031

Query: 192  IKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRNYDCK 251
               E     ++      NL     +I  +++S  L+ +++ +SD N   HH LLRNY+  
Sbjct: 1032 DSSEGGAEGVR------NLQHHQSII--NKLSAQLDAAEKEKSDLN-HLHHELLRNYESL 1082

Query: 252  IED 254
             +D
Sbjct: 1083 QQD 1085

>Scas_654.27
          Length = 1615

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 39/81 (48%), Gaps = 6/81 (7%)

Query: 236 PNISTHHHLLRN--YDCKIEDKFLLDSYNIHRLII---SAITVSTKFWSDFFYSNSRYAK 290
           P  +   HL++   Y+ K  + F  +S    +L I   +A +   +     FY    Y+ 
Sbjct: 158 PQTTLLRHLMKKSKYELKKFNLFFENSVGYSQLSILFFTAYSDQDRLQKLEFYLEQMYSI 217

Query: 291 VGGISLDEMNYLELQFLLISN 311
           +G  SLD M  L+L FLLISN
Sbjct: 218 IGQYSLDSMRCLDL-FLLISN 237

>Scas_706.36
          Length = 1086

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 100 TRKQIEKIPLSTRLNSSYDENA--SVNDFIDITKLSTKKLIKMI 141
           T  Q   +PL++  N+S   +   S N+ +DITK+ST K IK++
Sbjct: 406 TNTQPGGVPLASDFNNSKQLSKLRSTNNLVDITKISTPKKIKLL 449

>Kwal_14.2619
          Length = 1167

 Score = 29.3 bits (64), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 17/71 (23%)

Query: 185 RGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYF-----------------DRISKVLN 227
           + + + P    + F +IQK  PT  ++ L +  YF                 D + ++L 
Sbjct: 341 QSQSVAPSPEMKVFSKIQKMIPTRKVIWLHLRNYFHSPLHALFPVLNEDWFNDDMREILR 400

Query: 228 GSKENESDPNI 238
           GS+E++S P I
Sbjct: 401 GSEESDSQPEI 411

>Scas_718.12
          Length = 1446

 Score = 28.9 bits (63), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 52/125 (41%), Gaps = 37/125 (29%)

Query: 123 VNDF--IDITKLSTKKLIKMISTILEKLIKSNDEL-----------------RERNE--- 160
           V DF  ++IT   T+KLI+ I  IL  L+  ND +                 RER     
Sbjct: 550 VQDFEALEITNRYTRKLIQFIEDILVTLLTDNDSMVKVAILGNILPLCRFFGRERTNDII 609

Query: 161 -----TSLNDRTDDDNSDESKLVRSIKSFRGKHI--PPIKLEQYFHR--IQKYCPTNNLV 211
                T LNDR      D +  +  I++  G  I   PI  EQY     +Q    +  LV
Sbjct: 610 LSHLITYLNDR------DPALRLALIQNISGISILLGPITFEQYILPLLVQTLIDSEELV 663

Query: 212 LLAIL 216
           ++A+L
Sbjct: 664 VVAVL 668

>CAGL0J09328g 918579..919472 similar to sp|P25693 Saccharomyces
           cerevisiae YDL127w PCL2 or tr|Q12477 Saccharomyces
           cerevisiae YDL179w PCL9, start by similarity
          Length = 297

 Score = 28.1 bits (61), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 29/150 (19%), Positives = 58/150 (38%), Gaps = 36/150 (24%)

Query: 178 VRSIKSFRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPN 237
           VR   S     IP  KLE +  ++ KY       L+A  ++  ++  ++           
Sbjct: 33  VRETHSMIDVAIPAPKLELFIKKLVKYSNVQTPTLMATTVFLTKLRSIIPA--------- 83

Query: 238 ISTHHHLLRNYDCKIEDKFLLDSYNI----HRLIISAITVSTKFWSDFFYSNSRYAKV-- 291
                                + Y I    HR+ +  + +S K  +D    N  +A+   
Sbjct: 84  ---------------------NVYGIETTRHRIFLGCLILSAKTLNDSSPLNKHWAQYTD 122

Query: 292 GGISLDEMNYLELQFLLISNFDLIISSEEI 321
           G + L E+N +E + L   +++L +S+ ++
Sbjct: 123 GLLHLKEVNTIERELLEYFDWNLTLSTNDL 152

>YHL019C (APM2) [2267] chr8 complement(67727..69544)
           Clathrin-associated protein (AP) complex, medium subunit
           [1818 bp, 605 aa]
          Length = 605

 Score = 28.5 bits (62), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 194 LEQYFHRIQKY----CPTNNLVLLAILIYFDRISKVLNGSKENESDPNI 238
           LEQ++H +QKY      T N++L  IL+  + I + ++      +DP+I
Sbjct: 83  LEQFYHLLQKYFEIEVLTKNVILDNILLVLELIDECIDFGIVQVTDPSI 131

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,094,536
Number of extensions: 487397
Number of successful extensions: 2627
Number of sequences better than 10.0: 107
Number of HSP's gapped: 2660
Number of HSP's successfully gapped: 107
Length of query: 341
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 239
Effective length of database: 13,065,073
Effective search space: 3122552447
Effective search space used: 3122552447
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)