Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_715.5055955927030.0
CAGL0D02662g56452820140.0
CAGL0D02640g56452820140.0
Sklu_2380.257253719700.0
CAGL0I00286g55553519240.0
YMR011W (HXT2)54151618830.0
Kwal_14.85457051618810.0
YFL011W (HXT10)54650818270.0
Sklu_2362.157253518290.0
Scas_628.759352518250.0
YDR343C (HXT6)57051418180.0
YDR342C (HXT7)57051418160.0
Sklu_2376.557953818120.0
Kwal_55.2007557151317750.0
Scas_658.2457052917750.0
YLR081W (GAL2)57453217670.0
KLLA0D13310g56753817510.0
CAGL0A02211g55252117470.0
AFL205C54652617440.0
CAGL0A02233g54953517400.0
Scas_541.657354017420.0
YHR096C (HXT5)59250817410.0
YOL156W (HXT11)56754117360.0
YJL219W (HXT9)56751417260.0
AFL207C53949617210.0
CAGL0A00737g54951517220.0
YDR345C (HXT3)56754017220.0
YHR094C (HXT1)57054417070.0
CAGL0A01826g53350817030.0
YHR092C (HXT4)56050517000.0
CAGL0A01782g56850916980.0
Scas_712.155853316930.0
Sklu_2415.257154016930.0
Scas_658.2356853016900.0
CAGL0A02321g55654316540.0
Scas_509.256854316500.0
CAGL0A01804g56352916460.0
Scas_541.759153016480.0
Scas_687.461052116460.0
YJL214W (HXT8)56951216390.0
Scas_550.957452116360.0
Scas_657.2056953516240.0
Scas_552.257254616040.0
Sklu_2304.657151215960.0
AFL204C53552015850.0
Scas_685.556051715560.0
Kwal_26.668656949215440.0
Scas_455.2*53551315360.0
Kwal_55.1958256749615290.0
Kwal_56.2228556749615180.0
YEL069C (HXT13)56452714860.0
YNR072W (HXT17)56452614790.0
YDL245C (HXT15)56750414570.0
YJR158W (HXT16)56750414500.0
YIL170W (HXT12)45745614160.0
Scas_634.1647142313141e-178
Kwal_26.668041639112611e-171
Scas_600.12932939571e-126
KLLA0E21021g5284738811e-112
Kwal_55.200682672578411e-109
AFR602W5584848661e-109
Scas_716.535234918511e-107
YNL318C (HXT14)5405218011e-100
CAGL0M04103g5314857963e-99
Kwal_56.248415114927649e-95
Kwal_27.96785134907387e-91
Kwal_55.200642382026563e-82
Scas_624.57984976484e-75
CAGL0I03872g7625156212e-71
YDL138W (RGT2)7635006142e-70
CAGL0J09020g8565396163e-70
Kwal_56.244697094936094e-70
YDL194W (SNF3)8844906157e-70
ADR091W6645385784e-66
KLLA0F05181g7874985811e-65
Scas_701.448764725649e-63
Kwal_34.162613272174612e-52
AEL042C5475224753e-52
Kwal_34.161905565214533e-49
Sklu_2439.205714914342e-46
KLLA0F26246g5834984272e-45
KLLA0A11110g5515004253e-45
ADR139C5585254086e-43
YDR536W (STL1)5694794061e-42
Kwal_56.227245784604033e-42
Kwal_33.149115704963972e-41
Scas_637.96074633903e-40
KLLA0E00264g5114543863e-40
Sklu_2427.85785203868e-40
Sklu_2313.35783803743e-38
KLLA0C12309g5695503691e-37
Scas_581.65875493655e-37
AFR343C5714893639e-37
YOL103W (ITR2)6094573612e-36
YDR497C (ITR1)5843803575e-36
CAGL0I07447g5704623576e-36
Kwal_27.116387234773472e-34
KLLA0F06853g5284453372e-33
Scas_552.0d1121062942e-31
KLLA0A03223g6774803199e-31
Kwal_34.162661581572931e-30
Sklu_2144.65274843062e-29
KLLA0E02970g5405523019e-29
ABR223C6244393012e-28
Scas_632.145535452982e-28
CAGL0M01672g5475312955e-28
KLLA0D00374g5564812931e-27
YBR241C4883852865e-27
KLLA0E14696g4774172856e-27
KLLA0E25025g5564782876e-27
YDR387C5555302788e-26
Kwal_14.11055224202715e-25
Kwal_14.16255065302699e-25
Kwal_27.128151981882531e-24
AFL034W4744212671e-24
Sklu_2080.45234622662e-24
YJR160C (MPH3)6024472612e-23
YDL247W (MPH2)6095172602e-23
CAGL0C01771g4853732554e-23
KLLA0D00253g5844882566e-23
KLLA0B00264g5764882557e-23
Kwal_33.129505664882548e-23
KLLA0E08987g5665292512e-22
Kwal_55.212895375042468e-22
Scas_597.54893972441e-21
KLLA0B14861g5874882461e-21
KLLA0E01782g5723712423e-21
YGL104C (VPS73)4863962403e-21
YBR298C (MAL31)6143992406e-21
CAGL0K12716g4844232299e-20
Scas_105.156552031e-19
Kwal_27.106646533792263e-19
YFL040W5405012201e-18
KLLA0D05379g4964842192e-18
Scas_716.725445052192e-18
Kwal_27.128111811722052e-18
KLLA0E06743g6674112149e-18
YIL171W (HXT12)109451894e-17
YGR289C (MAL11)6163321988e-16
AGL277W6714181907e-15
Sklu_2375.16134531853e-14
Scas_652.124784691843e-14
Kwal_27.110796134971827e-14
KLLA0C19481g3903361655e-12
CAGL0B02475g5804051202e-06
YML123C (PHO84)5874101183e-06
Kwal_27.113852222091126e-06
YDL199C6874331159e-06
Scas_626.15701761051e-04
Sklu_2304.55651401023e-04
KLLA0F13684g5711181005e-04
Kwal_26.7984612115988e-04
Scas_692.8625174870.018
Sklu_1567.2569109790.15
Sklu_1959.3531164790.16
Kwal_26.6669590143780.21
Sklu_2289.2528225780.22
Kwal_56.2375458990770.29
AGR076C686110760.39
Kwal_23.4814529176750.45
Sklu_2394.9533200750.46
Scas_660.3568118750.48
KLLA0F10043g528146730.87
YMR088C562118711.3
CAGL0J01375g56470711.7
KLLA0C19459g14994681.7
KLLA0D10615g45163692.2
Scas_694.19581168683.0
KLLA0C16852g45745683.3
YOR378W515151683.3
YKR105C582218683.6
ABR173C43634673.8
AFR322C592179674.1
Scas_713.30630160674.3
Scas_721.15530266674.8
Kwal_47.18976534158674.9
AFR442C56360665.2
ADR336C56865665.3
KLLA0F17776g55387665.3
Sklu_1110.1657113665.4
YBR180W (DTR1)572185665.8
Kwal_33.15638535210656.6
Kwal_33.1426856945657.0
Kwal_27.1217356784657.2
Kwal_23.4824553261658.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_715.50
         (559 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_715.50                                                          1045   0.0  
CAGL0D02662g complement(278099..279793) highly similar to sp|P23...   780   0.0  
CAGL0D02640g 274285..275979 highly similar to sp|P23585 Saccharo...   780   0.0  
Sklu_2380.2 YMR011W, Contig c2380 4381-6099 reverse complement        763   0.0  
CAGL0I00286g complement(20521..22188) highly similar to sp|P2358...   745   0.0  
YMR011W (HXT2) [3975] chr13 (288078..289703) High-affinity hexos...   729   0.0  
Kwal_14.854                                                           729   0.0  
YFL011W (HXT10) [1671] chr6 (112339..113979) Member of the hexos...   708   0.0  
Sklu_2362.1 YDR342C, Contig c2362 924-2642                            709   0.0  
Scas_628.7                                                            707   0.0  
YDR343C (HXT6) [1171] chr4 complement(1159598..1161310) High-aff...   704   0.0  
YDR342C (HXT7) [1170] chr4 complement(1154206..1155918) High-aff...   704   0.0  
Sklu_2376.5 , Contig c2376 9071-10810 reverse complement              702   0.0  
Kwal_55.20075                                                         688   0.0  
Scas_658.24                                                           688   0.0  
YLR081W (GAL2) [3496] chr12 (290213..291937) Galactose and gluco...   685   0.0  
KLLA0D13310g complement(1143027..1144730) gi|131828|sp|P18631|RA...   679   0.0  
CAGL0A02211g complement(224864..226522) highly similar to sp|P39...   677   0.0  
AFL205C [2990] [Homologous to ScYHR094C - SH] (49039..50679) [16...   676   0.0  
CAGL0A02233g complement(231128..232777) highly similar to sp|P39...   674   0.0  
Scas_541.6                                                            675   0.0  
YHR096C (HXT5) [2384] chr8 complement(294671..296449) Member of ...   675   0.0  
YOL156W (HXT11) [4669] chr15 (25272..26975) Low-affinity glucose...   673   0.0  
YJL219W (HXT9) [2711] chr10 (19497..21200) Member of the hexose ...   669   0.0  
AFL207C [2988] [Homologous to ScAFL207C] (44349..45968) [1620 bp...   667   0.0  
CAGL0A00737g 74767..76416 highly similar to sp|P39003 Saccharomy...   667   0.0  
YDR345C (HXT3) [1172] chr4 complement(1162947..1164650) Low-affi...   667   0.0  
YHR094C (HXT1) [2383] chr8 complement(290915..292627) Low-affini...   662   0.0  
CAGL0A01826g complement(179321..180922) highly similar to sp|P38...   660   0.0  
YHR092C (HXT4) [2382] chr8 complement(287131..288813) Moderate- ...   659   0.0  
CAGL0A01782g complement(170326..172032) highly similar to sp|P39...   658   0.0  
Scas_712.1                                                            656   0.0  
Sklu_2415.2 YJL214W, Contig c2415 2182-3897 reverse complement        656   0.0  
Scas_658.23                                                           655   0.0  
CAGL0A02321g complement(247500..249170) highly similar to sp|P32...   641   0.0  
Scas_509.2                                                            640   0.0  
CAGL0A01804g complement(175488..177179) highly similar to sp|P32...   638   0.0  
Scas_541.7                                                            639   0.0  
Scas_687.4                                                            638   0.0  
YJL214W (HXT8) [2715] chr10 (26887..28596) Member of the hexose ...   635   0.0  
Scas_550.9                                                            634   0.0  
Scas_657.20                                                           630   0.0  
Scas_552.2                                                            622   0.0  
Sklu_2304.6 , Contig c2304 11341-13056 reverse complement             619   0.0  
AFL204C [2991] [Homologous to ScAFL204C] (51587..53194) [1608 bp...   615   0.0  
Scas_685.5                                                            603   0.0  
Kwal_26.6686                                                          599   0.0  
Scas_455.2*                                                           596   0.0  
Kwal_55.19582                                                         593   0.0  
Kwal_56.22285                                                         589   0.0  
YEL069C (HXT13) [1361] chr5 complement(21537..23231) Member of t...   577   0.0  
YNR072W (HXT17) [4655] chr14 (772654..774348) Member of the hexo...   574   0.0  
YDL245C (HXT15) [632] chr4 complement(11657..13360) Member of th...   565   0.0  
YJR158W (HXT16) [3048] chr10 (732355..734058) Member of the hexo...   563   0.0  
YIL170W (HXT12) [2508] chr9 (19847..21220) Protein of unknown fu...   550   0.0  
Scas_634.16                                                           510   e-178
Kwal_26.6680                                                          490   e-171
Scas_600.1                                                            373   e-126
KLLA0E21021g 1870154..1871740 gi|32400014|emb|CAE00632.1 Kluyver...   343   e-112
Kwal_55.20068                                                         328   e-109
AFR602W [3794] [Homologous to ScYNL318C (HXT14 ) - NSH] compleme...   338   e-109
Scas_716.53                                                           332   e-107
YNL318C (HXT14) [4295] chr14 complement(38706..40328) Member of ...   313   e-100
CAGL0M04103g 452677..454272 similar to sp|P42833 Saccharomyces c...   311   3e-99
Kwal_56.24841                                                         298   9e-95
Kwal_27.9678                                                          288   7e-91
Kwal_55.20064                                                         257   3e-82
Scas_624.5                                                            254   4e-75
CAGL0I03872g 337985..340273 some similarities with sp|Q12300 Sac...   243   2e-71
YDL138W (RGT2) [730] chr4 (213352..215643) Low-affinity glucose ...   241   2e-70
CAGL0J09020g 887145..889715 highly similar to sp|P10870 Saccharo...   241   3e-70
Kwal_56.24469                                                         239   4e-70
YDL194W (SNF3) [679] chr4 (111581..114235) High-affinity glucose...   241   7e-70
ADR091W [1832] [Homologous to ScYDL194W (SNF3) - SH; ScYDL138W (...   227   4e-66
KLLA0F05181g 510384..512747 gi|2440082|emb|CAA75114.1 Kluyveromy...   228   1e-65
Scas_701.44                                                           221   9e-63
Kwal_34.16261                                                         182   2e-52
AEL042C [2464] [Homologous to ScYOL156W (HXT11) - SH] (557191..5...   187   3e-52
Kwal_34.16190                                                         179   3e-49
Sklu_2439.20 YDR536W, Contig c2439 31933-33648                        171   2e-46
KLLA0F26246g 2432209..2433960 similar to sp|P39932 Saccharomyces...   169   2e-45
KLLA0A11110g 964084..965739 gi|1346290|sp|P49374|HGT1_KLULA Kluy...   168   3e-45
ADR139C [1880] [Homologous to ScYDR536W (STL1) - NSH] (950171..9...   161   6e-43
YDR536W (STL1) [1346] chr4 (1507992..1509701) Member of the hexo...   160   1e-42
Kwal_56.22724                                                         159   3e-42
Kwal_33.14911                                                         157   2e-41
Scas_637.9                                                            154   3e-40
KLLA0E00264g 15302..16837 weakly similar to sp|P54854 Saccharomy...   153   3e-40
Sklu_2427.8 , Contig c2427 19304-21040                                153   8e-40
Sklu_2313.3 YDR497C, Contig c2313 3640-5376 reverse complement        148   3e-38
KLLA0C12309g 1046848..1048557 highly similar to sp|P30606 Saccha...   146   1e-37
Scas_581.6                                                            145   5e-37
AFR343C [3535] [Homologous to ScYOL103W (ITR2) - SH; ScYDR497C (...   144   9e-37
YOL103W (ITR2) [4718] chr15 (124000..125829) Myo-inositol permea...   143   2e-36
YDR497C (ITR1) [1312] chr4 complement(1443701..1445455) Myo-inos...   142   5e-36
CAGL0I07447g 716104..717816 highly similar to sp|P30606 Saccharo...   142   6e-36
Kwal_27.11638                                                         138   2e-34
KLLA0F06853g 656373..657959 gi|24943210|gb|AAN65374.1 Kluyveromy...   134   2e-33
Scas_552.0d                                                           117   2e-31
KLLA0A03223g 290002..292035 some similarities with sp|P39932 Sac...   127   9e-31
Kwal_34.16266                                                         117   1e-30
Sklu_2144.6 YFL040W, Contig c2144 7747-9330 reverse complement        122   2e-29
KLLA0E02970g complement(278965..280587) similar to sgd|S0002795 ...   120   9e-29
ABR223C [817] [Homologous to ScYFL040W - SH] (820632..822506) [1...   120   2e-28
Scas_632.14                                                           119   2e-28
CAGL0M01672g 186088..187731 similar to tr|Q04162 Saccharomyces c...   118   5e-28
KLLA0D00374g 30962..32632 weakly similar to sp|Q9P8X7 Aspergillu...   117   1e-27
YBR241C (YBR241C) [420] chr2 complement(702546..704012) Member o...   114   5e-27
KLLA0E14696g 1309427..1310860 weakly similar to sp|Q9P8X7 Asperg...   114   6e-27
KLLA0E25025g complement(2219051..2220721) weakly similar to sp|P...   115   6e-27
YDR387C (YDR387C) [1215] chr4 complement(1248142..1249809) Membe...   111   8e-26
Kwal_14.1105                                                          108   5e-25
Kwal_14.1625                                                          108   9e-25
Kwal_27.12815                                                         102   1e-24
AFL034W [3159] [Homologous to ScYBR241C - SH; ScYGL104C - SH] co...   107   1e-24
Sklu_2080.4 YBR241C, Contig c2080 4658-6229                           107   2e-24
YJR160C (MPH3) [3050] chr10 complement(737923..739731) Protein w...   105   2e-23
YDL247W (MPH2) [630] chr4 (5985..7814) Protein with maltose perm...   104   2e-23
CAGL0C01771g 187030..188487 similar to sp|P38142 Saccharomyces c...   102   4e-23
KLLA0D00253g <12780..14534 gi|5441459|emb|CAB46745.1 Kluyveromyc...   103   6e-23
KLLA0B00264g 12844..14574 gi|5441459|emb|CAB46745.1 Kluyveromyce...   102   7e-23
Kwal_33.12950                                                         102   8e-23
KLLA0E08987g 804915..806615 gi|22293246|emb|CAC79614.1 Kluyverom...   101   2e-22
Kwal_55.21289                                                          99   8e-22
Scas_597.5                                                             99   1e-21
KLLA0B14861g complement(1305927..1307690) gi|125935|sp|P07921|LA...    99   1e-21
KLLA0E01782g 171319..173037 weakly similar to ca|CA5798|IPF4181 ...    98   3e-21
YGL104C (VPS73) [1880] chr7 complement(308714..310174) Putative ...    97   3e-21
YBR298C (MAL31) [475] chr2 complement(802587..804431) Maltose pe...    97   6e-21
CAGL0K12716g complement(1260169..1261623) similar to sp|P43562 S...    93   9e-20
Scas_105.1                                                             83   1e-19
Kwal_27.10664                                                          92   3e-19
YFL040W (YFL040W) [1643] chr6 (51350..52972) Putative hexose tra...    89   1e-18
KLLA0D05379g complement(464200..465690) weakly similar to sp|P43...    89   2e-18
Scas_716.72                                                            89   2e-18
Kwal_27.12811                                                          84   2e-18
KLLA0E06743g complement(612941..614944) similar to ca|CA5798|IPF...    87   9e-18
YIL171W (HXT12) [2507] chr9 (19515..19844) Member of the hexose ...    77   4e-17
YGR289C (MAL11) [2234] chr7 complement(1073968..1075818) Maltose...    81   8e-16
AGL277W [4035] [Homologous to NOHBY] complement(185070..187085) ...    78   7e-15
Sklu_2375.1 YGR289C, Contig c2375 1376-3217 reverse complement         76   3e-14
Scas_652.12                                                            75   3e-14
Kwal_27.11079                                                          75   7e-14
KLLA0C19481g 1747623..1748795 similar to ca|CA3241|IPF7493 Candi...    68   5e-12
CAGL0B02475g 236029..237771 highly similar to sp|P25297 Saccharo...    51   2e-06
YML123C (PHO84) [3849] chr13 complement(24038..25801) High-affin...    50   3e-06
Kwal_27.11385                                                          48   6e-06
YDL199C (YDL199C) [675] chr4 complement(101291..103354) Member o...    49   9e-06
Scas_626.1                                                             45   1e-04
Sklu_2304.5 , Contig c2304 8691-10388                                  44   3e-04
KLLA0F13684g complement(1267367..1269082) similar to sp|Q04301 S...    43   5e-04
Kwal_26.7984                                                           42   8e-04
Scas_692.8                                                             38   0.018
Sklu_1567.2 YPR198W, Contig c1567 1150-2859                            35   0.15 
Sklu_1959.3 , Contig c1959 3851-5446 reverse complement                35   0.16 
Kwal_26.6669                                                           35   0.21 
Sklu_2289.2 , Contig c2289 5004-6585                                   35   0.22 
Kwal_56.23754                                                          34   0.29 
AGR076C [4386] [Homologous to ScYDR119W - SH] (871570..873630) [...    34   0.39 
Kwal_23.4814                                                           33   0.45 
Sklu_2394.9 YHR048W, Contig c2394 13885-15486                          33   0.46 
Scas_660.3                                                             33   0.48 
KLLA0F10043g complement(928691..930277) weakly similar to sp|P36...    33   0.87 
YMR088C (YMR088C) [4046] chr13 complement(443413..445101) Member...    32   1.3  
CAGL0J01375g 127843..129537 similar to sp|Q04301 Saccharomyces c...    32   1.7  
KLLA0C19459g 1746987..1747436 some similarities with ca|CA3241|I...    31   1.7  
KLLA0D10615g 903967..905322 similar to sp|P47159 Saccharomyces c...    31   2.2  
Scas_694.19                                                            31   3.0  
KLLA0C16852g 1471656..1473029 similar to sp|P25297 Saccharomyces...    31   3.3  
YOR378W (YOR378W) [5152] chr15 (1049507..1051054) Member of the ...    31   3.3  
YKR105C (YKR105C) [3356] chr11 complement(658352..660100) Member...    31   3.6  
ABR173C [766] [Homologous to ScYJR124C - SH] (727042..728352) [1...    30   3.8  
AFR322C [3514] [Homologous to ScYGR138C (TPO2) - SH; ScYPR156C (...    30   4.1  
Scas_713.30                                                            30   4.3  
Scas_721.15                                                            30   4.8  
Kwal_47.18976                                                          30   4.9  
AFR442C [3634] [Homologous to ScYML123C (PHO84) - SH] (1234199.....    30   5.2  
ADR336C [2077] [Homologous to ScYNR055C (HOL1) - NSH] (1299396.....    30   5.3  
KLLA0F17776g complement(1627198..1628859) similar to ca|CA1324|I...    30   5.3  
Sklu_1110.1 YDR119W, Contig c1110 22-1995                              30   5.4  
YBR180W (DTR1) [364] chr2 (589698..591416) Dityrosine transporte...    30   5.8  
Kwal_33.15638                                                          30   6.6  
Kwal_33.14268                                                          30   7.0  
Kwal_27.12173                                                          30   7.2  
Kwal_23.4824                                                           30   8.2  

>Scas_715.50
          Length = 559

 Score = 1045 bits (2703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/559 (92%), Positives = 517/559 (92%)

Query: 1   MSEDXXXXXXXXXXXXXXXFPDPKQIKSVEDVSLKVKTNENEGAPKPISAYFTVICLCLM 60
           MSED               FPDPKQIKSVEDVSLKVKTNENEGAPKPISAYFTVICLCLM
Sbjct: 1   MSEDSTTTYNSSGHSSSSTFPDPKQIKSVEDVSLKVKTNENEGAPKPISAYFTVICLCLM 60

Query: 61  IAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGI 120
           IAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGI
Sbjct: 61  IAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGI 120

Query: 121 ILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTL 180
           ILGRLGDFYGRKIGL            IQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTL
Sbjct: 121 ILGRLGDFYGRKIGLVCVVSVYVVGVVIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTL 180

Query: 181 ISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVL 240
           ISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVL
Sbjct: 181 ISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVL 240

Query: 241 GMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASW 300
           GMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASW
Sbjct: 241 GMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASW 300

Query: 301 AELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNF 360
           AELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNF
Sbjct: 301 AELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNF 360

Query: 361 SSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIV 420
           SSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIV
Sbjct: 361 SSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIV 420

Query: 421 FACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAIN 480
           FACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAIN
Sbjct: 421 FACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAIN 480

Query: 481 FYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYD 540
           FYYGFV               VCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYD
Sbjct: 481 FYYGFVFFGCLIFSFFYIFFFVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYD 540

Query: 541 VHATQNDDQTFFQKIFSKK 559
           VHATQNDDQTFFQKIFSKK
Sbjct: 541 VHATQNDDQTFFQKIFSKK 559

>CAGL0D02662g complement(278099..279793) highly similar to sp|P23585
           Saccharomyces cerevisiae YMR011w HXT2 high-affinity
           hexose transporter, start by similarity
          Length = 564

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/528 (69%), Positives = 433/528 (82%), Gaps = 2/528 (0%)

Query: 27  KSVEDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKR 86
           K   DVS    + E E  PKPISAYFTVICLCLMIAFGGF+FGWD GTI GFV QTDFKR
Sbjct: 37  KQTADVS--AMSPEAEAPPKPISAYFTVICLCLMIAFGGFVFGWDTGTISGFVAQTDFKR 94

Query: 87  RFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXX 146
           RFG+   +G YYLSDVRTGLIV  FN+GCA GG+ LGRLGD YGR++GL           
Sbjct: 95  RFGQQAADGSYYLSDVRTGLIVAIFNIGCAIGGLTLGRLGDMYGRRLGLMAVITVYVVGI 154

Query: 147 XIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIF 206
            IQISST  W QYF+GRIVSGLGVGGIAVLSPTLISE APKHLRG C+S YQLMIT GIF
Sbjct: 155 VIQISSTTTWYQYFVGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIF 214

Query: 207 VGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLA 266
           +GYCTNYG+K++TNSIQWR+PLGL FAWAL M++GM MVPESPR+L+EKG+FEEA+RSLA
Sbjct: 215 LGYCTNYGTKTHTNSIQWRVPLGLCFAWALFMLVGMSMVPESPRFLVEKGRFEEARRSLA 274

Query: 267 KSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQL 326
           +SNK ++DDPIV  E + I+AGVEAE++ GNASW ELFSTKGK+LQRV+MGIM+QSLQQL
Sbjct: 275 RSNKVSMDDPIVTAEIENISAGVEAEKSAGNASWGELFSTKGKILQRVVMGIMIQSLQQL 334

Query: 327 TGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASM 386
           TGCNYFFYYGTTIF+AVG++DS+ TSI+LG+VNF+STF++L+ V+RFGRRKCLLWGS++M
Sbjct: 335 TGCNYFFYYGTTIFKAVGLEDSFQTSIILGIVNFASTFVALYVVDRFGRRKCLLWGSSTM 394

Query: 387 ACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYP 446
           A C V+FAS+GV  LYPNG DQP+S +AGNVMIVF CL+IFCFA +WAP A+V+VAE+YP
Sbjct: 395 AVCMVIFASVGVKSLYPNGKDQPSSTTAGNVMIVFTCLYIFCFATTWAPTAYVIVAETYP 454

Query: 447 QRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETK 506
            R+K RAMAIAV  NWIW F IGF TPFIT+AINFYYG+V               VCETK
Sbjct: 455 LRVKNRAMAIAVGFNWIWGFLIGFFTPFITTAINFYYGYVFMGCLVFSFFYVFFFVCETK 514

Query: 507 GLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQK 554
           GL+LEE NEMYEEG LPWKS  W+P+++R + YDV A  +DD+ ++++
Sbjct: 515 GLTLEEVNEMYEEGVLPWKSAQWLPTTKRTSGYDVDAALHDDKPWYKR 562

>CAGL0D02640g 274285..275979 highly similar to sp|P23585
           Saccharomyces cerevisiae YMR011w HXT2 high-affinity
           hexose transporter, start by similarity
          Length = 564

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/528 (69%), Positives = 433/528 (82%), Gaps = 2/528 (0%)

Query: 27  KSVEDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKR 86
           K   DVS    + E E  PKPISAYFTVICLCLMIAFGGF+FGWD GTI GFV QTDFKR
Sbjct: 37  KQTADVS--AMSPEAEAPPKPISAYFTVICLCLMIAFGGFVFGWDTGTISGFVAQTDFKR 94

Query: 87  RFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXX 146
           RFG+   +G YYLSDVRTGLIV  FN+GCA GG+ LGRLGD YGR++GL           
Sbjct: 95  RFGQQAADGSYYLSDVRTGLIVAIFNIGCAIGGLTLGRLGDMYGRRLGLMAVITVYVVGI 154

Query: 147 XIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIF 206
            IQISST  W QYF+GRIVSGLGVGGIAVLSPTLISE APKHLRG C+S YQLMIT GIF
Sbjct: 155 VIQISSTTTWYQYFVGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIF 214

Query: 207 VGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLA 266
           +GYCTNYG+K++TNSIQWR+PLGL FAWAL M++GM MVPESPR+L+EKG+FEEA+RSLA
Sbjct: 215 LGYCTNYGTKTHTNSIQWRVPLGLCFAWALFMLVGMSMVPESPRFLVEKGRFEEARRSLA 274

Query: 267 KSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQL 326
           +SNK ++DDPIV  E + I+AGVEAE++ GNASW ELFSTKGK+LQRV+MGIM+QSLQQL
Sbjct: 275 RSNKVSMDDPIVTAEIENISAGVEAEKSAGNASWGELFSTKGKILQRVVMGIMIQSLQQL 334

Query: 327 TGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASM 386
           TGCNYFFYYGTTIF+AVG++DS+ TSI+LG+VNF+STF++L+ V+RFGRRKCLLWGS++M
Sbjct: 335 TGCNYFFYYGTTIFKAVGLEDSFQTSIILGIVNFASTFVALYVVDRFGRRKCLLWGSSTM 394

Query: 387 ACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYP 446
           A C V+FAS+GV  LYPNG DQP+S +AGNVMIVF CL+IFCFA +WAP A+V+VAE+YP
Sbjct: 395 AVCMVIFASVGVKSLYPNGKDQPSSTTAGNVMIVFTCLYIFCFATTWAPTAYVIVAETYP 454

Query: 447 QRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETK 506
            R+K RAMAIAV  NWIW F IGF TPFIT+AINFYYG+V               VCETK
Sbjct: 455 LRVKNRAMAIAVGFNWIWGFLIGFFTPFITTAINFYYGYVFMGCLVFSFFYVFFFVCETK 514

Query: 507 GLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQK 554
           GL+LEE NEMYEEG LPWKS  W+P+++R + YDV A  +DD+ ++++
Sbjct: 515 GLTLEEVNEMYEEGVLPWKSAQWLPTTKRTSGYDVDAALHDDKPWYKR 562

>Sklu_2380.2 YMR011W, Contig c2380 4381-6099 reverse complement
          Length = 572

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/537 (67%), Positives = 430/537 (80%), Gaps = 8/537 (1%)

Query: 23  PKQIKSVEDVSLKVKTNENEGAP----KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGF 78
           P    S +D  LK    ENE  P    K +S Y  V+CLCLM+AFGGF+FGWD GTI GF
Sbjct: 37  PSNKASRDDFDLK---PENEHFPEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGF 93

Query: 79  VGQTDFKRRFGELND-EGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXX 137
           V  TDFKRRFG  +  EG YYLS+VRTGLIV  FN+GCAFGG+ LGRLGD YGR++GL  
Sbjct: 94  VNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMC 153

Query: 138 XXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLY 197
                     IQI++ + W QYFIGRI+SGLGVGGIAVLSPTLISE APKHLRG C++ Y
Sbjct: 154 VVCVYVVGIIIQIATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFY 213

Query: 198 QLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGK 257
           QLMIT GIF+GYCTNYG+K+YTNS+QWR+PLG+ FAWA+ M+ GM++VPESPR+LIEKG+
Sbjct: 214 QLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGR 273

Query: 258 FEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMG 317
           FEEA+RS+AKSNK TV+DP V  E ++INAGVEAE+  G+A+W ELFS+KGK+LQRVIMG
Sbjct: 274 FEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQRVIMG 333

Query: 318 IMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRK 377
           +M+QSLQQLTG NYFFYYGTTIFQAVGMDDS+ TSIVLG+VNF+STF+ LW+VE+FGRRK
Sbjct: 334 VMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRK 393

Query: 378 CLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIA 437
           CLLWGSASMA CFVVFAS+GVT+L+PNG DQP+SK AGN MIVF C FIFCFA +WAPIA
Sbjct: 394 CLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVFTCFFIFCFATTWAPIA 453

Query: 438 FVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXX 497
           +V+V+ESYP R+K RAMAI+V +NWIW F IGF TPFITSAINFYYG+V           
Sbjct: 454 YVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLVFSYFY 513

Query: 498 XXXXVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQK 554
               VCETKGL+LEE NEMYEEG LPWKSD+W+P+ RRG DY+      DD+  +++
Sbjct: 514 VFFFVCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTEEAHTDDKPLYKR 570

>CAGL0I00286g complement(20521..22188) highly similar to sp|P23585
           Saccharomyces cerevisiae YMR011w HXT2 or sp|P39003
           Saccharomyces cerevisiae YDR343c HXT6 or sp|P39004
           Saccharomyces cerevisiae YDR342c HXT7, hypothetical
           start
          Length = 555

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/535 (66%), Positives = 422/535 (78%), Gaps = 3/535 (0%)

Query: 23  PKQIKSVEDVSLKVKTNENEGAP---KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFV 79
           P+     ED  LK      +GA    KP+ AY+TV+CLCLMIAFGGF+FGWD GTI GFV
Sbjct: 19  PETKLEGEDFQLKADEASIQGAEIPRKPLGAYWTVMCLCLMIAFGGFVFGWDTGTISGFV 78

Query: 80  GQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXX 139
            QTDFKRRFG+ + +G YYLS+VRTGLIV  FN+GCAFGG+ LGR GD YGRK GL    
Sbjct: 79  AQTDFKRRFGQRHSDGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRTGDLYGRKKGLVIVV 138

Query: 140 XXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQL 199
                   IQI+S + W QYFIGRI+SGLGVGGIAVLSPTLISE APKHLRG C+S YQL
Sbjct: 139 SVYVVGIIIQIASVDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQL 198

Query: 200 MITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFE 259
           MIT GIF+GYCTNYG+K+Y+NS+QWR+PLGL FAWAL M+ GM MVPESPR+L+EKG+ E
Sbjct: 199 MITLGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGMSMVPESPRFLVEKGRLE 258

Query: 260 EAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIM 319
           EA+RS+A SNK ++DDP V  E D I+AGVEAER  G+ASW ELFS KGK+L RVIMG+M
Sbjct: 259 EARRSIAISNKLSMDDPGVTFELDTISAGVEAERLAGSASWGELFSNKGKILPRVIMGVM 318

Query: 320 VQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCL 379
           +QSLQQLTG NYFFYYGTTIF+AVG++DS+ TSIVLG+VNF+STF+ LW+VERFGRR+CL
Sbjct: 319 IQSLQQLTGNNYFFYYGTTIFKAVGLEDSFQTSIVLGIVNFASTFVGLWTVERFGRRRCL 378

Query: 380 LWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFV 439
           LWGSA+MA CFV+FAS+GV  LYP+G D  +SK AGN MIVF C FIFCFA +WAPIA+V
Sbjct: 379 LWGSATMAACFVIFASVGVKSLYPHGRDHASSKGAGNCMIVFTCFFIFCFATTWAPIAYV 438

Query: 440 VVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXX 499
           +V+E+YP R+K RAMAIAV +NWIW F IGF TPFITSAINF YG+V             
Sbjct: 439 IVSETYPLRVKNRAMAIAVGSNWIWGFLIGFFTPFITSAINFSYGYVFMGCLVFSYFYVF 498

Query: 500 XXVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQK 554
             VCETKGL+LEE N+MYEEG LPWKS  W+P SRR A YD+ A  +DD+ ++++
Sbjct: 499 FFVCETKGLTLEEVNDMYEEGVLPWKSPNWVPPSRRDASYDIDAMMHDDKPWYKR 553

>YMR011W (HXT2) [3975] chr13 (288078..289703) High-affinity hexose
           transporter, member of the hexose transport family of
           the major facilitator superfamily (MFS) [1626 bp, 541
           aa]
          Length = 541

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/516 (67%), Positives = 414/516 (80%), Gaps = 1/516 (0%)

Query: 21  PDPKQIKSVED-VSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFV 79
           P  +++++ E  +  K +    E   KPI+AY+TVICLCLMIAFGGF+FGWD GTI GFV
Sbjct: 22  PIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFV 81

Query: 80  GQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXX 139
            QTDFKRRFG++  +G YYLSDVRTGLIV  FN+GCAFGG+ LGRLGD YGR+IGL    
Sbjct: 82  NQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVV 141

Query: 140 XXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQL 199
                   IQI+S++ W QYFIGRI+SG+GVGGIAVLSPTLISE APKH+RG C+S YQL
Sbjct: 142 LVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQL 201

Query: 200 MITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFE 259
           MIT GIF+GYCTNYG+K Y+NS+QWR+PLGL FA+A+ M+ GM+MVPESPR+L+EKG++E
Sbjct: 202 MITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYE 261

Query: 260 EAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIM 319
           +AKRSLAKSNK T++DP ++ E D I A VE ER  GNASW ELFS KG +L RVIMGIM
Sbjct: 262 DAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPRVIMGIM 321

Query: 320 VQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCL 379
           +QSLQQLTG NYFFYYGTTIF AVGM DS+ TSIVLG+VNF+STF++L++V++FGRRKCL
Sbjct: 322 IQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCL 381

Query: 380 LWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFV 439
           L GSASMA CFV+F+++GVT LYPNG DQP+SK+AGNVMIVF CLFIF FA+SWAPIA+V
Sbjct: 382 LGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYV 441

Query: 440 VVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXX 499
           +VAESYP R+K RAMAIAV ANWIW F IGF TPFITSAI F YG+V             
Sbjct: 442 IVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLVFSFFYVF 501

Query: 500 XXVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRR 535
             VCETKGL+LEE NEMY EG  PWKS +WI   +R
Sbjct: 502 FFVCETKGLTLEEVNEMYVEGVKPWKSGSWISKEKR 537

>Kwal_14.854
          Length = 570

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/516 (68%), Positives = 416/516 (80%), Gaps = 1/516 (0%)

Query: 40  ENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELN-DEGEYY 98
            NE   KP+S Y  V+CLCLM+AFGGF+FGWD GTI GFV  TDFKRRFG  +  E +Y 
Sbjct: 53  NNEIPQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYV 112

Query: 99  LSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQ 158
           LSDVRTGLIV  FN+GCA GG+ LGRLGD YGR++GL            IQI+S+N W Q
Sbjct: 113 LSDVRTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQ 172

Query: 159 YFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSY 218
           YFIGRIVSGLGVGGIAVLSPTLISE APKHLRG C+S YQLMIT GIF+GYCTNYG+K+Y
Sbjct: 173 YFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTY 232

Query: 219 TNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIV 278
           +N++QW++PLGL F WA+ M+ GM+ VPESPRYLIEKG FEEAKRS+AKSNK TV+D  V
Sbjct: 233 SNAVQWKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGV 292

Query: 279 LREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTT 338
           L E ++INAGVEAE+  GNASW ELFS KGK+LQRVIMG ++QSLQQLTG NYFFYYGTT
Sbjct: 293 LAEVELINAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTT 352

Query: 339 IFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGV 398
           IF AVGM DS+ TSIVLGVVNF+STF+ L++VER+GRRKCLLWGSA+M+ CFVVFAS+GV
Sbjct: 353 IFDAVGMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGV 412

Query: 399 TKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAV 458
           TKLYPNG D P+SKSAGN MI F CLFIF FA +WAPIA+V+V+E+YP R+K RAMA+AV
Sbjct: 413 TKLYPNGKDMPSSKSAGNAMIFFTCLFIFFFATTWAPIAYVIVSETYPLRVKNRAMAMAV 472

Query: 459 AANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYE 518
            +NWIW FAIGF TPFITSAI FYYG+V               VCETKGL+LEE NEMY+
Sbjct: 473 GSNWIWGFAIGFGTPFITSAIGFYYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYQ 532

Query: 519 EGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQK 554
           EG LPWKS+TW+P+ RR   YDV+ TQ D + F+++
Sbjct: 533 EGVLPWKSETWVPALRRNESYDVNETQEDSKPFYKR 568

>YFL011W (HXT10) [1671] chr6 (112339..113979) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1641 bp, 546 aa]
          Length = 546

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/508 (69%), Positives = 411/508 (80%), Gaps = 2/508 (0%)

Query: 30  EDVSLKVKTNENE-GAP-KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRR 87
           +++ L  +T E     P KPI AY+TV+ LCLMIAFGGFIFGWD GTI GF+ QTDFKRR
Sbjct: 23  DEIKLTPETREASLDIPYKPIIAYWTVMGLCLMIAFGGFIFGWDTGTISGFINQTDFKRR 82

Query: 88  FGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXX 147
           FGEL  +G + LSDVRTGLIV  FN+GCA GG+ LGRLGD YGRKIGL            
Sbjct: 83  FGELQRDGSFQLSDVRTGLIVGIFNIGCALGGLTLGRLGDIYGRKIGLMCVILVYVVGIV 142

Query: 148 IQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFV 207
           IQI+S++ W QYFIGRIVSG+GVGG+AVLSPTLISEI+PKHLRG C+S YQLMIT GIF+
Sbjct: 143 IQIASSDKWYQYFIGRIVSGMGVGGVAVLSPTLISEISPKHLRGTCVSFYQLMITLGIFL 202

Query: 208 GYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAK 267
           GYCTNYG+K Y+NSIQWR+PLGL FAWA+ MV+GM+MVPESPRYL+EKGK+EEA+RSLAK
Sbjct: 203 GYCTNYGTKKYSNSIQWRVPLGLCFAWAIFMVIGMVMVPESPRYLVEKGKYEEARRSLAK 262

Query: 268 SNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLT 327
           SNK TV DP V+ EFD I A +E ERA+GNASW ELFS KG +L RVIMGI++QSLQQLT
Sbjct: 263 SNKVTVTDPGVVFEFDTIVANMELERAVGNASWHELFSNKGAILPRVIMGIVIQSLQQLT 322

Query: 328 GCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMA 387
           GCNYFFYYGTTIF AVGM DS+ TSIVLG VNF+STF++L+ V++FGRRKCLLWGSASMA
Sbjct: 323 GCNYFFYYGTTIFNAVGMQDSFETSIVLGAVNFASTFVALYIVDKFGRRKCLLWGSASMA 382

Query: 388 CCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQ 447
            CFV+FA++GVT+L+P G DQP+S+SAGNVMIVF C FIF FA++WAPIA+V+VAE+YP 
Sbjct: 383 ICFVIFATVGVTRLWPQGKDQPSSQSAGNVMIVFTCFFIFSFAITWAPIAYVIVAETYPL 442

Query: 448 RIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKG 507
           R+K RAMAIAV ANW+W F IGF TPFIT +I F YG+V               VCETKG
Sbjct: 443 RVKNRAMAIAVGANWMWGFLIGFFTPFITRSIGFSYGYVFMGCLIFSYFYVFFFVCETKG 502

Query: 508 LSLEEFNEMYEEGTLPWKSDTWIPSSRR 535
           L+LEE NEMYEE   PWKS  WIPSSRR
Sbjct: 503 LTLEEVNEMYEERIKPWKSGGWIPSSRR 530

>Sklu_2362.1 YDR342C, Contig c2362 924-2642
          Length = 572

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/535 (63%), Positives = 417/535 (77%), Gaps = 5/535 (0%)

Query: 22  DPKQIKSVEDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQ 81
           D K ++  E+ + KV    NE   KP SAY TV  LCL +AFGGF+FGWD GTI GFV Q
Sbjct: 41  DLKDVRFPEEATEKV----NEIPAKPTSAYITVCLLCLCVAFGGFVFGWDTGTISGFVNQ 96

Query: 82  TDFKRRFGELNDE-GEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXX 140
           TDFKRRFG+ N + G YYLS+VRTGL+V  FN+GCA GGIIL ++GD YGR+IGL     
Sbjct: 97  TDFKRRFGQHNHKTGGYYLSNVRTGLLVGIFNIGCAIGGIILSKIGDLYGRRIGLMSVIL 156

Query: 141 XXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLM 200
                  I I++++ W QYFIGRI+SGLGVGGIAVL+P LISE APKHLRG  +S YQLM
Sbjct: 157 VYVVSVIISIAASDKWYQYFIGRIISGLGVGGIAVLAPMLISETAPKHLRGTLVSCYQLM 216

Query: 201 ITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEE 260
           IT GIF+GYCTNYG+K+Y NS+QWR+PLGLGFAWAL ++ GMM VPESPRYL+E GK EE
Sbjct: 217 ITAGIFLGYCTNYGTKNYDNSVQWRVPLGLGFAWALFVIAGMMFVPESPRYLVEVGKIEE 276

Query: 261 AKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMV 320
           A+RS+A+SNK T++DP V  E D+I AGVEAE+  G+ASW+ELFSTK KVLQR+IMG M+
Sbjct: 277 ARRSVARSNKVTIEDPGVQAEVDLITAGVEAEKLSGSASWSELFSTKTKVLQRLIMGAML 336

Query: 321 QSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLL 380
           Q LQQLTG NYFFYYGTTIF++VG+ DS+ TSIV+GVVNF+STF+ ++ VE+FGRRKCLL
Sbjct: 337 QCLQQLTGNNYFFYYGTTIFKSVGLTDSFQTSIVIGVVNFASTFVGIYVVEKFGRRKCLL 396

Query: 381 WGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVV 440
           WG+ASM  C VV+AS+GVT+L+PNG DQP+SK AGN MIVF C +IFC+A +WAPIA+VV
Sbjct: 397 WGAASMMVCMVVYASVGVTRLWPNGEDQPSSKGAGNCMIVFTCFYIFCYATTWAPIAWVV 456

Query: 441 VAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXX 500
            AES+P R+K + MAIA A+NWIW F I F TPFITSAINFYYG+V              
Sbjct: 457 TAESFPLRVKSKCMAIASASNWIWGFLIAFFTPFITSAINFYYGYVFMGCLVFMYFYVFF 516

Query: 501 XVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKI 555
            V ETKGL+LEE  E++EEG LPWKS +W+P S+R   YDV A Q+DD+ +++++
Sbjct: 517 FVPETKGLTLEEIQELWEEGVLPWKSASWVPPSKRDKGYDVEALQHDDKPWYKRV 571

>Scas_628.7
          Length = 593

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/525 (65%), Positives = 399/525 (76%), Gaps = 4/525 (0%)

Query: 22  DPKQIKSVEDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQ 81
           D  QI+  E+  +  + +      KP ++YFTVI LCL+IAFGGFIFGWD GTI GFV Q
Sbjct: 15  DSAQIEPKEEFIMDTEPS----IAKPAASYFTVIILCLLIAFGGFIFGWDTGTISGFVAQ 70

Query: 82  TDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXX 141
           TDF +RFG    +G + LSDVR GL+V  FN+GC  GG+ L   GD +GRK GL      
Sbjct: 71  TDFIKRFGTQQSDGSFALSDVRKGLMVGIFNIGCLLGGLFLAGAGDKWGRKPGLMLVAAV 130

Query: 142 XXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMI 201
                 IQI+S+  W QYF+GRIVSG+GVGGIAVLSPTLISEIAPK LRG CISLYQLMI
Sbjct: 131 YVVGIIIQITSSTKWYQYFVGRIVSGMGVGGIAVLSPTLISEIAPKQLRGTCISLYQLMI 190

Query: 202 TGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEA 261
           TGGIF+GYC N+G+K Y N++QWR+PLGLGFAWA  M++G++ VPESPRYL +KGK   A
Sbjct: 191 TGGIFLGYCANFGTKRYNNAVQWRLPLGLGFAWAFFMIIGLLFVPESPRYLFKKGKISAA 250

Query: 262 KRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQ 321
           K SLAKSNKTTVDD +VL E D I AG+EAE   GNASW ELFS K K+ QRV MG+M+Q
Sbjct: 251 KHSLAKSNKTTVDDILVLSELDNIRAGIEAENNAGNASWKELFSLKNKIFQRVFMGVMIQ 310

Query: 322 SLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLW 381
           SLQQLTGCNYFFYYGTTIFQAVGMDDS+VTSIVLGVVNF+STFI+L  VE  GRRKCLL 
Sbjct: 311 SLQQLTGCNYFFYYGTTIFQAVGMDDSFVTSIVLGVVNFASTFIALGIVEWLGRRKCLLL 370

Query: 382 GSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVV 441
           GSASMACCFV+FAS+GVT+L+PNG DQPTSK AG+ MIVF C+FIFCFA +WAPI FV+V
Sbjct: 371 GSASMACCFVIFASVGVTRLWPNGKDQPTSKGAGDCMIVFTCIFIFCFATTWAPIGFVIV 430

Query: 442 AESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXX 501
           AESYP R+KQRAMAIA+ ANWIW F IGF TPFITSAINFYYGFV               
Sbjct: 431 AESYPLRVKQRAMAIAIGANWIWGFLIGFFTPFITSAINFYYGFVFMGCLIFSFFYVFFF 490

Query: 502 VCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQN 546
           V ETKGL+LEE +EMY E   PWKS +W P +RR   YD   T +
Sbjct: 491 VRETKGLTLEEVDEMYLENIKPWKSASWSPRNRRDGAYDNDITSD 535

>YDR343C (HXT6) [1171] chr4 complement(1159598..1161310)
           High-affinity hexose transporter, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS), nearly identical to Hxt7p [1713 bp, 570 aa]
          Length = 570

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/514 (65%), Positives = 403/514 (78%)

Query: 46  KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTG 105
           +P SAY TV  +C+MIAFGGF+FGWD GTI GF+ QTDF RRFG  + +G  YLS VRTG
Sbjct: 57  RPASAYVTVSIMCIMIAFGGFVFGWDTGTISGFINQTDFIRRFGMKHKDGTNYLSKVRTG 116

Query: 106 LIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIV 165
           LIV  FN+GCA GGIIL +LGD YGRK+GL            IQI+S N W QYFIGRI+
Sbjct: 117 LIVSIFNIGCAIGGIILSKLGDMYGRKVGLIVVVVIYIIGIIIQIASINKWYQYFIGRII 176

Query: 166 SGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWR 225
           SGLGVGGIAVLSP LISE++PKHLRG  +S YQLMIT GIF+GYCTN+G+K+Y+NS+QWR
Sbjct: 177 SGLGVGGIAVLSPMLISEVSPKHLRGTLVSCYQLMITAGIFLGYCTNFGTKNYSNSVQWR 236

Query: 226 MPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVI 285
           +PLGL FAWAL M+ GM  VPESPRYL E GK EEAKRS+A SNK  VDDP VL E + +
Sbjct: 237 VPLGLCFAWALFMIGGMTFVPESPRYLAEVGKIEEAKRSIAVSNKVAVDDPSVLAEVEAV 296

Query: 286 NAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGM 345
            AGVEAE+  GNASW ELFS+K KVLQR+IMG M+QSLQQLTG NYFFYYGTTIF+AVG+
Sbjct: 297 LAGVEAEKLAGNASWGELFSSKTKVLQRLIMGAMIQSLQQLTGDNYFFYYGTTIFKAVGL 356

Query: 346 DDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNG 405
            DS+ TSIVLG+VNF+STF+ ++ VER+GRR CLLWG+ASM  C VV+AS+GVT+L+PNG
Sbjct: 357 SDSFETSIVLGIVNFASTFVGIYVVERYGRRTCLLWGAASMTACMVVYASVGVTRLWPNG 416

Query: 406 MDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWN 465
            DQP+SK AGN MIVFAC +IFCFA +WAPI +VVV+E++P R+K +AM+IA AANW+W 
Sbjct: 417 QDQPSSKGAGNCMIVFACFYIFCFATTWAPIPYVVVSETFPLRVKSKAMSIATAANWLWG 476

Query: 466 FAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPWK 525
           F IGF TPFIT AINFYYG+V               V ETKGL+LEE N M+EEG LPWK
Sbjct: 477 FLIGFFTPFITGAINFYYGYVFMGCLVFMFFYVLLVVPETKGLTLEEVNTMWEEGVLPWK 536

Query: 526 SDTWIPSSRRGADYDVHATQNDDQTFFQKIFSKK 559
           S +W+P SRRGA+YD     +DD+  ++++FS K
Sbjct: 537 SASWVPPSRRGANYDAEEMAHDDKPLYKRMFSTK 570

>YDR342C (HXT7) [1170] chr4 complement(1154206..1155918)
           High-affinity hexose transporter, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS), nearly identical to Hxt6p [1713 bp, 570 aa]
          Length = 570

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/514 (65%), Positives = 403/514 (78%)

Query: 46  KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTG 105
           +P SAY TV  +C+MIAFGGF+FGWD GTI GF+ QTDF RRFG  + +G  YLS VRTG
Sbjct: 57  RPASAYVTVSIMCIMIAFGGFVFGWDTGTISGFINQTDFIRRFGMKHKDGTNYLSKVRTG 116

Query: 106 LIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIV 165
           LIV  FN+GCA GGIIL +LGD YGRK+GL            IQI+S N W QYFIGRI+
Sbjct: 117 LIVSIFNIGCAIGGIILSKLGDMYGRKVGLIVVVVIYIIGIIIQIASINKWYQYFIGRII 176

Query: 166 SGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWR 225
           SGLGVGGIAVLSP LISE++PKHLRG  +S YQLMIT GIF+GYCTN+G+K+Y+NS+QWR
Sbjct: 177 SGLGVGGIAVLSPMLISEVSPKHLRGTLVSCYQLMITAGIFLGYCTNFGTKNYSNSVQWR 236

Query: 226 MPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVI 285
           +PLGL FAWAL M+ GM  VPESPRYL E GK EEAKRS+A SNK  VDDP VL E + +
Sbjct: 237 VPLGLCFAWALFMIGGMTFVPESPRYLAEVGKIEEAKRSIAVSNKVAVDDPSVLAEVEAV 296

Query: 286 NAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGM 345
            AGVEAE+  GNASW ELFS+K KVLQR+IMG M+QSLQQLTG NYFFYYGTTIF+AVG+
Sbjct: 297 LAGVEAEKLAGNASWGELFSSKTKVLQRLIMGAMIQSLQQLTGDNYFFYYGTTIFKAVGL 356

Query: 346 DDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNG 405
            DS+ TSIVLG+VNF+STF+ ++ VER+GRR CLLWG+ASM  C VV+AS+GVT+L+PNG
Sbjct: 357 SDSFETSIVLGIVNFASTFVGIYVVERYGRRTCLLWGAASMTACMVVYASVGVTRLWPNG 416

Query: 406 MDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWN 465
            DQP+SK AGN MIVFAC +IFCFA +WAPI +VVV+E++P R+K +AM+IA AANW+W 
Sbjct: 417 QDQPSSKGAGNCMIVFACFYIFCFATTWAPIPYVVVSETFPLRVKSKAMSIATAANWLWG 476

Query: 466 FAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPWK 525
           F IGF TPFIT AINFYYG+V               V ETKGL+LEE N M+EEG LPWK
Sbjct: 477 FLIGFFTPFITGAINFYYGYVFMGCLVFMFFYVLLVVPETKGLTLEEVNTMWEEGVLPWK 536

Query: 526 SDTWIPSSRRGADYDVHATQNDDQTFFQKIFSKK 559
           S +W+P SRRGA+YD     +DD+  ++++FS K
Sbjct: 537 SASWVPPSRRGANYDAEEMTHDDKPLYKRMFSTK 570

>Sklu_2376.5 , Contig c2376 9071-10810 reverse complement
          Length = 579

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/538 (62%), Positives = 418/538 (77%), Gaps = 3/538 (0%)

Query: 21  PDPK--QIKSVEDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGF 78
           P+ K  Q+   ++     K  E + A K  S Y  V   C+M+AFGGF+FGWD GTI GF
Sbjct: 41  PEAKGGQMGDEDEFDELQKAAEEQLAKKGTSEYLFVSICCVMVAFGGFVFGWDTGTISGF 100

Query: 79  VGQTDFKRRFGEL-NDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXX 137
           V  +DFKRRFG+  +  G YYLSDVR GLIV  FN+GCA GG++L ++G+ YGR+IGL  
Sbjct: 101 VNMSDFKRRFGQYKHSTGTYYLSDVRVGLIVAIFNIGCAIGGVVLSKIGEVYGRRIGLMA 160

Query: 138 XXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLY 197
                     IQI+S + W QYFIGRI+SGLGVGGI VLSP LISE APKHLRG  I+ Y
Sbjct: 161 VVVIYIIGIIIQIASIDKWYQYFIGRIISGLGVGGITVLSPMLISETAPKHLRGTLIASY 220

Query: 198 QLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGK 257
           QLMIT GIF+GYCTNYG+K+Y NS+QWR+PLGL FAWA+ M+ GM+ VPESPRYL+E GK
Sbjct: 221 QLMITAGIFLGYCTNYGTKNYENSVQWRVPLGLCFAWAIFMITGMLFVPESPRYLVEAGK 280

Query: 258 FEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMG 317
            EEAKRS+A+SNK T++DP V  E D+I AGVEAE+  G+ASW+ELFS K KVLQR+IMG
Sbjct: 281 IEEAKRSIARSNKVTIEDPAVQTEVDMICAGVEAEKLAGSASWSELFSAKTKVLQRLIMG 340

Query: 318 IMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRK 377
           IM+QSLQQLTG NYFFYYGTTIF++VGM+DS+ TSIV+G+VNF+STF SL++V++FGRRK
Sbjct: 341 IMIQSLQQLTGDNYFFYYGTTIFKSVGMEDSFETSIVIGIVNFASTFFSLYTVDKFGRRK 400

Query: 378 CLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIA 437
           C+LWG+++M  CFVVFAS+GVT+L+PNG DQP+SK AGN MIVF C +IFCFA +WAPIA
Sbjct: 401 CMLWGASTMVACFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVFTCFYIFCFATTWAPIA 460

Query: 438 FVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXX 497
           +V+VAES+P R+K + MAIA A+NW+W F IGF TPFITSAINFYYG+V           
Sbjct: 461 YVIVAESFPLRVKSKGMAIATASNWLWGFLIGFFTPFITSAINFYYGYVFMGCLVFAYFY 520

Query: 498 XXXXVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKI 555
               V ETKGL+LEE NEM+EEG LPWKS +WIPSSRRGADY+    Q+D++ +F+++
Sbjct: 521 VFFFVPETKGLTLEEVNEMWEEGVLPWKSSSWIPSSRRGADYNADDLQHDEKPWFKRM 578

>Kwal_55.20075
          Length = 571

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/513 (62%), Positives = 412/513 (80%), Gaps = 2/513 (0%)

Query: 46  KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTG 105
           KP SAY TV+ LCL +AFGGF+FGWD GTI GFV Q+DFKRRFG+ N +G++YLS+VRTG
Sbjct: 59  KPASAYITVVILCLCVAFGGFVFGWDTGTISGFVAQSDFKRRFGQTNSKGQHYLSNVRTG 118

Query: 106 LIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIV 165
           LIV  FN+GCAFGGI+L ++GD +GR+IGL            IQI+S + W QYFIGRI+
Sbjct: 119 LIVSIFNIGCAFGGILLSKIGDVWGRRIGLMAVVVVYVVGIIIQIASQDKWYQYFIGRII 178

Query: 166 SGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWR 225
           SGLGVGGIAVLSP LISE APKHLRG  ++ YQLMIT GIF+GYCTNYG K+Y+NSIQWR
Sbjct: 179 SGLGVGGIAVLSPMLISETAPKHLRGTLVACYQLMITCGIFLGYCTNYGVKNYSNSIQWR 238

Query: 226 MPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVI 285
           +PLGL FAWAL M+ GMM VPESPRYL+EKG+ E+AK S+A+SNK +V+DP V  E D+I
Sbjct: 239 VPLGLCFAWALFMIGGMMFVPESPRYLVEKGRIEDAKVSIARSNKISVEDPSVQVEVDLI 298

Query: 286 NAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGM 345
           +AGVEAE+  G+AS+ ELFS K KVLQR+IMGIM+QSLQQLTG NYFFYYGT IF++VG+
Sbjct: 299 SAGVEAEKLAGSASFKELFSAKTKVLQRLIMGIMLQSLQQLTGDNYFFYYGTIIFKSVGL 358

Query: 346 DDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNG 405
           +DS+ TSI++G+VNF+STF+ +++VE+FGRR+CLLWG+ASM  CFV++AS+GVT+LYP+G
Sbjct: 359 NDSFQTSIIIGIVNFASTFVGIFTVEKFGRRRCLLWGAASMVVCFVIYASVGVTRLYPDG 418

Query: 406 MDQP--TSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWI 463
            + P  ++K AGN MIVF C +IFCFA +WAPIA+VVV+ES+P R+K +AMA+A AANW+
Sbjct: 419 ANHPQNSNKGAGNCMIVFTCFYIFCFATTWAPIAYVVVSESFPLRVKSKAMALATAANWL 478

Query: 464 WNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLP 523
           W F I F TPFITSAI+FYYG+V               V ETKGL+LEE  E++EEG LP
Sbjct: 479 WGFLIAFFTPFITSAIHFYYGYVFMGCLVFAYFYVFFFVPETKGLTLEEVQELWEEGVLP 538

Query: 524 WKSDTWIPSSRRGADYDVHATQNDDQTFFQKIF 556
           WKS +W+PSS RG +Y+    ++DD+ +++++ 
Sbjct: 539 WKSTSWVPSSSRGVNYNAEDLKHDDKPWYKRVL 571

>Scas_658.24
          Length = 570

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/529 (60%), Positives = 399/529 (75%)

Query: 30  EDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFG 89
           +D+  +V     E   +P SAY TV  +C+MIAFGGF+FGWD GTI GFV QTDF RRFG
Sbjct: 41  DDIDAEVNPEVVEIPKRPASAYVTVSIMCIMIAFGGFVFGWDTGTISGFVAQTDFLRRFG 100

Query: 90  ELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQ 149
           + +  G +YLS VR GL+V  FN+GCAFGGIIL + GD YGRK+GL            IQ
Sbjct: 101 QKHHNGTHYLSKVRMGLMVSIFNIGCAFGGIILAKSGDIYGRKMGLIIVVCIYIVGIVIQ 160

Query: 150 ISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGY 209
           I+S   W QYFIGRI+SGLGVGGIAVLSP LISE++PKH+RG  +S YQLMIT GIF+GY
Sbjct: 161 IASVKAWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHMRGTLVSCYQLMITAGIFLGY 220

Query: 210 CTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSN 269
           CTNYG+K+Y+NS+QWR+PLGL FAWAL M+ GM  VPESPRYL+E GK EEAKRS+A SN
Sbjct: 221 CTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYLVEVGKIEEAKRSIALSN 280

Query: 270 KTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGC 329
           K + DDP VL E D + AGVEAE+  GNASW ELF TK K+ QR++MG M+Q LQQLTG 
Sbjct: 281 KISADDPAVLAEVDNVQAGVEAEKLAGNASWGELFQTKNKIFQRLVMGCMIQCLQQLTGD 340

Query: 330 NYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACC 389
           NYFFYYGT +F++VG++DS+ TSIV+GVVNF STF +L++V+RFGRR+CLLWG+A+   C
Sbjct: 341 NYFFYYGTIVFKSVGLEDSFQTSIVIGVVNFFSTFFALYTVDRFGRRRCLLWGAATTTVC 400

Query: 390 FVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRI 449
           FV++AS+GVT+LYPNG DQP+SK AGN MIVF C +IFCFA +WAPI FV+ +E++P R+
Sbjct: 401 FVIYASVGVTRLYPNGKDQPSSKGAGNCMIVFTCFYIFCFATTWAPIPFVINSETFPLRV 460

Query: 450 KQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLS 509
           K + M++A   NW+W F I F TPFIT AINFYYG+V               V ETKGL+
Sbjct: 461 KSKCMSLAQGCNWLWGFLISFFTPFITGAINFYYGYVFMGCLCFSFFYVFFFVPETKGLT 520

Query: 510 LEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIFSK 558
           LEE N M+EEG LPWKS  W+P SRRGADY+V     D++  ++++F +
Sbjct: 521 LEEVNTMWEEGVLPWKSTEWVPPSRRGADYNVDGLTKDEKPLYKRMFGR 569

>YLR081W (GAL2) [3496] chr12 (290213..291937) Galactose and glucose
           permease (facilitated diffusion transporter), member of
           the hexose transporter family of the major facilitator
           superfamily (MFS) [1725 bp, 574 aa]
          Length = 574

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/532 (61%), Positives = 402/532 (75%)

Query: 25  QIKSVEDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDF 84
           ++K+ E  S   ++   E   KP+S Y TV  LCL +AFGGF+FGWD GTI GFV QTDF
Sbjct: 42  ELKAGESGSEGSQSVPIEIPKKPMSEYVTVSLLCLCVAFGGFMFGWDTGTISGFVVQTDF 101

Query: 85  KRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXX 144
            RRFG  + +G +YLS+VRTGLIV  FN+GCAFGGIIL + GD YGRK GL         
Sbjct: 102 LRRFGMKHKDGTHYLSNVRTGLIVAIFNIGCAFGGIILSKGGDMYGRKKGLSIVVSVYIV 161

Query: 145 XXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGG 204
              IQI+S N W QYFIGRI+SGLGVGGIAVL P LISEIAPKHLRG  +S YQLMIT G
Sbjct: 162 GIIIQIASINKWYQYFIGRIISGLGVGGIAVLCPMLISEIAPKHLRGTLVSCYQLMITAG 221

Query: 205 IFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRS 264
           IF+GYCTNYG+KSY+NS+QWR+PLGL FAW+L M+  + +VPESPRYL E  K E+AKRS
Sbjct: 222 IFLGYCTNYGTKSYSNSVQWRVPLGLCFAWSLFMIGALTLVPESPRYLCEVNKVEDAKRS 281

Query: 265 LAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQ 324
           +AKSNK + +DP V  E D+I AG+EAE+  GNASW ELFSTK KV QR++MG+ VQ  Q
Sbjct: 282 IAKSNKVSPEDPAVQAELDLIMAGIEAEKLAGNASWGELFSTKTKVFQRLLMGVFVQMFQ 341

Query: 325 QLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSA 384
           QLTG NYFFYYGT IF++VG+DDS+ TSIV+GVVNF+STF SLW+VE  G RKCLL G+A
Sbjct: 342 QLTGNNYFFYYGTVIFKSVGLDDSFETSIVIGVVNFASTFFSLWTVENLGHRKCLLLGAA 401

Query: 385 SMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAES 444
           +M  C V++AS+GVT+LYP+G  QP+SK AGN MIVF C +IFC+A +WAP+A+V+ AES
Sbjct: 402 TMMACMVIYASVGVTRLYPHGKSQPSSKGAGNCMIVFTCFYIFCYATTWAPVAWVITAES 461

Query: 445 YPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCE 504
           +P R+K + MA+A A+NW+W F I F TPFITSAINFYYG+V               V E
Sbjct: 462 FPLRVKSKCMALASASNWVWGFLIAFFTPFITSAINFYYGYVFMGCLVAMFFYVFFFVPE 521

Query: 505 TKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIF 556
           TKGLSLEE  E++EEG LPWKS+ WIPSSRRG +YD+   Q+DD+ +++ + 
Sbjct: 522 TKGLSLEEIQELWEEGVLPWKSEGWIPSSRRGNNYDLEDLQHDDKPWYKAML 573

>KLLA0D13310g complement(1143027..1144730)
           gi|131828|sp|P18631|RAG1_KLULA Kluyveromyces lactis
           Low-affinity glucose transporter, start by similarity
          Length = 567

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/538 (60%), Positives = 407/538 (75%), Gaps = 2/538 (0%)

Query: 21  PDPKQIKSVEDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVG 80
           P+  ++   ED++   KT E     KP   Y  V   C+M+AFGGF+FGWD GTI GFV 
Sbjct: 30  PNDLKVSHEEDLNDLEKTAEETLQQKPAKEYIFVSLCCVMVAFGGFVFGWDTGTISGFVN 89

Query: 81  QTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXX 140
           QTDF RRFG+   +G +YLS+VRTGLIV  FN+GCA GGI+L  +GD +GR+IGL     
Sbjct: 90  QTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAVGGIVLSNIGDRWGRRIGLITVII 149

Query: 141 XXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLM 200
                  IQI+S + W QYFIGRI+SGLGVGGI VLSP LISE APKHLRG  +S YQLM
Sbjct: 150 IYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISETAPKHLRGTLVSCYQLM 209

Query: 201 ITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEE 260
           IT GIF+GYCTNYG+K+Y+NS+QWR+PLGL FAWA+ MVLGMM VPES R+L+E  + EE
Sbjct: 210 ITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMVLGMMFVPESARFLVETDQIEE 269

Query: 261 AKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMV 320
           A++SLAK+NK ++DDP+V  E   I + +E E+A GNASW EL + K  + +R +MGIM+
Sbjct: 270 ARKSLAKTNKVSIDDPVVKYELLKIQSSIELEKAAGNASWGELITGKPSMFRRTLMGIMI 329

Query: 321 QSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLL 380
           QSLQQLTG NYFFYYGTTIFQ+VGMDDS+ TSIVLG+VNF+STF +L++V+ FGRR CLL
Sbjct: 330 QSLQQLTGDNYFFYYGTTIFQSVGMDDSFETSIVLGIVNFASTFFALYTVDHFGRRNCLL 389

Query: 381 WGSASMACCFVVFASMGVTKLYPNGMDQP--TSKSAGNVMIVFACLFIFCFAVSWAPIAF 438
           +G   M  C+VV+AS+GVT+L+P+G D P  +SK AGN MIVFAC +IFCFA +WAPIA+
Sbjct: 390 YGCVGMVACYVVYASVGVTRLWPDGPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAY 449

Query: 439 VVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXX 498
           VV++ESYP R+K +AMAIA A+NWIW F IGF TPFITSAI+FYYG+V            
Sbjct: 450 VVISESYPLRVKGKAMAIASASNWIWGFLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYV 509

Query: 499 XXXVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIF 556
              V ETKGL+LEE NEMY EG LPWKS +W+PSSRRGA+YDV A Q+DD+ +++ + 
Sbjct: 510 YFFVPETKGLTLEEVNEMYSEGVLPWKSSSWVPSSRRGAEYDVDALQHDDKPWYKAML 567

>CAGL0A02211g complement(224864..226522) highly similar to sp|P39003
           Saccharomyces cerevisiae YDR343c HXT6 or sp|P39004
           Saccharomyces cerevisiae YDR342c HXT7, hypothetical
           start
          Length = 552

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/521 (61%), Positives = 398/521 (76%), Gaps = 6/521 (1%)

Query: 40  ENEGAP------KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELND 93
           + EG P      KP SAY ++   CL IAFGGF+FGWD GTI GFV QTDF RR G+   
Sbjct: 30  DEEGQPMVEIPKKPASAYVSISIFCLFIAFGGFVFGWDTGTISGFVAQTDFIRRLGQTRA 89

Query: 94  EGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISST 153
            G +YLS VRTGL+V  FN+GCA GGI+L +LGD YGRKIGL            IQI++ 
Sbjct: 90  NGTHYLSKVRTGLVVSIFNIGCAIGGIVLSKLGDMYGRKIGLISVVVIYIVGIVIQIATI 149

Query: 154 NNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNY 213
           + W QYFIGRI+SGLGVGGIAVLSP LISE++PKH+RG  +S YQLMIT GIF+GYCTNY
Sbjct: 150 DKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHMRGSLVSCYQLMITCGIFLGYCTNY 209

Query: 214 GSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTV 273
           G+K+Y+NS+QWR+PLGL FAWAL M+ GM  VPESPRYLIE G+ EEA+RS+A SNK + 
Sbjct: 210 GTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYLIEVGRVEEARRSIAISNKVSP 269

Query: 274 DDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFF 333
           DDP V  E + + A VEAER  G+ASW ELFSTK KV QR+IMGIM+QSLQQLTG NYFF
Sbjct: 270 DDPAVTFEVENVQAAVEAERLAGSASWGELFSTKTKVFQRLIMGIMIQSLQQLTGDNYFF 329

Query: 334 YYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVF 393
           YYGTT+F+AVG++DS+ TSIV+G+VNF+STF++L+ V+RFGRR+CLLWG+A+M  C VVF
Sbjct: 330 YYGTTVFKAVGLEDSFETSIVIGIVNFASTFVALYVVDRFGRRRCLLWGAAAMTACMVVF 389

Query: 394 ASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRA 453
           AS+GVT+L+PNG DQP+SK AGN MIVF C +IFCFA +WAPI FVV +E++P R+K + 
Sbjct: 390 ASVGVTRLWPNGQDQPSSKGAGNCMIVFTCFYIFCFATTWAPIPFVVNSETFPLRVKAKC 449

Query: 454 MAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEF 513
           MAIA A+NWIW F I F TPFIT+AINFYYG+V               + ETKGL+LEE 
Sbjct: 450 MAIAQASNWIWGFLIAFFTPFITNAINFYYGYVFMGCLCFSYFYVFFFIPETKGLTLEEV 509

Query: 514 NEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQK 554
           N ++EEG LPWKS  W+P S+R A YD  A  +DD+ ++++
Sbjct: 510 NTLWEEGVLPWKSPNWVPPSKRDASYDADAMMHDDKPWYKR 550

>AFL205C [2990] [Homologous to ScYHR094C - SH] (49039..50679) [1641
           bp, 546 aa]
          Length = 546

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/526 (60%), Positives = 398/526 (75%), Gaps = 9/526 (1%)

Query: 21  PDPKQIKSVEDVSLKVKTNENEGAP--------KPISAYFTVICLCLMIAFGGFIFGWDI 72
           PD + + S    +   K ++ E           KP SAY TV  LC+++AFGGFIFGWD 
Sbjct: 8   PDNRSVMSTHSSTASNKPSKEENKESGLVEIPVKPASAYITVSLLCILVAFGGFIFGWDT 67

Query: 73  GTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRK 132
           GTI GFV Q+D+K RFGELN+ G+YYLSD RTGLIV  FN+GCA GGI L +  D YGR+
Sbjct: 68  GTISGFVNQSDYKNRFGELNESGDYYLSDNRTGLIVAIFNIGCAVGGIFLSKFADMYGRR 127

Query: 133 IGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGM 192
           IGL            +QISST+ W QY IGR++SGLGVGGIAVLSP LISE +PKHLRGM
Sbjct: 128 IGLMIVTLVYVIGIVVQISSTDKWYQYCIGRVISGLGVGGIAVLSPMLISETSPKHLRGM 187

Query: 193 CISLYQLMITGGIFVGYCTNYGSKS-YTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRY 251
            +S YQLMIT GIFVGYC NYG+K+ Y +S QWR+PLGL FAWA++M+ GM++VPESPRY
Sbjct: 188 LVSCYQLMITAGIFVGYCANYGTKAKYEDSKQWRIPLGLSFAWAILMIGGMVLVPESPRY 247

Query: 252 LIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVL 311
           L+E  K+E+AKRSLA+SNK  VDDP +  EFD I+AG+E ER  G+ASW ELFSTK K+L
Sbjct: 248 LVEVNKYEDAKRSLARSNKVPVDDPSIQAEFDNIHAGIELERMAGSASWGELFSTKSKIL 307

Query: 312 QRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVE 371
           QRVIMG+M+QSLQQLTG NYFFYYGTTIF++VG++DS+ TSI+LG VNF STF+++W+V 
Sbjct: 308 QRVIMGVMIQSLQQLTGNNYFFYYGTTIFKSVGLEDSFQTSIILGAVNFGSTFVAVWAVG 367

Query: 372 RFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAV 431
           +FGRR+ +L G+A+M  C V+FAS+GVTKL+PNG DQP+SK AGNVMIVF C++IFCFA 
Sbjct: 368 KFGRRRLMLAGAAAMTVCMVIFASIGVTKLWPNGEDQPSSKPAGNVMIVFTCIYIFCFAT 427

Query: 432 SWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXX 491
           +WAPI FV+V+E++P R+K + MAIA AANWIW F I F TP IT+AI F YG+V     
Sbjct: 428 TWAPIPFVIVSETFPLRVKAKGMAIATAANWIWGFLIAFFTPKITNAIKFNYGYVFMGCL 487

Query: 492 XXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGA 537
                     V ETKGL+LEE  EM++EG +PWKS++W PS +R A
Sbjct: 488 IFAFFYMFFFVPETKGLTLEEVEEMWQEGVVPWKSESWTPSYKRNA 533

>CAGL0A02233g complement(231128..232777) highly similar to sp|P39003
           Saccharomyces cerevisiae YDR343c HXT6 or sp|P39004
           Saccharomyces cerevisiae YDR342c HXT7, hypothetical
           start
          Length = 549

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/535 (60%), Positives = 402/535 (75%), Gaps = 5/535 (0%)

Query: 27  KSVEDVSLKVKTNEN-----EGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQ 81
           K   +   K  T+E+     E   KP SAY  +   CL IAFGGF+FGWD GTI GFV Q
Sbjct: 15  KVEREDEFKAYTDEDGQPMVEIPKKPASAYVAISIFCLFIAFGGFVFGWDTGTISGFVAQ 74

Query: 82  TDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXX 141
           TDF RR G+    G +YLS VRTGLIV  FN+GCA GG++L +LGD YGRKIGL      
Sbjct: 75  TDFIRRMGQTRANGTHYLSKVRTGLIVSIFNIGCAIGGVVLSKLGDVYGRKIGLISVVVI 134

Query: 142 XXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMI 201
                 IQI++ + W QYFIGRI+SGLGVGGIAVLSP LISE++PKH+RG  +S YQLMI
Sbjct: 135 YIVGIVIQIATIDKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHMRGSLVSCYQLMI 194

Query: 202 TGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEA 261
           T GIF+GYCTNYG+K+Y+NS+QWR+PLGL FAWAL M+ GM  VPESPRYLIE G+ EEA
Sbjct: 195 TCGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYLIEVGRVEEA 254

Query: 262 KRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQ 321
           +RS+A SNK + DDP V  E + + AGVEAER  G+ASW ELFSTK K+ QR+IMGIM+Q
Sbjct: 255 RRSIAISNKVSPDDPAVTFEVENVQAGVEAERLAGSASWGELFSTKTKIFQRLIMGIMIQ 314

Query: 322 SLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLW 381
           SLQQLTG NYFFYYGTT+F+AVG++DS+ TSIV+G+VNF+STF++L+ V+RFGRR+CLLW
Sbjct: 315 SLQQLTGDNYFFYYGTTVFKAVGLEDSFETSIVIGIVNFASTFVALYVVDRFGRRRCLLW 374

Query: 382 GSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVV 441
           G+A+M  C VVFAS+GVT+LYP+GM QP+SK AGN MIVF C +IFCFA +WAPI FVV 
Sbjct: 375 GAAAMTACMVVFASVGVTRLYPHGMKQPSSKGAGNCMIVFTCFYIFCFATTWAPIPFVVN 434

Query: 442 AESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXX 501
           +E++P R+K + MAIA A+NWIW F I F TPFIT+AINFYYG+V               
Sbjct: 435 SETFPLRVKAKCMAIAQASNWIWGFLIAFFTPFITNAINFYYGYVFMGCLCFSYFYVFFF 494

Query: 502 VCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIF 556
           + ETKGL+LEE N M+EEG L WKS  W+P S+R A YD  A  +DD+ ++++ +
Sbjct: 495 IPETKGLTLEEVNTMWEEGVLAWKSPNWVPPSKRDASYDADALMHDDKPWYKRFY 549

>Scas_541.6
          Length = 573

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/540 (60%), Positives = 399/540 (73%), Gaps = 3/540 (0%)

Query: 23  PKQIKSVEDVSLKVKTNEN---EGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFV 79
           P      +DV   V+ +     E   KP SAY TV  +C+MIAFGGF+FGWD GTI GFV
Sbjct: 34  PSNKDDRDDVKEYVEEDPQIIAEIPKKPASAYVTVSIMCVMIAFGGFVFGWDTGTISGFV 93

Query: 80  GQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXX 139
            QTDF +RFG+ +  G++YLS VR GLIV  FN+GCA GGIIL +LGD YGRKIGL    
Sbjct: 94  AQTDFLQRFGQHHSNGKHYLSKVRMGLIVSIFNIGCAVGGIILSKLGDIYGRKIGLITVV 153

Query: 140 XXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQL 199
                   IQI+S   W QYFIGRI+SGLGVGGIAVLSP LISE++PKHLRG  +S YQL
Sbjct: 154 VIYVIGIIIQIASVKAWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHLRGTLVSCYQL 213

Query: 200 MITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFE 259
           MIT GIF+GYCTNYG+K+Y+NS+QWR+PLGL FAWAL M+ GM  VPESPR+L+E G+ +
Sbjct: 214 MITAGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESPRFLVEVGRID 273

Query: 260 EAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIM 319
           EAKRS+A SNK +VDDP VL E + + AGVEAE+  GNASW E+F TK KVLQR+IMG M
Sbjct: 274 EAKRSVAMSNKVSVDDPAVLGELETLQAGVEAEKLAGNASWGEIFQTKTKVLQRLIMGSM 333

Query: 320 VQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCL 379
           +QSLQQLTG NYFFYYGTT+F +VGM DS+ TSIVLG+VNF+STF+ ++ VER+GRR CL
Sbjct: 334 IQSLQQLTGDNYFFYYGTTVFTSVGMQDSFETSIVLGIVNFASTFVGIFLVERYGRRTCL 393

Query: 380 LWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFV 439
           LWG+A+M  C VVFAS+GVT+L+PNG D   SK AGN MI F C ++FCFA +WAPI FV
Sbjct: 394 LWGAATMTSCMVVFASVGVTRLWPNGKDGEASKGAGNCMICFTCFYLFCFATTWAPIPFV 453

Query: 440 VVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXX 499
           V +E++P R+K + M+I    NW+W F IGF TPFIT AI+FYYG+V             
Sbjct: 454 VNSETFPLRVKSKCMSITQGCNWLWGFLIGFFTPFITGAIDFYYGYVFMGCLCFSYFYVF 513

Query: 500 XXVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIFSKK 559
             V ETKGL+LEE N M+EEG LPWKS  W+P SRRG +YDV     DD+  F+++F +K
Sbjct: 514 FFVPETKGLTLEEVNTMWEEGVLPWKSAEWVPPSRRGENYDVAEMAKDDKPLFKRMFGRK 573

>YHR096C (HXT5) [2384] chr8 complement(294671..296449) Member of the
           hexose transporter family of the major facilitator
           superfamily (MFS) [1779 bp, 592 aa]
          Length = 592

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/508 (62%), Positives = 395/508 (77%), Gaps = 1/508 (0%)

Query: 52  FTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTF 111
           F  +C CLM+AFGGF+FGWD GTI GFV QTDF RRFG     G  YLSDVRTGL+V  F
Sbjct: 85  FVSVC-CLMVAFGGFVFGWDTGTISGFVRQTDFIRRFGSTRANGTTYLSDVRTGLMVSIF 143

Query: 112 NLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVG 171
           N+GCA GGI+L +LGD YGRKIGL            IQI+S + W QYFIGRI+SGLGVG
Sbjct: 144 NIGCAIGGIVLSKLGDMYGRKIGLMTVVVIYSIGIIIQIASIDKWYQYFIGRIISGLGVG 203

Query: 172 GIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLG 231
           GI VL+P LISE++PK LRG  +S YQLMIT GIF+GYCTN+G+K+Y+NS+QWR+PLGL 
Sbjct: 204 GITVLAPMLISEVSPKQLRGTLVSCYQLMITFGIFLGYCTNFGTKNYSNSVQWRVPLGLC 263

Query: 232 FAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEA 291
           FAW++ M++GM  VPESPRYL+E GK EEAKRSLA++NKTT D P+V  E +   + +EA
Sbjct: 264 FAWSIFMIVGMTFVPESPRYLVEVGKIEEAKRSLARANKTTEDSPLVTLEMENYQSSIEA 323

Query: 292 ERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVT 351
           ER  G+ASW EL + K ++ +R +MG+M+QSLQQLTG NYFFYYGTTIFQAVG++DS+ T
Sbjct: 324 ERLAGSASWGELVTGKPQMFRRTLMGMMIQSLQQLTGDNYFFYYGTTIFQAVGLEDSFET 383

Query: 352 SIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTS 411
           +IVLGVVNF STF SL++V+RFGRR CLLWG   M CC+VV+AS+GVT+L+PNG DQP+S
Sbjct: 384 AIVLGVVNFVSTFFSLYTVDRFGRRNCLLWGCVGMICCYVVYASVGVTRLWPNGQDQPSS 443

Query: 412 KSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFC 471
           K AGN MIVFAC +IFCFA +WAP+A+V+++ESYP R++ +AM+IA A NWIW F I F 
Sbjct: 444 KGAGNCMIVFACFYIFCFATTWAPVAYVLISESYPLRVRGKAMSIASACNWIWGFLISFF 503

Query: 472 TPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPWKSDTWIP 531
           TPFITSAINFYYG+V               V ETKGL+LEE NEMYEE  LPWKS  WIP
Sbjct: 504 TPFITSAINFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNEMYEENVLPWKSTKWIP 563

Query: 532 SSRRGADYDVHATQNDDQTFFQKIFSKK 559
            SRR  DYD+ AT+ND + F++++F+K+
Sbjct: 564 PSRRTTDYDLDATRNDPRPFYKRMFTKE 591

>YOL156W (HXT11) [4669] chr15 (25272..26975) Low-affinity glucose
           permease, member of the hexose transporter family of the
           major facilitator superfamily (MFS), may be involved in
           uptake of drugs [1704 bp, 567 aa]
          Length = 567

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/541 (61%), Positives = 397/541 (73%), Gaps = 4/541 (0%)

Query: 21  PDPKQIKSVEDVSLKVKTNEN--EGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGF 78
           P  K        SL +  NE   +   KP+SAY TV  LCLMIAFGGFIFGWD GTI GF
Sbjct: 26  PSVKTEHGDSKNSLNLDANEPPIDLPQKPLSAYTTVAILCLMIAFGGFIFGWDTGTISGF 85

Query: 79  VGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXX 138
           V  +DF RRFG+ ND+G YYLS VR GLIV  FN+GCA GGI+L ++GD YGR+IGL   
Sbjct: 86  VNLSDFIRRFGQKNDKGTYYLSKVRMGLIVSIFNIGCAIGGIVLSKVGDIYGRRIGLITV 145

Query: 139 XXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQ 198
                    IQI+S N W QYFIGRI+SGLGVGGIAVLSP LISE+APKH+RG  + LYQ
Sbjct: 146 TAIYVVGILIQITSINKWYQYFIGRIISGLGVGGIAVLSPMLISEVAPKHIRGTLVQLYQ 205

Query: 199 LMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKF 258
           LM T GIF+GYCTNYG+K+Y N+ QWR+ LGL FAWA  MV GMM VPESPRYLIE GK 
Sbjct: 206 LMGTMGIFLGYCTNYGTKNYHNATQWRVGLGLCFAWATFMVSGMMFVPESPRYLIEVGKD 265

Query: 259 EEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGI 318
           EEAKRSL+KSNK +VDDP +L E+D I AG+E E+  GNASW+EL STK KV QRV+MG+
Sbjct: 266 EEAKRSLSKSNKVSVDDPALLVEYDTIKAGIELEKLAGNASWSELLSTKTKVFQRVLMGV 325

Query: 319 MVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKC 378
           M+QSLQQLTG NYFFYYGTTIF++VG+ DS+ TSI++GVVNF S+FI+++++ERFGRR C
Sbjct: 326 MIQSLQQLTGDNYFFYYGTTIFKSVGLKDSFQTSIIIGVVNFFSSFIAVYTIERFGRRTC 385

Query: 379 LLWGSASMACCFVVFASMGVTKLYPNGMDQP--TSKSAGNVMIVFACLFIFCFAVSWAPI 436
           LLWG+ASM CCF VFAS+GVTKL+P G      TS+ AGN MIVF   FIF FA +WA  
Sbjct: 386 LLWGAASMLCCFAVFASVGVTKLWPQGSSHQDITSQGAGNCMIVFTMFFIFSFATTWAGG 445

Query: 437 AFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXX 496
            +V+V+E++P R+K R MAIA AANW+W F I F TPFIT AINFYYG+V          
Sbjct: 446 CYVIVSETFPLRVKSRGMAIATAANWMWGFLISFFTPFITGAINFYYGYVFLGCLVFAYF 505

Query: 497 XXXXXVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIF 556
                V ETKGL+LEE N M+ EG   WKS +W+P  RR ADYD  A  +D++  +++ F
Sbjct: 506 YVFFFVPETKGLTLEEVNTMWLEGVPAWKSASWVPPERRTADYDADAIDHDNRPIYKRFF 565

Query: 557 S 557
           S
Sbjct: 566 S 566

>YJL219W (HXT9) [2711] chr10 (19497..21200) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS), may play a role in drug uptake [1704 bp, 567 aa]
          Length = 567

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/514 (63%), Positives = 387/514 (75%), Gaps = 2/514 (0%)

Query: 46  KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTG 105
           KP+SAY TV  LCLMIAFGGFIFGWD GTI GFV  +DF RRFG+ ND+G YYLS VR G
Sbjct: 53  KPLSAYTTVAILCLMIAFGGFIFGWDTGTISGFVNLSDFIRRFGQKNDKGTYYLSKVRMG 112

Query: 106 LIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIV 165
           LIV  FN+GCA GGI+L ++GD YGR+IGL            IQI+S N W QYFIGRI+
Sbjct: 113 LIVSIFNIGCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRII 172

Query: 166 SGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWR 225
           SGLGVGGIAVLSP LISE+APK +RG  + LYQLM T GIF+GYCTNYG+K+Y N+ QWR
Sbjct: 173 SGLGVGGIAVLSPMLISEVAPKQIRGTLVQLYQLMCTMGIFLGYCTNYGTKNYHNATQWR 232

Query: 226 MPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVI 285
           + LGL FAW   MV GMM VPESPRYLIE GK EEAKRSL+KSNK +VDDP +L E+D I
Sbjct: 233 VGLGLCFAWTTFMVSGMMFVPESPRYLIEVGKDEEAKRSLSKSNKVSVDDPALLAEYDTI 292

Query: 286 NAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGM 345
            AG+E E+  GNASW+EL STK KV QRV+MG+M+QSLQQLTG NYFFYYGTTIF++VG+
Sbjct: 293 KAGIELEKLAGNASWSELLSTKTKVFQRVLMGVMIQSLQQLTGDNYFFYYGTTIFKSVGL 352

Query: 346 DDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNG 405
            DS+ TSI++GVVNF S+FI+++++ERFGRR CLLWG+ASM CCF VFAS+GVTKL+P G
Sbjct: 353 KDSFQTSIIIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLWPQG 412

Query: 406 MDQP--TSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWI 463
                 TS+ AGN MIVF   FIF FA +WA   +V+V+E++P R+K R MAIA AANW+
Sbjct: 413 SSHQDITSQGAGNCMIVFTMFFIFSFATTWAGGCYVIVSETFPLRVKSRGMAIATAANWM 472

Query: 464 WNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLP 523
           W F I F TPFIT AINFYYG+V               V ETKGL+LEE N M+ EG   
Sbjct: 473 WGFLISFFTPFITGAINFYYGYVFLGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGVPA 532

Query: 524 WKSDTWIPSSRRGADYDVHATQNDDQTFFQKIFS 557
           WKS +W+P  RR ADYD  A  +DD+  +++ FS
Sbjct: 533 WKSASWVPPERRTADYDADAIDHDDRPIYKRFFS 566

>AFL207C [2988] [Homologous to ScAFL207C] (44349..45968) [1620 bp,
           539 aa]
          Length = 539

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/496 (63%), Positives = 383/496 (77%), Gaps = 1/496 (0%)

Query: 46  KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTG 105
           KP +AY TV  LC+ +AFGGFIFGWD GTI GFV QTDF+RRF ++NDEG YY S+ R G
Sbjct: 36  KPATAYITVCLLCVFVAFGGFIFGWDTGTISGFVNQTDFRRRFAQVNDEGGYYWSNARVG 95

Query: 106 LIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIV 165
           LIV  FN+GCA GGIIL RLGD YGR+IGL            IQISS   W QY IGR++
Sbjct: 96  LIVAIFNIGCAVGGIILSRLGDMYGRRIGLMIVSLIYVVGIIIQISSNTKWYQYCIGRVI 155

Query: 166 SGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKS-YTNSIQW 224
           SGLGVGGIAVLSP LISE +PKHLRG  +S YQLMIT GI +GYC NYG+KS Y +S QW
Sbjct: 156 SGLGVGGIAVLSPMLISETSPKHLRGTLVSCYQLMITAGILLGYCANYGTKSRYDDSRQW 215

Query: 225 RMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDV 284
           R+PLGL F WA+ M+ GM  VPESPRYLIEK K EEAKRSLA SNK  VDDP +L E + 
Sbjct: 216 RIPLGLCFLWAIFMITGMAFVPESPRYLIEKDKIEEAKRSLATSNKVPVDDPAILAEVNN 275

Query: 285 INAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVG 344
           I AGVE ER  G+ASW ELF+ + K+LQRVIMG M+QSLQQLTG NYFFYYGTTIF +VG
Sbjct: 276 IQAGVELERMAGSASWGELFTVRTKILQRVIMGAMIQSLQQLTGNNYFFYYGTTIFDSVG 335

Query: 345 MDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPN 404
           ++D++ TSI+LG VNF STF+++++V+RFGRRKCLL+G+A+MA C V+FAS+GVT+L+PN
Sbjct: 336 LEDAFKTSIILGAVNFGSTFVAMYTVDRFGRRKCLLYGAAAMAVCMVIFASVGVTRLWPN 395

Query: 405 GMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIW 464
           G DQP+S+ AGN MIVF CL+IF FA +WAPIA+V+V+E++P R+K + MAIA AANWIW
Sbjct: 396 GPDQPSSRPAGNAMIVFTCLYIFFFATTWAPIAYVIVSETFPLRVKAKGMAIATAANWIW 455

Query: 465 NFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPW 524
            F I F TP+IT+AI FYYG+V               V ETKGL+LEE  EM++EG +PW
Sbjct: 456 GFLIAFFTPYITNAIRFYYGYVFMGCLIFAFFYIFFFVPETKGLTLEEVEEMWQEGVVPW 515

Query: 525 KSDTWIPSSRRGADYD 540
           +S++W+PS+RR A Y 
Sbjct: 516 RSESWVPSARRHAPYS 531

>CAGL0A00737g 74767..76416 highly similar to sp|P39003 Saccharomyces
           cerevisiae YDR343c HXT6 or sp|P39004 Saccharomyces
           cerevisiae YDR342c HXT7, hypothetical start
          Length = 549

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/515 (62%), Positives = 394/515 (76%)

Query: 42  EGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSD 101
           E   KP SAY  +  LCL IAFGGF+FGWD GTI GFV + DF +R G+      YYLS 
Sbjct: 35  EIPKKPASAYTLIFILCLFIAFGGFVFGWDTGTISGFVAEEDFIKRLGQRRANNTYYLSK 94

Query: 102 VRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFI 161
           VRTGLIV  FN+GCA GG++L + GD YGRKIGL            IQI++ + W QYFI
Sbjct: 95  VRTGLIVSIFNIGCAIGGVVLSKFGDMYGRKIGLIIVIVVYIVGIVIQIATIDKWYQYFI 154

Query: 162 GRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNS 221
           GRIVSGLGVGGIAVLSP LISE++PKH+RG  +S YQLM+T GIF+GYCTNYG+K+Y NS
Sbjct: 155 GRIVSGLGVGGIAVLSPMLISEVSPKHMRGTLVSCYQLMVTCGIFLGYCTNYGTKNYPNS 214

Query: 222 IQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLRE 281
           +QWR+PLGL FAWAL M+ GM+ VPESPRYL+E GKFEEA+RS+A SNK T +DP V  E
Sbjct: 215 VQWRVPLGLCFAWALFMIGGMLCVPESPRYLVEVGKFEEARRSIAISNKLTPEDPAVTFE 274

Query: 282 FDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQ 341
            + + AGVEAER  G+ASW ELFSTK KVLQR+IMGIM+Q LQQLTG NYFFYYGTT+F+
Sbjct: 275 LENVQAGVEAERLAGSASWGELFSTKTKVLQRLIMGIMLQCLQQLTGDNYFFYYGTTVFK 334

Query: 342 AVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKL 401
           AVG++DS+ TSIV+G+VNF+STF++L+ V+RFGRRKCLLWG+ASM  C VVFAS+GVT+L
Sbjct: 335 AVGLEDSFQTSIVIGIVNFASTFVALYVVDRFGRRKCLLWGAASMTACMVVFASVGVTRL 394

Query: 402 YPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAAN 461
           YPNGMDQP+SK AGN MIVF C +IFCFA +WAP  +V+ +E++P R+K + MAI  AAN
Sbjct: 395 YPNGMDQPSSKGAGNCMIVFTCFYIFCFATTWAPTPWVINSETFPLRVKAKCMAICQAAN 454

Query: 462 WIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGT 521
           WIW F I F TPFIT AINFYYG+V               + ETKGL+LEE N M+EEG 
Sbjct: 455 WIWGFLIAFFTPFITGAINFYYGYVFMGCLCFSYFYVFFFIPETKGLTLEEVNTMWEEGV 514

Query: 522 LPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIF 556
           LPWKS  WIP S+R A YD  A  +DD+ ++++++
Sbjct: 515 LPWKSPDWIPPSKRDATYDADAMMHDDKPWYRRMW 549

>YDR345C (HXT3) [1172] chr4 complement(1162947..1164650)
           Low-affinity hexose transporter, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1704 bp, 567 aa]
          Length = 567

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/540 (60%), Positives = 404/540 (74%), Gaps = 5/540 (0%)

Query: 21  PDPKQIKS-VEDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFV 79
           P+ K ++   +  + +V TN N G      AY TV   C+M+AFGGF+FGWD GTI GFV
Sbjct: 32  PEEKGVQDDFQAEADQVLTNPNTGK----GAYVTVSICCVMVAFGGFVFGWDTGTISGFV 87

Query: 80  GQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXX 139
            QTDF RRFG  + +G YYLS VRTGLIV  FN+GCA GGIIL +LGD YGRK+GL    
Sbjct: 88  AQTDFLRRFGMKHKDGSYYLSKVRTGLIVSIFNIGCAIGGIILAKLGDMYGRKMGLIVVV 147

Query: 140 XXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQL 199
                   IQI+S N W QYFIGRI+SGLGVGGIAVLSP LISE+APK +RG  +S YQL
Sbjct: 148 VIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPMLISEVAPKEMRGTLVSCYQL 207

Query: 200 MITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFE 259
           MIT GIF+GYCTN+G+K+Y+NS+QWR+PLGL FAWAL M+ GM  VPESPRYL+E G+ +
Sbjct: 208 MITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYLVEAGQID 267

Query: 260 EAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIM 319
           EA+ SL+K NK   D P + +E +VI A VE  RA G+ASW ELF+ K  + +R +MGIM
Sbjct: 268 EARASLSKVNKVAPDHPFIQQELEVIEASVEEARAAGSASWGELFTGKPAMFKRTMMGIM 327

Query: 320 VQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCL 379
           +QSLQQLTG NYFFYYGTT+F AVGM DS+ TSIV GVVNF ST  SL++V+RFGRR CL
Sbjct: 328 IQSLQQLTGDNYFFYYGTTVFNAVGMSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCL 387

Query: 380 LWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFV 439
           L+G+  M CC+VV+AS+GVT+L+PNG    +SK AGN MIVFAC +IFCFA +WAPIA+V
Sbjct: 388 LYGAIGMVCCYVVYASVGVTRLWPNGEGNGSSKGAGNCMIVFACFYIFCFATTWAPIAYV 447

Query: 440 VVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXX 499
           V++E++P R+K +AM+IA AANW+W F IGF TPFIT AINFYYG+V             
Sbjct: 448 VISETFPLRVKSKAMSIATAANWLWGFLIGFFTPFITGAINFYYGYVFMGCMVFAYFYVF 507

Query: 500 XXVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIFSKK 559
             V ETKGL+LEE N+MY EG LPWKS +W+P+S+RGA+YD  A  +DDQ F++K+F KK
Sbjct: 508 FFVPETKGLTLEEVNDMYAEGVLPWKSASWVPTSQRGANYDADALMHDDQPFYKKMFGKK 567

>YHR094C (HXT1) [2383] chr8 complement(290915..292627) Low-affinity
           hexose transporter, member of the hexose transporter
           family of the major facilitator superfamily (MFS),
           induced by glucose only at high concentration [1713 bp,
           570 aa]
          Length = 570

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/544 (59%), Positives = 395/544 (72%), Gaps = 8/544 (1%)

Query: 24  KQIKSVEDVSLKVKTNENEGAPKPISA--------YFTVICLCLMIAFGGFIFGWDIGTI 75
           K + + E  +     N +E   +P  A        Y TV   C+M+AFGGFIFGWD GTI
Sbjct: 27  KAMNTPEGKNESFHDNLSESQVQPAVAPPNTGKGVYVTVSICCVMVAFGGFIFGWDTGTI 86

Query: 76  GGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGL 135
            GFV QTDF RRFG  + +G +YLS VRTGLIV  FN+GCA GGI+L +LGD YGR+IGL
Sbjct: 87  SGFVAQTDFLRRFGMKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGL 146

Query: 136 XXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCIS 195
                       IQI+S N W QYFIGRI+SGLGVGGI VLSP LISE+AP  +RG  +S
Sbjct: 147 IVVVVIYTIGIIIQIASINKWYQYFIGRIISGLGVGGITVLSPMLISEVAPSEMRGTLVS 206

Query: 196 LYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEK 255
            YQ+MIT GIF+GYCTN+G+K+Y+NS+QWR+PLGL FAWAL M+ GMM VPESPRYL+E 
Sbjct: 207 CYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIGGMMFVPESPRYLVEA 266

Query: 256 GKFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVI 315
           G+ +EA+ SLAK NK   D P +  E + I A VE  RA G ASW ELF+ K  + QR +
Sbjct: 267 GRIDEARASLAKVNKCPPDHPYIQYELETIEASVEEMRAAGTASWGELFTGKPAMFQRTM 326

Query: 316 MGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGR 375
           MGIM+QSLQQLTG NYFFYYGT +FQAVG+ DS+ TSIV GVVNF ST  SL++V+RFGR
Sbjct: 327 MGIMIQSLQQLTGDNYFFYYGTIVFQAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGR 386

Query: 376 RKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAP 435
           R CL+WG+  M CC+VV+AS+GVT+L+PNG DQP+SK AGN MIVFAC +IFCFA +WAP
Sbjct: 387 RNCLMWGAVGMVCCYVVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAP 446

Query: 436 IAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXX 495
           IA+VV++E +P R+K + M+IA AANWIW F I F TPFIT AINFYYG+V         
Sbjct: 447 IAYVVISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGCMVFAY 506

Query: 496 XXXXXXVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKI 555
                 V ETKGLSLEE N+MY EG LPWKS +W+P S+RGADY+     +DDQ F++ +
Sbjct: 507 FYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYNADDLMHDDQPFYKSL 566

Query: 556 FSKK 559
           FS+K
Sbjct: 567 FSRK 570

>CAGL0A01826g complement(179321..180922) highly similar to sp|P38695
           Saccharomyces cerevisiae YHR096c HXT5, hypothetical
           start
          Length = 533

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/508 (63%), Positives = 398/508 (78%), Gaps = 1/508 (0%)

Query: 52  FTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTF 111
           F  +C C+M+AFGGF+FGWD GTI GFV QTDF RRFG+   +G YYLS+VRTGLIV  F
Sbjct: 27  FVSLC-CIMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQQRSDGTYYLSNVRTGLIVAIF 85

Query: 112 NLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVG 171
           N+GCA GGI L +LGD +GR++GL            IQI+S + W QYFIGRI+SGLGVG
Sbjct: 86  NIGCAIGGITLSKLGDIWGRRLGLVTVVVVYTIGIVIQIASIDKWYQYFIGRIISGLGVG 145

Query: 172 GIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLG 231
           GIAVLSP LISE++PK LRG  +S YQLMIT GIF+GYCTNYG+K+Y+NS+QWR+PLGL 
Sbjct: 146 GIAVLSPMLISEVSPKQLRGTLVSCYQLMITCGIFLGYCTNYGTKNYSNSVQWRVPLGLC 205

Query: 232 FAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEA 291
           FAWAL M+ G+M VPESPRYL+E GK EEAKRSLA++NKTTVD PIVL E D   A VEA
Sbjct: 206 FAWALFMIFGVMCVPESPRYLVEVGKLEEAKRSLARANKTTVDSPIVLLELDKYQASVEA 265

Query: 292 ERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVT 351
           ER  G+ASW EL + K ++L+R IMG+M+QSLQQLTG NYFFYYGTTIF+AVG+DDS+ T
Sbjct: 266 ERLAGSASWGELVTGKPQMLRRTIMGMMIQSLQQLTGANYFFYYGTTIFRAVGLDDSFQT 325

Query: 352 SIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTS 411
           +IVLGVVNF STF +L++V+ +GRR CL+WG   M CC+VV+AS+GVT+L+PNG    +S
Sbjct: 326 AIVLGVVNFVSTFYALYTVDHYGRRNCLMWGCVGMVCCYVVYASVGVTRLWPNGEGNGSS 385

Query: 412 KSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFC 471
           K AGN MIVFAC FIFCFA +WAPIA+V+V+ESYP RI+ +AM+IA+AANWIW F I F 
Sbjct: 386 KGAGNCMIVFACFFIFCFATTWAPIAYVIVSESYPLRIRGKAMSIAIAANWIWGFLIAFF 445

Query: 472 TPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPWKSDTWIP 531
           TPFITSAINFYYG+V               V ETKGL+LEE N+MYEEG LPWKS +W+P
Sbjct: 446 TPFITSAINFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNQMYEEGVLPWKSSSWVP 505

Query: 532 SSRRGADYDVHATQNDDQTFFQKIFSKK 559
             RR A+Y++    +DD+ +++++FS+ 
Sbjct: 506 PDRRTAEYNLDDYSHDDKPWYKRVFSRN 533

>YHR092C (HXT4) [2382] chr8 complement(287131..288813) Moderate- to
           low-affinity hexose transporter, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1683 bp, 560 aa]
          Length = 560

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/505 (63%), Positives = 384/505 (76%)

Query: 31  DVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGE 90
           D + +   N  E   KP SAY TV   CLM+AFGGF+FGWD GTI GFV QTDF RRFG 
Sbjct: 48  DENHEESNNYVEIPKKPASAYVTVSICCLMVAFGGFVFGWDTGTISGFVAQTDFIRRFGM 107

Query: 91  LNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQI 150
            + +G YYLS VRTGLIV  FN+GCA GGIIL +LGD YGRK+GL            IQI
Sbjct: 108 KHHDGTYYLSKVRTGLIVSIFNIGCAIGGIILAKLGDMYGRKMGLIVVVVIYIIGIIIQI 167

Query: 151 SSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYC 210
           +S N W QYFIGRI+SGLGVGGIAVLSP LISE++PKH+RG  +S YQLMIT GIF+GYC
Sbjct: 168 ASINKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHIRGTLVSCYQLMITLGIFLGYC 227

Query: 211 TNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNK 270
           TNYG+K+YTNS+QWR+PLGLGFAWAL M+ GM  VPESPRYL+E GK EEAKRS+A SNK
Sbjct: 228 TNYGTKTYTNSVQWRVPLGLGFAWALFMIGGMTFVPESPRYLVEVGKIEEAKRSIALSNK 287

Query: 271 TTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCN 330
            + DDP V+ E +V+ A VEAE+  GNASW E+FSTK KV QR+IMG M+QSLQQLTG N
Sbjct: 288 VSADDPAVMAEVEVVQATVEAEKLAGNASWGEIFSTKTKVFQRLIMGAMIQSLQQLTGDN 347

Query: 331 YFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCF 390
           YFFYYGTT+F AVG++DS+ TSIVLG+VNF+STF+ ++ VER+GRR+CLLWG+ASM  C 
Sbjct: 348 YFFYYGTTVFTAVGLEDSFETSIVLGIVNFASTFVGIFLVERYGRRRCLLWGAASMTACM 407

Query: 391 VVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIK 450
           VVFAS+GVT+L+PNG    +SK AGN MIVF C ++FCFA +WAPI FVV +E++P R+K
Sbjct: 408 VVFASVGVTRLWPNGKKNGSSKGAGNCMIVFTCFYLFCFATTWAPIPFVVNSETFPLRVK 467

Query: 451 QRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSL 510
            + MAIA A NWIW F IGF TPFI+ AI+FYYG+V               V ETKGL+L
Sbjct: 468 SKCMAIAQACNWIWGFLIGFFTPFISGAIDFYYGYVFMGCLVFSYFYVFFFVPETKGLTL 527

Query: 511 EEFNEMYEEGTLPWKSDTWIPSSRR 535
           EE N ++EEG LPWKS +W   +R 
Sbjct: 528 EEVNTLWEEGVLPWKSPSWFHQTRE 552

>CAGL0A01782g complement(170326..172032) highly similar to sp|P39003
           Saccharomyces cerevisiae YDR343c HXT6 or sp|P39004
           Saccharomyces cerevisiae YDR342c HXT7, hypothetical
           start
          Length = 568

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/509 (61%), Positives = 387/509 (76%)

Query: 46  KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTG 105
           KP SAY TV   CL IAFGGF+FGWD GTI GFV QTDF RR G+    G +YLS VRTG
Sbjct: 58  KPASAYVTVSIFCLFIAFGGFVFGWDTGTISGFVAQTDFIRRLGQKRANGTHYLSKVRTG 117

Query: 106 LIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIV 165
           L+V  FN+GCA GG+IL +LGD YGRK GL            IQI++ + W QYFIGRI+
Sbjct: 118 LVVSIFNIGCAIGGVILSKLGDVYGRKPGLIIVVVIYVVGIIIQIATIDKWYQYFIGRII 177

Query: 166 SGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWR 225
           SGLGVGGIAVLSP LISE++PKHLR   ++ YQLMIT GIF+GYCTN+G+K+Y+NS+QWR
Sbjct: 178 SGLGVGGIAVLSPMLISEVSPKHLRATLVACYQLMITLGIFLGYCTNFGTKNYSNSVQWR 237

Query: 226 MPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVI 285
           +PLGL FAWA+ M+ GM  VPESPR+L+EKG+ E+AKRS+A SNK +VDDP V+ E D +
Sbjct: 238 VPLGLCFAWAIFMISGMTFVPESPRFLVEKGRIEDAKRSIASSNKVSVDDPAVVAEVDSV 297

Query: 286 NAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGM 345
            A VEAER  G+ASW ELFSTK K+ QR++MGIM+QSLQQLTG NYFFYYGT +F+AVG+
Sbjct: 298 QAAVEAERLAGSASWGELFSTKTKIFQRLVMGIMIQSLQQLTGDNYFFYYGTIVFKAVGL 357

Query: 346 DDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNG 405
           +DS+ TSIV+GVVNF STF+ ++ V RFGRR CLLWG+A+M  C VVFAS+GVT+L+P+G
Sbjct: 358 EDSFETSIVIGVVNFFSTFVGIFLVGRFGRRTCLLWGAATMTACMVVFASVGVTRLWPHG 417

Query: 406 MDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWN 465
               +SK AGN MIVF C +IFCFA +WAP+AFV+ +E++P R+K + MA+A A+NWIW 
Sbjct: 418 KGNGSSKGAGNCMIVFTCFYIFCFATTWAPLAFVICSETFPLRVKAKCMALAQASNWIWG 477

Query: 466 FAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPWK 525
           F I F TPFIT AINF YG+V               V ETKGL+LEE N M+EEG LPWK
Sbjct: 478 FLISFFTPFITDAINFNYGYVFMGCLCFSYFYVFFFVPETKGLTLEEVNTMWEEGVLPWK 537

Query: 526 SDTWIPSSRRGADYDVHATQNDDQTFFQK 554
           +  W+P SRRGADYD  A  +DD  ++++
Sbjct: 538 ASQWVPPSRRGADYDADALMHDDTPWYKR 566

>Scas_712.1
          Length = 558

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/533 (59%), Positives = 387/533 (72%), Gaps = 4/533 (0%)

Query: 30  EDVSLKVKTNEN---EGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKR 86
           +D+S  ++TNE    +   KP SAY  V   CLM+AFGGFI GWD GTIGGF+   DF  
Sbjct: 27  KDLS-DLETNEQHVIDIPQKPASAYIAVCIFCLMVAFGGFISGWDTGTIGGFLAHPDFVG 85

Query: 87  RFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXX 146
           RFG  + +G  Y S+VRTGL+V  FN+GC  G + LGRLGD YGR+IG+           
Sbjct: 86  RFGSKHSDGTPYFSNVRTGLLVSIFNIGCCVGAVFLGRLGDMYGRRIGIVLAVIIYIVGI 145

Query: 147 XIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIF 206
            IQI+S + W QYFIGRIV+GLG G IAVLSP LISE++PKHLRG  +S YQLMIT GIF
Sbjct: 146 VIQIASVDKWYQYFIGRIVAGLGSGTIAVLSPMLISEVSPKHLRGTLVSCYQLMITFGIF 205

Query: 207 VGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLA 266
           +GYC NYG+K Y NSIQWR+PLGL FAWAL ++  M  VPESPRYL+E GK EEAKRS+A
Sbjct: 206 LGYCANYGTKKYNNSIQWRVPLGLCFAWALFLIAAMFFVPESPRYLVEAGKIEEAKRSVA 265

Query: 267 KSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQL 326
           +SNK ++DDP  + E ++I   VE+ERA G+ASW ELF TK KVL R IM +MV +LQQL
Sbjct: 266 QSNKVSIDDPATIAEVEIIQVAVESERAAGSASWGELFQTKTKVLPRTIMCVMVLALQQL 325

Query: 327 TGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASM 386
           TGCNYFFYYGT +F AVGM DSY TSIV G+VNF+STF++L+ V++FGRR CLLWG+A M
Sbjct: 326 TGCNYFFYYGTIVFNAVGMSDSYETSIVFGIVNFASTFVALYVVDKFGRRTCLLWGAAGM 385

Query: 387 ACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYP 446
            CC VVFAS+GV  L+P+G D P+SK AGN MIVF+C FIFCFA SWAPI FV+V+ES+P
Sbjct: 386 VCCMVVFASVGVKSLHPHGDDGPSSKGAGNCMIVFSCFFIFCFATSWAPIPFVIVSESFP 445

Query: 447 QRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETK 506
            +IK + MAI   +N +WNF IGF TPFIT AI+FYYG+V               V ETK
Sbjct: 446 TKIKAKGMAIGTVSNQLWNFCIGFFTPFITGAIDFYYGYVFLGCLVFAYCYVFMFVPETK 505

Query: 507 GLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIFSKK 559
           GL LE+ N M+EEG LPWKS  W+P S+RGADYD     NDD+  ++++  K 
Sbjct: 506 GLQLEDVNIMWEEGVLPWKSSAWVPPSQRGADYDAQELANDDKPAWKRMVGKN 558

>Sklu_2415.2 YJL214W, Contig c2415 2182-3897 reverse complement
          Length = 571

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/540 (57%), Positives = 403/540 (74%), Gaps = 6/540 (1%)

Query: 23  PKQIKSVEDVS-LKVKTNENEGAP----KPISAYFTVICLCLMIAFGGFIFGWDIGTIGG 77
           P    S  D+  LK +  E E       KP SAY TV  +CL +AFGGF+ GWD GTI G
Sbjct: 32  PSNKASRADLDELKFQAEETEIVAEIPKKPASAYITVSIMCLCVAFGGFVVGWDTGTISG 91

Query: 78  FVGQTDFKRRFGEL-NDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLX 136
           FV QTDFKRRFGE  + + EYYLS+VR GLIV  FN+GCA GG++L +LGD YGR IGL 
Sbjct: 92  FVNQTDFKRRFGEYSHSKDEYYLSNVRVGLIVSIFNVGCAVGGLVLSKLGDIYGRCIGLM 151

Query: 137 XXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISL 196
                      IQISS + W QYFIGRIVSGLGVGG+ VL+P LISE APKHLRG  ++ 
Sbjct: 152 AVTIVYVVGIVIQISSVDKWYQYFIGRIVSGLGVGGVCVLAPMLISETAPKHLRGTLLAC 211

Query: 197 YQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKG 256
           +QLM+T  IF+GYC NYG+KSY NS+QWR+PLGL FAWA+IMV+GM  VPESPR+L++ G
Sbjct: 212 WQLMVTFAIFLGYCANYGTKSYDNSVQWRVPLGLCFAWAIIMVVGMCFVPESPRFLVKVG 271

Query: 257 KFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIM 316
           + E+AKRS+AKSNK +V+DP V  E D+I AGVE E+  G++SW ELFS K KV QR++M
Sbjct: 272 RVEDAKRSVAKSNKISVEDPAVQAEVDLIAAGVEVEKLAGSSSWGELFSKKTKVFQRLVM 331

Query: 317 GIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRR 376
            +M+ SLQQL+G NYFFYYGTTIF++VGM+DS+ TSIV+G++NF+STF+SL+++++ GRR
Sbjct: 332 SVMINSLQQLSGDNYFFYYGTTIFKSVGMEDSFETSIVIGIINFASTFLSLYTLDKLGRR 391

Query: 377 KCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPI 436
           + LLWG+A M  C +++AS+GVT+LYP+G DQP+SK AGN MIVF CL+IF FA +W P 
Sbjct: 392 RSLLWGAAIMTVCMLIYASVGVTRLYPDGKDQPSSKPAGNCMIVFTCLYIFFFANTWGPT 451

Query: 437 AFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXX 496
            +V+++ES+P R+K + M++A  AN++W F IGF TPFITSAINFYYG+V          
Sbjct: 452 CYVIISESFPLRVKSKCMSVATGANYLWGFLIGFFTPFITSAINFYYGYVFMGCLVFSYF 511

Query: 497 XXXXXVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIF 556
                V ETKGL+LEE  EM+ EG LPWKS++W+PSSRR  +YD    Q+D++ +++++ 
Sbjct: 512 YVFFFVPETKGLTLEEVEEMWHEGVLPWKSESWVPSSRRDVNYDAEKLQHDEKPWYKRML 571

>Scas_658.23
          Length = 568

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/530 (59%), Positives = 393/530 (74%), Gaps = 6/530 (1%)

Query: 30  EDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFG 89
           E V+  V  N  +GA      Y TV   C+M+AFGGF+FGWD GTI GFV QTDF RRFG
Sbjct: 45  EQVTELVNPNNGKGA------YVTVSICCVMVAFGGFVFGWDTGTISGFVAQTDFLRRFG 98

Query: 90  ELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQ 149
           + +  G  YLS VR GLIV  FN+GCA GGI+L RLGD +GRK+GL            IQ
Sbjct: 99  QKHHNGTPYLSKVRMGLIVSIFNIGCAIGGIVLARLGDTHGRKMGLIIVVCIYIVGIIIQ 158

Query: 150 ISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGY 209
           I+S   W QYFIGRI+SGLGVGGIAVLSP LISE+APK +RG  +S YQLMIT GIF+GY
Sbjct: 159 IASVKAWYQYFIGRIISGLGVGGIAVLSPMLISEVAPKEMRGTLVSCYQLMITLGIFLGY 218

Query: 210 CTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSN 269
           CTNYG+K+Y+NS+QWR+PLGL FAWAL M+ GM  VPESPRYL+E GK +EA+ SL+K N
Sbjct: 219 CTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYLVEAGKIDEARASLSKVN 278

Query: 270 KTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGC 329
           KT  D P + +E ++I A VE  RA G+ASW ELF+ K  +LQR ++GIM+QSLQQLTG 
Sbjct: 279 KTPGDHPFIQQELELIEASVEEARAAGSASWGELFTGKPAMLQRTMLGIMIQSLQQLTGD 338

Query: 330 NYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACC 389
           NYFFYYGTT+F AVGM DS+ TSIV G+VN +ST  SL++V++FGRR CLLWG+  M CC
Sbjct: 339 NYFFYYGTTVFTAVGMQDSFETSIVFGIVNLASTCCSLYTVDKFGRRNCLLWGAVGMVCC 398

Query: 390 FVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRI 449
           +VV+AS+GVT+L+PNG    +SK AGN MI FAC +IFCFA +WAPIA+VV++E++P R+
Sbjct: 399 YVVYASVGVTRLWPNGEGNGSSKGAGNCMICFACFYIFCFATTWAPIAYVVISETFPLRV 458

Query: 450 KQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLS 509
           K +AM++A AANW+W F IGF TPFIT AINFYYG+V               V ETKGL+
Sbjct: 459 KSKAMSVATAANWLWGFLIGFFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPETKGLT 518

Query: 510 LEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIFSKK 559
           LEE N+MY EG +PWKS +W+P SRRGADY++    +DD   ++++F +K
Sbjct: 519 LEEVNDMYSEGVVPWKSASWVPPSRRGADYNIDELAHDDTPIYKRMFGRK 568

>CAGL0A02321g complement(247500..249170) highly similar to sp|P32466
           Saccharomyces cerevisiae YDR345c HXT3 or sp|P42833
           Saccharomyces cerevisiae YNL318c HXT14, hypothetical
           start
          Length = 556

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/543 (56%), Positives = 391/543 (72%), Gaps = 3/543 (0%)

Query: 20  FPDPKQIKSVEDVSLKVKTNENEGA---PKPISAYFTVICLCLMIAFGGFIFGWDIGTIG 76
           +P      S +   L   T E E     P   SAY  V   C ++AFGGFIFGWD GTI 
Sbjct: 14  YPSQNSDNSYKRDDLDPDTLEKEAKIENPNGKSAYIAVSISCALVAFGGFIFGWDTGTIS 73

Query: 77  GFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLX 136
           GFV QTDF RR G  + +G  YLS VRTGL+V  FN+GCA GG++L ++GD  GRK GL 
Sbjct: 74  GFVNQTDFIRRIGSKHADGTSYLSKVRTGLVVGIFNIGCAIGGVVLSKIGDTKGRKAGLV 133

Query: 137 XXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISL 196
                      IQI++ + W QYFIGRI+SGLGVGGI+VLSPTLISE+APK LRG  +SL
Sbjct: 134 TVVLIYIVGIVIQIATIDKWYQYFIGRIISGLGVGGISVLSPTLISEVAPKELRGSLVSL 193

Query: 197 YQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKG 256
           YQ+MIT GIF+GYCTNYG+K+Y+NS+QWR+PLGL FAWAL+M+ GM  VPESPRYLIE G
Sbjct: 194 YQIMITLGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALLMIGGMTFVPESPRYLIEAG 253

Query: 257 KFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIM 316
             + A++SL  +NK   + P + +EF ++ A VE   A G ASW+EL + K  +L+R IM
Sbjct: 254 DDDAARKSLCAANKLPAEHPFIEQEFTILKAKVEEANAAGTASWSELITGKPAMLRRTIM 313

Query: 317 GIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRR 376
           GIM+QSLQQLTG NYFFYYGTT+F+AVG++DS+ TSIV GVVNF STF+SL++V+RFGRR
Sbjct: 314 GIMIQSLQQLTGDNYFFYYGTTVFKAVGLEDSFQTSIVFGVVNFFSTFLSLFTVDRFGRR 373

Query: 377 KCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPI 436
            CLL+G+A M CC+VV+AS+GVT+L+PNG    +SK AGN MIVF+C +IFCFA +WAPI
Sbjct: 374 NCLLYGAAGMVCCYVVYASVGVTRLWPNGQGNGSSKGAGNCMIVFSCFYIFCFATTWAPI 433

Query: 437 AFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXX 496
           A+V+++ES+P RIK +AM+IA A+NWIW F I F TPFIT+AINFYYG+V          
Sbjct: 434 AYVIISESFPLRIKTKAMSIASASNWIWGFLIAFFTPFITNAINFYYGYVFMGCMVFAYF 493

Query: 497 XXXXXVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIF 556
                V ET+GL+LEE +EMY EG LPWKS  W+P S R   YD  A  +DD  +++++ 
Sbjct: 494 YVFFFVNETRGLTLEEVDEMYAEGVLPWKSSKWVPESERDDSYDADALLHDDTPWYKRVI 553

Query: 557 SKK 559
            + 
Sbjct: 554 GRN 556

>Scas_509.2
          Length = 568

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/543 (58%), Positives = 395/543 (72%), Gaps = 10/543 (1%)

Query: 27  KSVEDVSLKVKTNENEG-------APKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFV 79
            S++  +   K N +EG         KP SAY T+   C MI FGGFI GWD GTIGGF+
Sbjct: 26  NSIKAENESFKENSDEGNEVVVEIPKKPASAYVTISIFCCMIGFGGFISGWDTGTIGGFL 85

Query: 80  GQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXX 139
              D+ RRFG+ +  G +Y S+VRTGL+V  FN+G  FG +ILG L +  GRK+ L    
Sbjct: 86  AHPDYLRRFGQHHKNGTHYFSNVRTGLVVSIFNIGGLFGCLILGDLANRIGRKMALVAVV 145

Query: 140 XXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQL 199
                   IQI+S + W QYFIGRI+SGLGVG I++ SP L+SE+APKHLRG   S+YQL
Sbjct: 146 VIFMVGIIIQIASIDKWYQYFIGRIISGLGVGAISIFSPMLLSEVAPKHLRGTLGSMYQL 205

Query: 200 MITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFE 259
           M+T GIF+G CTNYG+K+Y NS+QWR+PLGL FAW L M+  M  VPESPRYL+E GK E
Sbjct: 206 MVTAGIFLGDCTNYGTKNYDNSVQWRVPLGLSFAWCLFMIAAMFFVPESPRYLVEVGKIE 265

Query: 260 EAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIM 319
           EAKRS+A SNK ++DDP V  E D+I++GVEAER  GNASWAELFSTKGK +QR+ M  M
Sbjct: 266 EAKRSIATSNKVSMDDPAVQAEVDLISSGVEAERLAGNASWAELFSTKGKNIQRLFMCCM 325

Query: 320 VQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCL 379
           +Q LQQLTGCNYFFYYGT IFQAVGM DSY T+IV G+VNF+STF++L+ V+RFGRRKCL
Sbjct: 326 LQCLQQLTGCNYFFYYGTVIFQAVGMKDSYQTAIVFGIVNFASTFVALYVVDRFGRRKCL 385

Query: 380 LWGSASMACCFVVFASMGVTKLYPNGM---DQPTSKSAGNVMIVFACLFIFCFAVSWAPI 436
           +WG+A+M CC+VV+AS+GVT+LYP+G+   D  +SK AGN MI F+C FIF FA +WAPI
Sbjct: 386 MWGAAAMVCCYVVYASVGVTRLYPDGIKHKDTNSSKGAGNCMICFSCFFIFSFACTWAPI 445

Query: 437 AFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXX 496
            +VVV+ES+P RIK + MA+A   NW WNF I F TPFIT AINFYYG+V          
Sbjct: 446 CWVVVSESFPLRIKPKGMALANGCNWFWNFLISFFTPFITGAINFYYGYVFMGCMVFAYF 505

Query: 497 XXXXXVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIF 556
                V E KGL+LEE NE++E+G LPWKS  W+PSSRRGAD D+ A Q DD+  F+K+F
Sbjct: 506 YVFFFVPEMKGLTLEEVNELWEDGVLPWKSPDWVPSSRRGADVDMDAFQKDDKPLFKKMF 565

Query: 557 SKK 559
            +K
Sbjct: 566 GRK 568

>CAGL0A01804g complement(175488..177179) highly similar to sp|P32466
           Saccharomyces cerevisiae YDR345c HXT3, start by
           similarity
          Length = 563

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/529 (58%), Positives = 389/529 (73%), Gaps = 4/529 (0%)

Query: 30  EDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFG 89
           E V  ++  N N G      A+  VI  C M+AFGGF+FGWD GTI GFV Q DF  RFG
Sbjct: 38  EFVQNEMIANPNTGK----GAFVGVIISCFMVAFGGFVFGWDTGTISGFVAQKDFIHRFG 93

Query: 90  ELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQ 149
             + +G  YLS VRTGLIV  FN+GCA GGIIL +LGD  GRK+GL            IQ
Sbjct: 94  MKHPDGTEYLSKVRTGLIVSIFNIGCAIGGIILSKLGDTKGRKMGLVVVVVIYIVGIIIQ 153

Query: 150 ISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGY 209
           I+S N W QYFIGRI+SGLGVGGI+VLSP LISE+AP  LRG  +S YQLMIT GIF+GY
Sbjct: 154 IASINKWYQYFIGRIISGLGVGGISVLSPMLISEVAPSDLRGSLVSCYQLMITLGIFLGY 213

Query: 210 CTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSN 269
           CTN+G+K+YTNS+QWR+PLGL FAWAL M+ GM  VPESPRYL+E G+ EEA+ SLA+ N
Sbjct: 214 CTNFGTKNYTNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYLVEAGQIEEARSSLARIN 273

Query: 270 KTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGC 329
           K + D P + +E D+I A V+  R+ G+ASW ELF+ K  + +R +MGIM+QSLQQLTG 
Sbjct: 274 KCSPDHPYIQQELDLIQASVDEARSAGSASWGELFTGKPAMFRRTLMGIMIQSLQQLTGD 333

Query: 330 NYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACC 389
           NYFFYYGT +F+AVG++DS+ TSIV GVVNF ST  SL +V+RFGRR CLL+G+  M CC
Sbjct: 334 NYFFYYGTIVFKAVGLEDSFETSIVFGVVNFFSTCCSLLTVDRFGRRNCLLYGAIGMVCC 393

Query: 390 FVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRI 449
           +VV+AS+GVT+L+P+G    +SK AGN MIVF+C +IFCFA +WAPIA+V+++E++P RI
Sbjct: 394 YVVYASVGVTRLWPHGQGNGSSKGAGNCMIVFSCFYIFCFATTWAPIAYVIISETFPLRI 453

Query: 450 KQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLS 509
           K +AM+IA AANW+W F I F TPFIT+AINFYYG+V               V ETKGL+
Sbjct: 454 KAKAMSIATAANWMWGFLIAFFTPFITNAINFYYGYVFMGCMVFAYFYVFFFVSETKGLT 513

Query: 510 LEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIFSK 558
           LEE NEMY EG LPWKS  W+P+SRRGADYD  A  +DD  +++++  +
Sbjct: 514 LEEVNEMYAEGVLPWKSSKWVPASRRGADYDADALMHDDTPWYKRVVGR 562

>Scas_541.7
          Length = 591

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/530 (59%), Positives = 391/530 (73%)

Query: 30  EDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFG 89
           + +S   K  +++   KP    F V   C+M++FGGFIFGWD GTI GF+ QTDF RRFG
Sbjct: 62  DQMSELQKEADSQLESKPRKDLFFVCLCCIMVSFGGFIFGWDTGTISGFIRQTDFIRRFG 121

Query: 90  ELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQ 149
           +    G +YLS VRTGLIV  FN+G A GGI L + GD +GR++GL            IQ
Sbjct: 122 QTRANGTHYLSTVRTGLIVSIFNIGAAIGGITLSKTGDMWGRRLGLITVIGIYIVGILIQ 181

Query: 150 ISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGY 209
           I+S N W QYFIGRI+SGLGVGGI VL+P LISE+APK LRG  +S YQLMIT GIF+GY
Sbjct: 182 ITSFNKWYQYFIGRIISGLGVGGITVLAPMLISEVAPKKLRGTMVSCYQLMITLGIFLGY 241

Query: 210 CTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSN 269
           CTN+G+K+Y+NS+QWR+PLGL FAWAL M+ GM +VPESPRYL+E GK  EA+R LA+ N
Sbjct: 242 CTNFGTKNYSNSVQWRVPLGLCFAWALFMISGMTLVPESPRYLVEVGKIAEARRGLARVN 301

Query: 270 KTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGC 329
           K + D P+V  E +   + VEAER  GNASW EL + K  +L+R IMG+M+QSLQQLTG 
Sbjct: 302 KVSEDSPLVQLELEKYESSVEAERLAGNASWGELVTGKPAMLRRTIMGMMIQSLQQLTGA 361

Query: 330 NYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACC 389
           NYFFYYGTTIFQAVG+ DS+ T+IVLGVVNF STF +L+ V+ +GRR CLLWG   M CC
Sbjct: 362 NYFFYYGTTIFQAVGLSDSFETAIVLGVVNFVSTFFALYFVDHYGRRLCLLWGCVGMVCC 421

Query: 390 FVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRI 449
           +VV+AS+GVT+L+PNGM+ PTSK AGN MIVFAC FIFCFA +WAPIA+VV +E+YP R+
Sbjct: 422 YVVYASVGVTRLHPNGMNNPTSKGAGNCMIVFACFFIFCFATTWAPIAYVVTSETYPLRV 481

Query: 450 KQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLS 509
           + +AM+IA A NWIW F I F TPFITSAINF YG+V               V ETKGL+
Sbjct: 482 RGKAMSIASACNWIWGFLISFFTPFITSAINFSYGYVFMGCMVFAFFFVFFFVPETKGLT 541

Query: 510 LEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIFSKK 559
           LEE NEMYEEG LPWKS +W+P S+R ADYD+ A Q D + F++KI ++ 
Sbjct: 542 LEEVNEMYEEGVLPWKSSSWVPPSKRTADYDIDALQQDTRPFYKKILNRN 591

>Scas_687.4
          Length = 610

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/521 (60%), Positives = 386/521 (74%), Gaps = 3/521 (0%)

Query: 42  EGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSD 101
           E   KP SAY T+   C MI FGGFI GWD GTIGGF+   D+ RRFG+ +  G +Y S+
Sbjct: 90  EIPKKPASAYVTISIFCCMIGFGGFISGWDTGTIGGFLAHPDYLRRFGQHHKNGTHYFSN 149

Query: 102 VRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFI 161
           VRTGL+V  FN+G  FG +ILG L +  GRK+ L            IQI+S + W QYFI
Sbjct: 150 VRTGLVVSIFNIGGLFGCLILGDLANRIGRKMALVAVVVIFMVGIIIQIASIDKWYQYFI 209

Query: 162 GRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNS 221
           GRI+SGLGVG I++ SP L+SE+APKHLRG   S+YQLM+T GIF+G CTNYG+K+Y NS
Sbjct: 210 GRIISGLGVGAISIFSPMLLSEVAPKHLRGTLGSMYQLMVTAGIFLGDCTNYGTKNYDNS 269

Query: 222 IQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLRE 281
           +QWR+PLGL FAW L M+  M  VPESPRYL+E GK EEAKRS+A SNK ++DDP V  E
Sbjct: 270 VQWRVPLGLSFAWCLFMIAAMFFVPESPRYLVEVGKIEEAKRSIATSNKVSMDDPAVQAE 329

Query: 282 FDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQ 341
            D+I++GVEAER  GNASW ELFSTKGK +QR+ M  M+Q LQQLTGCNYFFYYGT IFQ
Sbjct: 330 VDLISSGVEAERLAGNASWGELFSTKGKNIQRLFMCCMLQCLQQLTGCNYFFYYGTVIFQ 389

Query: 342 AVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKL 401
           AVGM DSY T+IV G+VNF+STF++L+ V+RFGRRKCL+WG+A+M CC+VV+AS+GVT+L
Sbjct: 390 AVGMKDSYQTAIVFGIVNFASTFVALYVVDRFGRRKCLMWGAAAMVCCYVVYASVGVTRL 449

Query: 402 YPNGM---DQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAV 458
           YP+G+   D  +SK AGN MI F+C FIF FA +WAPI +VVV+ES+P RIK + MA+A 
Sbjct: 450 YPDGIKHKDTNSSKGAGNCMICFSCFFIFSFACTWAPICWVVVSESFPLRIKPKGMALAN 509

Query: 459 AANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYE 518
             NW WNF I F TPFIT AINFYYG+V               V E KGL+LEE NE++E
Sbjct: 510 GCNWFWNFLISFFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPEMKGLTLEEVNELWE 569

Query: 519 EGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIFSKK 559
           +G LPWKS  W+PSSRRGAD D+ A Q DD+  F+K+F +K
Sbjct: 570 DGVLPWKSPDWVPSSRRGADVDMDAFQKDDKPLFKKMFGRK 610

>YJL214W (HXT8) [2715] chr10 (26887..28596) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1710 bp, 569 aa]
          Length = 569

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/512 (57%), Positives = 388/512 (75%), Gaps = 1/512 (0%)

Query: 46  KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGEL-NDEGEYYLSDVRT 104
           KP SAY TV  +CL +AFGGF+ GWD GTI GFV QTDF RRFG   + +  YYLS+VRT
Sbjct: 58  KPASAYATVSIMCLCMAFGGFMSGWDTGTISGFVNQTDFLRRFGNYSHSKNTYYLSNVRT 117

Query: 105 GLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRI 164
           GLIV  FN+G A G + L +LGD YGR +GL            IQI+S + W QYFIGRI
Sbjct: 118 GLIVSIFNVGSAIGCLFLSKLGDIYGRCMGLIIVIVVYMVGIVIQIASIDKWYQYFIGRI 177

Query: 165 VSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQW 224
           ++G+G G I+VL+P LISE APKH+RG  ++ +QLM+T  IF+GYCTNYG+K+Y+NS+QW
Sbjct: 178 IAGIGAGSISVLAPMLISETAPKHIRGTLLACWQLMVTFAIFLGYCTNYGTKTYSNSVQW 237

Query: 225 RMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDV 284
           R+PLGL FAWA+IM+ GM  VPESPR+L++ GK E+AK S AKSNK +VDDP V+ E D+
Sbjct: 238 RVPLGLCFAWAIIMIGGMTFVPESPRFLVQVGKIEQAKASFAKSNKLSVDDPAVVAEIDL 297

Query: 285 INAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVG 344
           + AGVEAE A+G ASW ELFS K KV QR+ M +M+ SLQQLTG NYFFYYGTTIF++VG
Sbjct: 298 LVAGVEAEEAMGTASWKELFSRKTKVFQRLTMTVMINSLQQLTGDNYFFYYGTTIFKSVG 357

Query: 345 MDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPN 404
           M+DS+ TSIVLG+VNF+S F SL+SV++ GRR+CLL G+A+M  C V++AS+GVT+LYPN
Sbjct: 358 MNDSFETSIVLGIVNFASCFFSLYSVDKLGRRRCLLLGAATMTACMVIYASVGVTRLYPN 417

Query: 405 GMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIW 464
           G  +P+SK AGN  IVF C +IFCF+ +W P+ +V+++E++P R++ + M++A AAN +W
Sbjct: 418 GKSEPSSKGAGNCTIVFTCFYIFCFSCTWGPVCYVIISETFPLRVRSKCMSVATAANLLW 477

Query: 465 NFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPW 524
            F IGF TPFITSAINFYYG+V               V ETKGL+LEE +EM+ +G LPW
Sbjct: 478 GFLIGFFTPFITSAINFYYGYVFMGCLAFSYFYVFFFVPETKGLTLEEVDEMWMDGVLPW 537

Query: 525 KSDTWIPSSRRGADYDVHATQNDDQTFFQKIF 556
           KS++W+P+SRR  DYD    Q+D++ F++++F
Sbjct: 538 KSESWVPASRRDGDYDNEKLQHDEKPFYKRMF 569

>Scas_550.9
          Length = 574

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/521 (60%), Positives = 388/521 (74%), Gaps = 3/521 (0%)

Query: 42  EGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSD 101
           E   KP SAY T+   C MIAFGGF+ GWD GTIGGF+   D+ RRFG+ + +G +Y S+
Sbjct: 54  EIPKKPASAYVTISIFCCMIAFGGFLSGWDTGTIGGFLAHPDYLRRFGQHHKDGTHYFSN 113

Query: 102 VRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFI 161
           VRTGL+V  FN+G   G ++LG L +  GRK+ L            IQI+S N W QYFI
Sbjct: 114 VRTGLVVSIFNIGGLIGCLVLGDLANRIGRKMALVAVVIIFMVGLIIQIASINKWYQYFI 173

Query: 162 GRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNS 221
           GRI+SGLGVG I++ SP L+SE+APKHLRG   S+YQLM+T GIF+G CTNYG+K Y+NS
Sbjct: 174 GRIISGLGVGAISIFSPMLLSEVAPKHLRGTLGSMYQLMVTMGIFLGDCTNYGTKKYSNS 233

Query: 222 IQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLRE 281
           +QWR+PLGL FAW L M+  M  VPESPRYL+E GK EEAKRS+A SN+ ++DDP V  E
Sbjct: 234 VQWRVPLGLSFAWCLFMIAAMFFVPESPRYLVEVGKVEEAKRSIATSNQVSIDDPAVQAE 293

Query: 282 FDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQ 341
            D+I++GVEAER  GNASW ELFSTKGK +QR+ M  M+Q LQQLTGCNYFFYYGT IFQ
Sbjct: 294 VDLISSGVEAERLAGNASWVELFSTKGKNIQRLFMCCMLQCLQQLTGCNYFFYYGTVIFQ 353

Query: 342 AVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKL 401
           AVGM DSY T+IV G+VNF+STF++L+ V+RFGRRKCL+WG+A+M CC+VV+AS+GVT+L
Sbjct: 354 AVGMKDSYQTAIVFGIVNFASTFVALYVVDRFGRRKCLMWGAAAMVCCYVVYASVGVTRL 413

Query: 402 YPNGM---DQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAV 458
           YP+G+   D  +SK AGN MI F+C FIFCFA +WAPI +VVV+ES+P RIK + MA+A 
Sbjct: 414 YPDGIKHKDTNSSKGAGNCMICFSCFFIFCFACTWAPICWVVVSESFPLRIKPKGMALAN 473

Query: 459 AANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYE 518
             NW WNF I F TPFIT AINFYYG+V               V E KGL+LEE NE++E
Sbjct: 474 GCNWFWNFLISFFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPEMKGLTLEEVNELWE 533

Query: 519 EGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIFSKK 559
           +G LPWKS  W+PSSRRGAD D+ A Q DD+  F+K+F +K
Sbjct: 534 DGVLPWKSPDWVPSSRRGADVDMDAFQKDDKPLFKKMFGRK 574

>Scas_657.20
          Length = 569

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/535 (57%), Positives = 392/535 (73%), Gaps = 2/535 (0%)

Query: 27  KSVEDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKR 86
           +S ++ S   +    E   KP SAY T+   C MIAFGGF+ GWD GTIGGF+   D+ R
Sbjct: 35  ESFKETSEDAQEVVLEIPKKPASAYVTISIFCCMIAFGGFLSGWDTGTIGGFLAHPDYLR 94

Query: 87  RFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXX 146
           RFG+ + +G++Y S+VRTGLIV  FN+G   G ++LG L +  GRK+ L           
Sbjct: 95  RFGQHHHDGKHYFSNVRTGLIVSIFNIGGLIGCLVLGDLANRIGRKMALVAVTIIFMIGL 154

Query: 147 XIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIF 206
            IQI+S + W QYFIGRI+ G+GVG I++ SP L+SE++PKHLRG   S+YQLM+T GIF
Sbjct: 155 IIQIASIDKWYQYFIGRIIGGVGVGAISIFSPMLLSEVSPKHLRGTLGSMYQLMVTAGIF 214

Query: 207 VGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLA 266
           +G CTNYG+K+Y NS+QWR+PLGL FAW L M+  M  VPESPRYL+E GK EEAKRS+A
Sbjct: 215 LGDCTNYGTKNYDNSVQWRVPLGLSFAWCLFMIAAMFFVPESPRYLVEVGKIEEAKRSIA 274

Query: 267 KSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQL 326
            SNK ++DDP V  E D+I++GVEAER  GNASWAELFSTKGK +QR+ M  M+Q LQQL
Sbjct: 275 TSNKVSMDDPAVQAEVDLISSGVEAERLAGNASWAELFSTKGKNIQRLFMCCMLQCLQQL 334

Query: 327 TGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASM 386
           TGCNYFFYYGT +FQAVGM DSY T+IV G+VNF+STF++L+ V+RFGRRKCL+WG+A+M
Sbjct: 335 TGCNYFFYYGTIVFQAVGMSDSYQTAIVFGIVNFASTFVALYVVDRFGRRKCLMWGAAAM 394

Query: 387 ACCFVVFASMGVTKLYPNGMDQP--TSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAES 444
            CC+VV+AS+GV++LYP G+     TSK AGN MIVF+C FIF FA +WAPI +VVV+ES
Sbjct: 395 VCCYVVYASVGVSRLYPEGLKHKDITSKGAGNCMIVFSCFFIFSFACTWAPICWVVVSES 454

Query: 445 YPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCE 504
           +P R+K + MA+A   NW WNF I F TPFIT AINF YG+V               V E
Sbjct: 455 FPLRVKPKGMALANGCNWFWNFLISFFTPFITGAINFCYGYVFMGCMVFAYFYVFFFVPE 514

Query: 505 TKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIFSKK 559
            KGL+LEE NE++EEG LPWKS  W+PSSRRGAD ++ A Q DD+  F+K+F +K
Sbjct: 515 MKGLTLEEVNELWEEGVLPWKSPEWVPSSRRGADVEMDAFQKDDKPLFKKMFGRK 569

>Scas_552.2
          Length = 572

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/546 (58%), Positives = 393/546 (71%), Gaps = 13/546 (2%)

Query: 27  KSVEDVSLKVKTNENEG----------APKPISAYFTVICLCLMIAFGGFIFGWDIGTIG 76
            S++D +   K N   G            KP SAY T+   C MI FGGFI GWD GTIG
Sbjct: 27  HSIKDENDSFKENGENGEDANEAVVEIPKKPASAYATISIFCCMIGFGGFISGWDTGTIG 86

Query: 77  GFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLX 136
           GF+   D+ RRFG+ + +G +Y S+VRTGL+V  FN+G  FG +ILG L +  GRK+ L 
Sbjct: 87  GFLAHPDYLRRFGQHHHDGTHYFSNVRTGLVVSIFNIGGLFGCLILGDLANRIGRKMALV 146

Query: 137 XXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISL 196
                      IQI+S N W QYFIGRI+SGLGVG I++ SP L+SE++PKHLRG   S+
Sbjct: 147 VVVIIFMIGIIIQIASINKWYQYFIGRIISGLGVGAISIFSPMLLSEVSPKHLRGTLGSM 206

Query: 197 YQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKG 256
           YQLM+T GIF+G CTNYG+K Y+NS+QWR+PLGL FAW L M+  M  VPESPRYL+E G
Sbjct: 207 YQLMVTAGIFLGDCTNYGTKKYSNSVQWRVPLGLSFAWCLFMIAAMFFVPESPRYLVEVG 266

Query: 257 KFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIM 316
           K EEAKRS+A SNK ++DDP V  E D+I AGVEAER  GNASW ELFSTKGK +QR+ M
Sbjct: 267 KMEEAKRSIATSNKVSIDDPAVQGEVDLILAGVEAERLAGNASWGELFSTKGKNIQRLFM 326

Query: 317 GIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRR 376
             M+Q LQQLTGCNYFFYYGT IFQAVGM DSY T+IV GVVNF+STF++L+ V+RFGRR
Sbjct: 327 CCMLQCLQQLTGCNYFFYYGTVIFQAVGMKDSYQTAIVFGVVNFASTFVALYVVDRFGRR 386

Query: 377 KCLLWGSASMACCFVVFASMGVTKLYPNGM---DQPTSKSAGNVMIVFACLFIFCFAVSW 433
           KCL+WG+A+M CC+VV+AS+GVT+LYP+G+   D  +SK AGN MI F+C FIFCFA +W
Sbjct: 387 KCLMWGAAAMVCCYVVYASVGVTRLYPDGIKHKDTNSSKGAGNCMICFSCFFIFCFACTW 446

Query: 434 APIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXX 493
           API ++VV+E++P RIK + MA+A   NW WNF I F TPFIT AINFYYG+V       
Sbjct: 447 APICWIVVSEAFPLRIKPKGMALANGCNWFWNFLISFFTPFITGAINFYYGYVFMGCMVF 506

Query: 494 XXXXXXXXVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQ 553
                   V E KGL+LEE NE++E+G LPWKS  W+PSSRRGAD ++   Q DD+  F+
Sbjct: 507 GYFYVFFFVPEMKGLTLEEVNELWEDGVLPWKSPNWVPSSRRGADVNMDEFQKDDKPLFK 566

Query: 554 KIFSKK 559
           K+F +K
Sbjct: 567 KMFGRK 572

>Sklu_2304.6 , Contig c2304 11341-13056 reverse complement
          Length = 571

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/512 (58%), Positives = 385/512 (75%), Gaps = 1/512 (0%)

Query: 46  KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGEL-NDEGEYYLSDVRT 104
           KP SAY TV  LC+ +AFGGF+ GWD+GTI GFV QTDFKRRFGE  + + EYYLS+VR 
Sbjct: 60  KPASAYITVCILCMCVAFGGFVSGWDVGTISGFVNQTDFKRRFGEYSHSKDEYYLSNVRV 119

Query: 105 GLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRI 164
           GLIV  F++G A G ++L +LGD YGR +GL            IQISS + W QYFIGRI
Sbjct: 120 GLIVSIFSIGNAVGALVLSKLGDVYGRCMGLMAVILVYVVGIVIQISSDDKWYQYFIGRI 179

Query: 165 VSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQW 224
           V+GLG GG+ VL+  LISE APKHLRG  ++ +Q+M+   I +GYCTNYG+K+Y+NSIQW
Sbjct: 180 VAGLGGGGVGVLAQMLISETAPKHLRGTLLASWQVMVNCAILLGYCTNYGTKNYSNSIQW 239

Query: 225 RMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDV 284
           R+PLGL FAWA+IM+ GM  VPESPRYLI+ GK EEAKRSLA+SNK TV+DP V  E D+
Sbjct: 240 RVPLGLCFAWAIIMIAGMCFVPESPRYLIQVGKIEEAKRSLARSNKLTVEDPAVQCEVDL 299

Query: 285 INAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVG 344
           I AG+E E+  G++SW +L S K KV QR++M I + SLQQLTGC YFFYYGTTIF++VG
Sbjct: 300 IAAGIELEKLAGSSSWGDLLSKKTKVFQRLVMSITINSLQQLTGCGYFFYYGTTIFKSVG 359

Query: 345 MDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPN 404
           M+DS+ TSIV+GVVNF STF+SL+ ++R GRRKCLL G+A M  C V++A++GVT LYP+
Sbjct: 360 MEDSFETSIVIGVVNFVSTFVSLYILDRLGRRKCLLMGAAVMTVCMVIYATVGVTSLYPD 419

Query: 405 GMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIW 464
           G DQP+SK+AGN MIVF C +IF FA +W P  FVV++ES+P R+K + M++A AAN +W
Sbjct: 420 GEDQPSSKAAGNCMIVFTCFYIFFFANTWGPGCFVVISESFPLRVKSKCMSVATAANGLW 479

Query: 465 NFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPW 524
            F +GF TPFITSAINFYYG+V               V ETKGL+LEE  EM+ EG LPW
Sbjct: 480 GFLVGFFTPFITSAINFYYGYVFMGCLVVSYFYVFFFVPETKGLTLEEVEEMWHEGVLPW 539

Query: 525 KSDTWIPSSRRGADYDVHATQNDDQTFFQKIF 556
           KS +W+PSSRRG +YD    Q+D++ +++++ 
Sbjct: 540 KSGSWVPSSRRGTNYDAEKLQHDEKPWYKRML 571

>AFL204C [2991] [Homologous to ScAFL204C] (51587..53194) [1608 bp,
           535 aa]
          Length = 535

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/520 (58%), Positives = 379/520 (72%), Gaps = 6/520 (1%)

Query: 22  DPKQIKSVEDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQ 81
           +   I+S +D+   + T       KP SAY      C M+AFGGFIFGWD GTI GFV Q
Sbjct: 20  NSHPIESKKDIVSVISTET-----KPFSAYIFACLCCFMVAFGGFIFGWDTGTISGFVKQ 74

Query: 82  TDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXX 141
           TDF  RFG+L+  GEY LSD RTGLIV  FN+GCA GGI L ++GD YGRKIGL      
Sbjct: 75  TDFIARFGQLSPSGEYELSDDRTGLIVSIFNIGCAVGGIFLSKIGDAYGRKIGLATVTAV 134

Query: 142 XXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMI 201
                 IQIS+++ W QYF+GRI+SGLGVGGIAVLSP LISE +PKHLRG  +S YQLMI
Sbjct: 135 YVIGIVIQISASDKWYQYFVGRIISGLGVGGIAVLSPMLISETSPKHLRGSLVSCYQLMI 194

Query: 202 TGGIFVGYCTNYGSKS-YTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEE 260
           T GIF+GYCTNYG+K+ YT+S QWR+PLGLGFAWAL+M+ GM  VPESPRYL+E     +
Sbjct: 195 TAGIFLGYCTNYGTKTNYTDSRQWRIPLGLGFAWALLMIGGMAFVPESPRYLVEAENLPK 254

Query: 261 AKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMV 320
           A+ S+A++NK   D PIV  E + +   +E E+  G A   +LF+ K K+ QR+I+GI +
Sbjct: 255 ARMSIARANKVAEDHPIVEHELNTLQTAIELEKLAGKARIVDLFNVKKKIFQRLIIGIFI 314

Query: 321 QSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLL 380
           QSLQQL G NYFFYYGTTIF AVGMDD +VTSIVLG+VNF STF SL++V++FGRRKCL+
Sbjct: 315 QSLQQLIGNNYFFYYGTTIFNAVGMDDPFVTSIVLGIVNFGSTFFSLYTVDKFGRRKCLI 374

Query: 381 WGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVV 440
           WG+ +MA C  +FAS+GVTKL+PNG DQP+SK AGNVMIVF C++IF FA +WAPIA+V+
Sbjct: 375 WGAFAMAICMAIFASVGVTKLWPNGEDQPSSKPAGNVMIVFTCIYIFFFATTWAPIAYVI 434

Query: 441 VAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXX 500
           ++E YP R+K RAMA+A AANWIW F I F TP ITSAI F YG+V              
Sbjct: 435 ISEIYPLRVKARAMALATAANWIWGFLIAFFTPRITSAIKFCYGYVFMGCLIFAFFYIFF 494

Query: 501 XVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYD 540
            V ETKGL+LE+ +EM++EG +PW S++W+P S R   +D
Sbjct: 495 FVPETKGLTLEDVDEMWQEGVVPWGSESWLPRSDREVAHD 534

>Scas_685.5
          Length = 560

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/517 (56%), Positives = 368/517 (71%), Gaps = 2/517 (0%)

Query: 42  EGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSD 101
           E   K   AY T+  LC MI FGGFI GWD GTIGGF+G  DF RRFG+   +G +Y S+
Sbjct: 40  EMPKKSAGAYATISILCCMIGFGGFIAGWDTGTIGGFMGHPDFMRRFGQKRRDGTHYFSN 99

Query: 102 VRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFI 161
            RTGLIV  FNLG   G + L  L    GRK  L            I+++S N W QYFI
Sbjct: 100 SRTGLIVSIFNLGGCIGCLTLNNLAGRVGRKKALVIVVIIYMVGIVIEMASINKWYQYFI 159

Query: 162 GRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNS 221
           GRI+SG+GVG I++ SP L+SE++PKHLRG   S+YQLM+T GIF+G CTNYG++   NS
Sbjct: 160 GRIISGMGVGAISIFSPMLLSEVSPKHLRGTLGSVYQLMVTFGIFLGDCTNYGTRHKHNS 219

Query: 222 IQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLRE 281
            QWR PLGL FAWAL M+ GM  VPESPRYL+E GK EEAKRS+  SNK + DDP V  E
Sbjct: 220 SQWRAPLGLSFAWALFMIAGMSFVPESPRYLLEIGKVEEAKRSVGTSNKLSADDPAVQCE 279

Query: 282 FDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQ 341
            D+I A +EAER  G+ASW ELFSTKGK +QR++M  ++QSLQQLTG NYFFYYG+T+FQ
Sbjct: 280 VDLILANIEAERLAGSASWPELFSTKGKYVQRLLMCCVLQSLQQLTGINYFFYYGSTVFQ 339

Query: 342 AVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKL 401
           A  + D Y T+IV G+VNF+STF++ + V++FGRRKCL+WG+A+M CCFVV+AS+GV +L
Sbjct: 340 AASLKDPYETAIVFGIVNFASTFVAFYVVDKFGRRKCLMWGAAAMVCCFVVYASVGVKRL 399

Query: 402 YPNGMDQP--TSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVA 459
           YP G      TSK AG+ MIVF+C FIF FA + API +VVV+E++P  IK + MA+A  
Sbjct: 400 YPEGRKHKEITSKGAGDCMIVFSCFFIFSFACTLAPICWVVVSETFPLEIKPKGMALANG 459

Query: 460 ANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEE 519
           +NW+WNF I F TPFIT AI+FYYG+V               V E KGL+LEE NE++EE
Sbjct: 460 SNWLWNFLISFFTPFITGAIDFYYGYVFMGCILFAYFFVFFFVPEMKGLTLEEVNELWEE 519

Query: 520 GTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIF 556
           G LPWKS  W+PS+RR A+ D++A Q+DDQ  ++K+F
Sbjct: 520 GVLPWKSPDWVPSTRRDANMDMNALQHDDQPMYKKVF 556

>Kwal_26.6686
          Length = 569

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/492 (59%), Positives = 364/492 (73%), Gaps = 2/492 (0%)

Query: 46  KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGE-YYLSDVRT 104
           KP SAY TV  LC++++FGGF+ GWD G + GFV   DFK+RFG  N + E YYLS+VRT
Sbjct: 58  KPASAYLTVSLLCVLVSFGGFLPGWDTGIMAGFVNMDDFKQRFGSYNHKTETYYLSNVRT 117

Query: 105 GLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRI 164
           GL+V  F+ GCAFGG+ L +LGD YGR++GL            IQIS+ + W QYFIG+I
Sbjct: 118 GLLVAIFSAGCAFGGLTLPKLGDIYGRRLGLMIVIVLYVVGTIIQISAQDKWYQYFIGKI 177

Query: 165 VSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQW 224
           + G GVGG++VL+P LISE APKHLRG  IS YQLM+T GIF+GYC  YG++ Y +S QW
Sbjct: 178 IYGWGVGGVSVLAPMLISETAPKHLRGTLISCYQLMVTFGIFLGYCAVYGTRKYNSSAQW 237

Query: 225 RMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDV 284
           R+P+GL F WA+I++ GM  VPESPR+L+E G+ EEAKRS+A+SNK   ++  V  E D+
Sbjct: 238 RIPVGLCFLWAMIIIGGMTFVPESPRFLVEVGRMEEAKRSVARSNKVDPEEVGVQIEIDL 297

Query: 285 INAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVG 344
           I AGVEAER  G ASW ELFSTK KVLQR+I GI++QS  QLTG NYFFYYGTTIF+++G
Sbjct: 298 IAAGVEAERQQGKASWGELFSTKTKVLQRLITGILMQSFLQLTGENYFFYYGTTIFKSIG 357

Query: 345 MDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPN 404
           + DS+ TSIVLG+VNF+STF+S++ V+ FGRRKCLLWG+A M  C VVFAS+GVT L+PN
Sbjct: 358 LTDSFETSIVLGIVNFASTFLSMYVVDAFGRRKCLLWGAAGMTACMVVFASVGVTSLWPN 417

Query: 405 GMD-QPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWI 463
           G +    SK AGN MIVF C FIFCFA +WAPIA+VVVAES+P R+K + M+I+ A NW+
Sbjct: 418 GENVGEASKGAGNCMIVFTCFFIFCFATTWAPIAYVVVAESFPLRVKSKCMSISTAFNWL 477

Query: 464 WNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLP 523
           W F IGF TPFITSAI FYYG+V               + ET GL+LEE   +Y+EG  P
Sbjct: 478 WQFLIGFFTPFITSAIKFYYGYVFMGCLVAMFLYVFFFLPETSGLTLEEVQILYDEGIPP 537

Query: 524 WKSDTWIPSSRR 535
           W+S  W+P SRR
Sbjct: 538 WRSADWVPPSRR 549

>Scas_455.2*
          Length = 535

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/513 (56%), Positives = 367/513 (71%)

Query: 41  NEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLS 100
            E   KP+S Y     L L +AFGGFI GWD GTI G V Q DF +RFGE    G ++LS
Sbjct: 20  EELPKKPLSDYIVACILSLAVAFGGFITGWDTGTISGIVAQEDFIQRFGERRSNGSHHLS 79

Query: 101 DVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYF 160
           + RTG+IV  FN+GCA GGI+L R+GD +GRK GL            +QIS+   W QYF
Sbjct: 80  NARTGIIVSLFNIGCAVGGIVLSRVGDKFGRKKGLMVVIVIYIVGVIVQISTQKAWYQYF 139

Query: 161 IGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTN 220
           IGR+VSGLGVGGIAVL P LISEI+PKHLRG CIS YQLMIT GIF+GYCTNYG+K Y N
Sbjct: 140 IGRVVSGLGVGGIAVLCPMLISEISPKHLRGTCISFYQLMITAGIFLGYCTNYGTKDYNN 199

Query: 221 SIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLR 280
           S+QWR+PLGL FAWALIM++ +  VPESPR+L E    E+AKRS+AK +  +V DP V  
Sbjct: 200 SVQWRVPLGLSFAWALIMIVILFFVPESPRFLCEINDPEKAKRSIAKIHNVSVKDPSVQT 259

Query: 281 EFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIF 340
           E D+I +GVE+E+  G+ASW EL ST+ KV QRVIMGIM+  LQQLTG NYFFYYGT +F
Sbjct: 260 EVDLIMSGVESEKLAGSASWRELLSTRTKVRQRVIMGIMILMLQQLTGDNYFFYYGTIVF 319

Query: 341 QAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTK 400
           ++VG++DS+ TSIV GVVNF STF +L++V+  GRR  LLW  A+M  C ++++S+GVT+
Sbjct: 320 RSVGLNDSFQTSIVFGVVNFFSTFFALYTVDNVGRRLMLLWAGAAMTACLIIYSSVGVTR 379

Query: 401 LYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAA 460
           L+P+G    +SK AGN MIVF   +IFC+A+SWAPI +V+VAESYP R+K + MA++ A+
Sbjct: 380 LWPHGEGNGSSKGAGNCMIVFTSFYIFCYAMSWAPIPWVLVAESYPIRVKSKCMAVSAAS 439

Query: 461 NWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEG 520
           NWIW F I F TPFITS+INFYYG+V               + ETKGLSLEE   +++EG
Sbjct: 440 NWIWGFLISFFTPFITSSINFYYGYVFVGCLVFSWFYVFFFIPETKGLSLEEIQTLWDEG 499

Query: 521 TLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQ 553
             PWKS  W+  S+R  DYD+   Q D+  +++
Sbjct: 500 VAPWKSAKWVRPSKRTYDYDLEKFQKDENPWYK 532

>Kwal_55.19582
          Length = 567

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/496 (57%), Positives = 362/496 (72%), Gaps = 2/496 (0%)

Query: 42  EGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDE-GEYYLS 100
           E   KP SAY TV  LC++++FGGF+ GWD G + GFV   DFKRRFG   +   EYYLS
Sbjct: 51  ELPKKPASAYVTVSLLCVLVSFGGFLPGWDTGIMAGFVNMDDFKRRFGTYKESTNEYYLS 110

Query: 101 DVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYF 160
           +VRTGL+V  F+ GCA GG+ L +LGD +GR++ L            IQIS+++ W QYF
Sbjct: 111 NVRTGLLVAIFSAGCALGGLTLSKLGDIFGRRLALMFVVGVYVVGTIIQISASDKWYQYF 170

Query: 161 IGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTN 220
           IG+I+ G GVGG++VL+P LISE APKHLRG  IS YQLM+T GIF+GYC  Y ++ Y  
Sbjct: 171 IGKIIYGWGVGGVSVLAPMLISETAPKHLRGTLISCYQLMVTFGIFLGYCVVYATRKYDG 230

Query: 221 SIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLR 280
           S QWR+PLGL F WALI+V GM+ VPESPR+L+E G+ EEA+RS+A SNKT V+DP +  
Sbjct: 231 SEQWRIPLGLSFLWALIIVAGMVFVPESPRFLVEVGRIEEARRSIASSNKTPVEDPAIQA 290

Query: 281 EFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIF 340
           E D+I A VEAE+A G A WAELFSTK KV QR+I GI++QS  QLTG NYFFYYGTTIF
Sbjct: 291 EIDLIAASVEAEKAQGKARWAELFSTKTKVFQRLITGILMQSFLQLTGENYFFYYGTTIF 350

Query: 341 QAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTK 400
           +++G+ DS+ TSIVLG VNF S+F+S+++V+ FGRRKCLLWG+A+M  C V+FAS+GVT 
Sbjct: 351 KSIGLTDSFQTSIVLGTVNFFSSFLSMYTVDAFGRRKCLLWGAAAMTVCMVIFASVGVTS 410

Query: 401 LYPNGMD-QPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVA 459
           L+P+G +    SK AGNVMIVF CLFI  FA +WAPIA+VVVAES+P R+K + M+I+ A
Sbjct: 411 LWPHGENVGEASKPAGNVMIVFTCLFICFFATTWAPIAYVVVAESFPLRVKSKCMSISTA 470

Query: 460 ANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEE 519
            NW+W F IGF TPFIT+AI FYYG+V               + ET GL+LEE   +YEE
Sbjct: 471 FNWLWQFLIGFFTPFITNAIKFYYGYVFMGCLVAMFLYVFFFLPETSGLTLEEVQILYEE 530

Query: 520 GTLPWKSDTWIPSSRR 535
           G   W+S  W+P +RR
Sbjct: 531 GIPAWRSANWVPPTRR 546

>Kwal_56.22285
          Length = 567

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/496 (57%), Positives = 361/496 (72%), Gaps = 2/496 (0%)

Query: 42  EGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDE-GEYYLS 100
           E   KP SAY TV  LC++++FGGF+ GWD G + GFV   DFKRRFG   +   EYYLS
Sbjct: 51  ELPKKPASAYVTVSLLCVLVSFGGFLPGWDTGIMAGFVNMDDFKRRFGTYKESTNEYYLS 110

Query: 101 DVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYF 160
           +VRTGL+V  F+ GCA GG+ L +LGD +GR++ L            IQIS+++ W QYF
Sbjct: 111 NVRTGLLVAIFSAGCALGGLTLSKLGDIFGRRLALMFVVGVYVVGTIIQISASDKWYQYF 170

Query: 161 IGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTN 220
           IG+I+ G GVGG++VL+P LIS  APKH+RG  IS YQLM+T GIF+GYC  Y ++ Y  
Sbjct: 171 IGKIIYGWGVGGVSVLAPMLISLTAPKHVRGTLISCYQLMVTFGIFLGYCVVYATRKYDG 230

Query: 221 SIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLR 280
           S QWR+PLGL F WALI+V GM+ VPESPR+L+E G+ EEA+RS+A SNKT V+DP +  
Sbjct: 231 SEQWRIPLGLSFLWALIIVAGMVFVPESPRFLVEVGRIEEARRSIASSNKTPVEDPAIQA 290

Query: 281 EFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIF 340
           E D+I A VEAE+A G A WAELFSTK KV QR+I GI++QS  QLTG NYFFYYGTTIF
Sbjct: 291 EIDLIAASVEAEKAQGKARWAELFSTKTKVFQRLITGILMQSFLQLTGENYFFYYGTTIF 350

Query: 341 QAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTK 400
           +++G+ DS+ TSIVLG VNF S+F+S+++V+ FGRRKCLLWG+A+M  C V+FAS+GVT 
Sbjct: 351 KSIGLTDSFQTSIVLGTVNFFSSFLSMYTVDAFGRRKCLLWGAAAMTVCMVIFASVGVTS 410

Query: 401 LYPNGMD-QPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVA 459
           L+P+G +    SK AGNVMIVF CLFI  FA +WAPIA+VVVAES+P R+K + M+I+ A
Sbjct: 411 LWPHGENVGEASKPAGNVMIVFTCLFICFFATTWAPIAYVVVAESFPLRVKSKCMSISTA 470

Query: 460 ANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEE 519
            NW+W F IGF TPFIT+AI FYYG+V               + ET GL+LEE   +YEE
Sbjct: 471 FNWLWQFLIGFFTPFITNAIKFYYGYVFMGCLVAMFLYVFFFLPETSGLTLEEVQILYEE 530

Query: 520 GTLPWKSDTWIPSSRR 535
           G   W+S  W+P +RR
Sbjct: 531 GIPAWRSANWVPPTRR 546

>YEL069C (HXT13) [1361] chr5 complement(21537..23231) Member of the
           hexose transporter family of the major facilitator
           superfamily (MFS) [1695 bp, 564 aa]
          Length = 564

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/527 (53%), Positives = 366/527 (69%), Gaps = 3/527 (0%)

Query: 35  KVKTNENEGAPKP-ISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGEL-N 92
           +V   +N   PK  +  Y  +  LC  I+FGGF+ GWD G   GF+   +FK  FG   +
Sbjct: 37  EVINGDNVEPPKRGLIGYLVIYLLCYPISFGGFLPGWDSGITAGFINMDNFKMNFGSYKH 96

Query: 93  DEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISS 152
             GEYYLS+VR GL+V  F++GCA GG+I  RL D  GR++ +            IQISS
Sbjct: 97  STGEYYLSNVRMGLLVAMFSIGCAIGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISS 156

Query: 153 TNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTN 212
            + W QYF+G+I+ GLG GG +VL P L+SEIAP  LRG  +SLYQL +T GIF+GYC+ 
Sbjct: 157 NHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSV 216

Query: 213 YGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTT 272
           YG++ Y N+ QWR+PLGL F WALI+++GM++VPESPRYLIE  + EEA+ S+AK NK +
Sbjct: 217 YGTRKYDNTAQWRVPLGLCFLWALIIIIGMLLVPESPRYLIECERHEEARASIAKINKVS 276

Query: 273 VDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYF 332
            +DP VL++ D INAGV A+R +G ASW ELFS K KVLQR+I GI+VQ+  QLTG NYF
Sbjct: 277 PEDPWVLKQADEINAGVLAQRELGEASWKELFSVKTKVLQRLITGILVQTFLQLTGENYF 336

Query: 333 FYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVV 392
           F+YGTTIF++VG+ D + TSIVLG VNF ST I++  V++ GRRKCLL+G+A M  C V+
Sbjct: 337 FFYGTTIFKSVGLTDGFETSIVLGTVNFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVI 396

Query: 393 FASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQR 452
           FAS+GV  LYP+G D P+SK AGN MIVF C +IFCFA +WAP+A++VVAES+P ++K R
Sbjct: 397 FASIGVKCLYPHGQDGPSSKGAGNAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSR 456

Query: 453 AMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEE 512
           AM+I+ A NW+W F IGF TPFIT +I+FYYG+V               + ET GLSLEE
Sbjct: 457 AMSISTACNWLWQFLIGFFTPFITGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEE 516

Query: 513 FNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIFSKK 559
              +YEEG  PWKS +W+P SRRG   +   T+  D   F K FSK 
Sbjct: 517 IQLLYEEGIKPWKSASWVPPSRRGISSEESKTEKKDWKKFLK-FSKN 562

>YNR072W (HXT17) [4655] chr14 (772654..774348) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1695 bp, 564 aa]
          Length = 564

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/526 (53%), Positives = 365/526 (69%), Gaps = 3/526 (0%)

Query: 35  KVKTNENEGAPKP-ISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGEL-N 92
           +V   +N   PK  +  Y  +  LC  I+FGGF+ GWD G   GF+   +FK  FG   +
Sbjct: 37  EVINGDNVEPPKRGLIGYLVIYLLCYPISFGGFLPGWDSGITAGFINMDNFKMNFGSYKH 96

Query: 93  DEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISS 152
             GEYYLS+VR GL+V  F++GCA GG+I  RL D  GR++ +            IQISS
Sbjct: 97  STGEYYLSNVRMGLLVAMFSIGCAIGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISS 156

Query: 153 TNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTN 212
            + W QYF+G+I+ GLG GG +VL P L+SEIAP  LRG  +SLYQL +T GIF+GYC+ 
Sbjct: 157 NHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSV 216

Query: 213 YGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTT 272
           YG++ Y N+ QWR+PLGL F W LI+++GM++VPESPRYLIE  + EEA+ S+AK NK +
Sbjct: 217 YGTRKYDNTAQWRVPLGLCFLWTLIIIIGMLLVPESPRYLIECERHEEARASIAKINKVS 276

Query: 273 VDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYF 332
            +DP VL++ D INAGV A+R +G ASW ELFS K KVLQR+I GI+VQ+  QLTG NYF
Sbjct: 277 PEDPWVLKQADEINAGVLAQRELGEASWKELFSVKTKVLQRLITGILVQTFLQLTGENYF 336

Query: 333 FYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVV 392
           F+YGTTIF++VG+ D + TSIVLG VNF ST I++  V++ GRRKCLL+G+A M  C V+
Sbjct: 337 FFYGTTIFKSVGLTDGFETSIVLGTVNFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVI 396

Query: 393 FASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQR 452
           FAS+GV  LYP+G D P+SK AGN MIVF C +IFCFA +WAP+A++VVAES+P ++K R
Sbjct: 397 FASIGVKCLYPHGQDGPSSKGAGNAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSR 456

Query: 453 AMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEE 512
           AM+I+ A NW+W F IGF TPFIT +I+FYYG+V               + ET GLSLEE
Sbjct: 457 AMSISTACNWLWQFLIGFFTPFITGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEE 516

Query: 513 FNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIFSK 558
              +YEEG  PWKS +W+P SRRG   +   T+  D   F K FSK
Sbjct: 517 IQLLYEEGIKPWKSASWVPPSRRGIPSEESKTEKKDWKKFLK-FSK 561

>YDL245C (HXT15) [632] chr4 complement(11657..13360) Member of the
           hexose transporter family of the major facilitator
           superfamily (MFS) [1704 bp, 567 aa]
          Length = 567

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/504 (53%), Positives = 355/504 (70%), Gaps = 1/504 (0%)

Query: 36  VKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGEL-NDE 94
           +  N  +   +    Y  +  LC  ++FGGF+ GWD G   GF+   +FK  FG   +  
Sbjct: 42  INGNTPDAPKRGFLGYLIIYLLCYPVSFGGFLPGWDSGITAGFINMDNFKMNFGSYKHST 101

Query: 95  GEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTN 154
           GEYYLS+VR GL+V  F++GC+ GG+   RL D  GR++ +            IQISS +
Sbjct: 102 GEYYLSNVRMGLLVAMFSVGCSIGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNH 161

Query: 155 NWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYG 214
            W QYF+G+I+ GLG GG +VL P L+SEIAP  LRG  +SLYQL +T GIF+GYC+ YG
Sbjct: 162 KWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYG 221

Query: 215 SKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVD 274
           ++ Y+N+ QWR+P+GL F WALI+++GM++VPESPRYLIE  + EEA  S+AK NK + +
Sbjct: 222 TRKYSNTAQWRIPVGLCFLWALIIIVGMLLVPESPRYLIECERHEEACVSIAKINKVSPE 281

Query: 275 DPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFY 334
           DP VL++ D INAGV A+R +G ASW ELFS K KVLQR+I GI+VQ+  QLTG NYFF+
Sbjct: 282 DPWVLKQADEINAGVLAQRELGEASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFF 341

Query: 335 YGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFA 394
           YGTTIF++VG+ D + TSIVLG VNF ST I++  V++ GRRKCLL+G+ASM  C V+FA
Sbjct: 342 YGTTIFKSVGLTDGFETSIVLGTVNFFSTIIAVMVVDKIGRRKCLLFGAASMMACMVIFA 401

Query: 395 SMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAM 454
           S+GV  LYP+G D P+SK AGN MIVF C +IFCFA +WAP+A++VVAES+P ++K +AM
Sbjct: 402 SIGVKCLYPHGQDGPSSKGAGNAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSKAM 461

Query: 455 AIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFN 514
           +I+ A NW+W F IGF TPFIT +I+FYYG+V               + ET GLSLEE  
Sbjct: 462 SISTAFNWLWQFLIGFFTPFITGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQ 521

Query: 515 EMYEEGTLPWKSDTWIPSSRRGAD 538
            +YEEG  PWKS +W+P SRRGA 
Sbjct: 522 LLYEEGIKPWKSASWVPPSRRGAS 545

>YJR158W (HXT16) [3048] chr10 (732355..734058) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1704 bp, 567 aa]
          Length = 567

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/504 (53%), Positives = 355/504 (70%), Gaps = 1/504 (0%)

Query: 36  VKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGEL-NDE 94
           +  N  +   +    Y  +  LC  ++FGGF+ GWD G   GF+   +FK  FG   +  
Sbjct: 42  INGNTPDAPKRGFLGYLIIYLLCYPVSFGGFLPGWDSGITAGFINMDNFKMNFGSYKHST 101

Query: 95  GEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTN 154
           GEYYLS+VR GL+V  F++GC+ GG+   RL D  GR++ +            IQISS +
Sbjct: 102 GEYYLSNVRMGLLVAMFSVGCSIGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNH 161

Query: 155 NWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYG 214
            W QYF+G+I+ GLG GG +VL P L+SEIAP  LRG  +SLYQL +T GIF+GYC+ YG
Sbjct: 162 KWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYG 221

Query: 215 SKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVD 274
           ++ Y+N+ QWR+P+GL F WALI+++GM++VPESPRYLIE  + EEA  S+AK +K + +
Sbjct: 222 TRKYSNTAQWRIPVGLCFLWALIIIVGMLLVPESPRYLIECERHEEACVSIAKIDKVSPE 281

Query: 275 DPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFY 334
           DP VL++ D INAGV A+R +G ASW ELFS K KVLQR+I GI+VQ+  QLTG NYFF+
Sbjct: 282 DPWVLKQADEINAGVLAQRELGEASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFF 341

Query: 335 YGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFA 394
           YGTTIF++VG+ D + TSIVLG VNF ST I++  V++ GRRKCLL+G+ASM  C V+FA
Sbjct: 342 YGTTIFKSVGLTDGFETSIVLGTVNFFSTIIAVMVVDKIGRRKCLLFGAASMMACMVIFA 401

Query: 395 SMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAM 454
           S+GV  LYP+G D P+SK AGN MIVF C +IFCFA +WAP+A++VVAES+P ++K +AM
Sbjct: 402 SIGVKCLYPHGQDGPSSKGAGNAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSKAM 461

Query: 455 AIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFN 514
           +I+ A NW+W F IGF TPFIT +I+FYYG+V               + ET GLSLEE  
Sbjct: 462 SISTAFNWLWQFLIGFFTPFITGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEETQ 521

Query: 515 EMYEEGTLPWKSDTWIPSSRRGAD 538
            +YEEG  PWKS +W+P SRRGA 
Sbjct: 522 LLYEEGIKPWKSASWVPPSRRGAS 545

>YIL170W (HXT12) [2508] chr9 (19847..21220) Protein of unknown
           function [1374 bp, 457 aa]
          Length = 457

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/456 (61%), Positives = 340/456 (74%), Gaps = 2/456 (0%)

Query: 105 GLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRI 164
           GLIV  FN+GCA GGI+L ++GD YGR+IGL            IQI+S N W QYFIGRI
Sbjct: 2   GLIVSIFNIGCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRI 61

Query: 165 VSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQW 224
           +SG+GVGGIAVLSP LISE+APKH+RG  + LYQLM T GIF+GYCTNYG+K+Y N+ QW
Sbjct: 62  ISGIGVGGIAVLSPMLISEVAPKHIRGTLVQLYQLMGTMGIFLGYCTNYGTKNYHNATQW 121

Query: 225 RMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDV 284
           R+ LGL FAWA  MV GMM VPESPRYLIE GK EEAK SL+KSNK +VDDP +L E+D 
Sbjct: 122 RVGLGLCFAWATFMVSGMMFVPESPRYLIEVGKDEEAKHSLSKSNKVSVDDPALLAEYDT 181

Query: 285 INAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVG 344
           I AG+E E+  GNASW+EL STK KV QRV+MG+++QSLQQLTG NYFFYYGTTIF++VG
Sbjct: 182 IKAGIEIEKLAGNASWSELLSTKTKVFQRVLMGVIIQSLQQLTGDNYFFYYGTTIFKSVG 241

Query: 345 MDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPN 404
           + DS+ TSI++GVVNF S+FI+++++ERFGRR CLLWG+ASM CCF VFAS+GVTKL+P 
Sbjct: 242 LKDSFQTSIIIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLWPQ 301

Query: 405 GMDQP--TSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANW 462
           G      TS+ AGN MIVF   FIF FA +WA   FV+V+E++P R K R MAIA AANW
Sbjct: 302 GSSHQDITSQGAGNCMIVFTMFFIFSFATTWAGGCFVIVSETFPLRAKSRGMAIATAANW 361

Query: 463 IWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTL 522
           +W F I F TPFIT AINFYYG+V               V ETKGL+LEE N M+ EG  
Sbjct: 362 MWGFLISFFTPFITGAINFYYGYVFLGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGVP 421

Query: 523 PWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIFSK 558
            WKS +W+P  RR ADYD  A  +D++  +++ FS 
Sbjct: 422 AWKSASWVPPERRTADYDADAIDHDNRPIYKRFFSS 457

>Scas_634.16
          Length = 471

 Score =  510 bits (1314), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 255/423 (60%), Positives = 321/423 (75%), Gaps = 8/423 (1%)

Query: 25  QIKSVEDVSLKVKTNENEGAP-----KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFV 79
           Q    +D  +K    + E AP     KP SAY TV  LCLMIAFGG+++GWD GTI GFV
Sbjct: 49  QSNKDDDEEIKNYGEDGEIAPAEMPKKPASAYVTVSILCLMIAFGGYVYGWDTGTISGFV 108

Query: 80  GQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXX 139
            QTD+ RR+G+   +G YYLS VRTGL++  FN+GCA GG++  RLGD +GR+  L    
Sbjct: 109 AQTDYVRRYGQKKKDGTYYLSKVRTGLLLAIFNIGCAIGGLLWSRLGDMWGRRKALVFVT 168

Query: 140 XXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQL 199
                   I I++  +W QYFIGRI+SGLGVGGIAV SP LISE+APKH+RG  +S YQL
Sbjct: 169 TVYMIGLIISIAAVKHWYQYFIGRIISGLGVGGIAVYSPLLISEVAPKHVRGTLVSCYQL 228

Query: 200 MITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFE 259
           MIT GIF+GYCTN+G+++Y+NS+QWR+PLGLGFAWAL M+  M  VPESPRYLIE G+ E
Sbjct: 229 MITLGIFLGYCTNFGTRNYSNSVQWRVPLGLGFAWALFMIAAMFFVPESPRYLIEVGQME 288

Query: 260 EAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIM 319
           EAKRS+A+SN+ TVDDP V+ E + + AGVEAER  G+ASW ELF TKGK+L RVIMGIM
Sbjct: 289 EAKRSVAQSNRLTVDDPSVIAEVEFLTAGVEAEREAGSASWMELFQTKGKILHRVIMGIM 348

Query: 320 VQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCL 379
           +Q+LQQLTG NYFF+YGT IF ++GM+D +  S+V+G+VNF+STF +++ V+RFGRR CL
Sbjct: 349 IQTLQQLTGANYFFFYGTLIFASIGMNDGFKASVVIGIVNFASTFPAIYIVDRFGRRTCL 408

Query: 380 LWGSASMACCFVVFASMGVTKLYPNGMDQP--TSKSAGNVMIVFACLFIFCFAVSWAPIA 437
           L+G+A M CC VVFAS+GVT+L+P+G DQ    SK AGN MI F C FIFCFA +WAP A
Sbjct: 409 LFGAAGMICCMVVFASVGVTRLHPDG-DQNGVASKGAGNCMICFTCFFIFCFANTWAPCA 467

Query: 438 FVV 440
           +V+
Sbjct: 468 YVM 470

>Kwal_26.6680
          Length = 416

 Score =  490 bits (1261), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 231/391 (59%), Positives = 293/391 (74%)

Query: 148 IQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFV 207
           IQI++   W  YFIG+I+ G GVGG++VLSP LISEI+PKHLRG  +S +QLM+T GIF+
Sbjct: 13  IQITADRKWYHYFIGKIIYGWGVGGMSVLSPMLISEISPKHLRGTLVSCFQLMVTFGIFL 72

Query: 208 GYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAK 267
           GYC  YG++ Y++S QWR+P+GL F WA+I+V GM  VPESPRYL+E  K EEAKRS+A+
Sbjct: 73  GYCAVYGTRQYSDSAQWRIPVGLSFLWAIIIVTGMFFVPESPRYLVEANKVEEAKRSIAR 132

Query: 268 SNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLT 327
           + K +VDDP V  E D+I AGVEA+R  G ASW ELFS K KVLQR+I GI++QS  QLT
Sbjct: 133 AFKLSVDDPEVQEETDLIVAGVEAQREQGEASWGELFSVKTKVLQRLITGILMQSFLQLT 192

Query: 328 GCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMA 387
           G NYFFYYGTTIF ++G+ DS+ TSIVLG VN +S+FIS+++V+  GRRKCLLWG+A MA
Sbjct: 193 GENYFFYYGTTIFDSIGLTDSFQTSIVLGTVNLASSFISMYTVDALGRRKCLLWGAAGMA 252

Query: 388 CCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQ 447
            C V+FAS+GVT L PNG D   SKSAGN M+VF CLFI CFA +WAPI++VVV+ES+P 
Sbjct: 253 ICMVIFASVGVTSLRPNGPDGEASKSAGNCMVVFICLFILCFATTWAPISYVVVSESFPL 312

Query: 448 RIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKG 507
           R+K + M+I+ A NW+W F I F TPFIT AINFYYG+V               V ET G
Sbjct: 313 RVKSKCMSISTAFNWLWQFLISFFTPFITGAINFYYGYVFFGCLVAMFLYVFFFVPETGG 372

Query: 508 LSLEEFNEMYEEGTLPWKSDTWIPSSRRGAD 538
           L+LEE   +Y+EG   W+S +W+P  RR ++
Sbjct: 373 LTLEEVQTLYDEGVPAWRSTSWVPPGRRSSN 403

>Scas_600.1
          Length = 293

 Score =  373 bits (957), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 175/293 (59%), Positives = 223/293 (76%), Gaps = 3/293 (1%)

Query: 270 KTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGC 329
           K +VDDP V  E D+I +G+EAER  GNASW ELFSTKGKV+QR++M  M+Q LQQLTGC
Sbjct: 1   KVSVDDPAVQAECDLITSGIEAERLAGNASWGELFSTKGKVVQRLLMCCMLQCLQQLTGC 60

Query: 330 NYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACC 389
           NYFFYYGT IFQAVG+ DSY T+IV G+VNF+STF++ + V+ +GRRKCL+WG+A+M CC
Sbjct: 61  NYFFYYGTVIFQAVGLKDSYQTAIVFGIVNFASTFVAFYVVDHYGRRKCLMWGAAAMVCC 120

Query: 390 FVVFASMGVTKLYPNGM---DQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYP 446
           +VV+AS+GVT+LYP+G+   D  +SK AGN MIVF+C FIF FA +WAPI +VVV+ES+P
Sbjct: 121 YVVYASVGVTRLYPDGIKHKDTNSSKGAGNCMIVFSCFFIFSFACTWAPICWVVVSESFP 180

Query: 447 QRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETK 506
            +IK + MA+A   NW WNF + F TPFIT AINFYYG+V               V E K
Sbjct: 181 LKIKPKGMALANGCNWFWNFLVSFFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPEMK 240

Query: 507 GLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIFSKK 559
           GL+LEE +E+++EG LPWKS  W+P+SRRGAD D+ A Q DD+ FF+K+F  K
Sbjct: 241 GLTLEEVDELWQEGVLPWKSPDWVPASRRGADVDLDAFQKDDKPFFKKMFGSK 293

>KLLA0E21021g 1870154..1871740 gi|32400014|emb|CAE00632.1
           Kluyveromyces lactis hexose transporter 3, hypothetical
           start
          Length = 528

 Score =  343 bits (881), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 187/473 (39%), Positives = 271/473 (57%), Gaps = 15/473 (3%)

Query: 55  ICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGE--YYLSDVRTGLIVVTFN 112
           I LCL  +F GFIFGWD+GTIGG      F+  FG   D     +Y   +  GLIV  FN
Sbjct: 58  ILLCLATSFAGFIFGWDVGTIGGITNMVSFQNFFGTNFDSSSNTHYFPKLLIGLIVSIFN 117

Query: 113 LGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGG 172
           + CA GG+ L ++ D  GRK G+            I  +  ++W  +F  R +SGLGVG 
Sbjct: 118 ISCALGGLFLVKIADINGRKPGIYAAITIYSLGTLIGWTCGSSWWYFFFARFISGLGVGA 177

Query: 173 IAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSY---TNSIQWRMPLG 229
            AV+ P  I+E AP ++RG  + LYQLMIT GI +G   NY  +S    T++  W++P+G
Sbjct: 178 TAVMIPMFIAESAPINIRGAMVVLYQLMITLGILLGNVINYCCRSTLHETDNATWKIPVG 237

Query: 230 LGFAWALIMVLGMMMVPESPRYLIEK-GKFEEAKRSLAKSNKTTVDDPIVLREFDVINAG 288
           LG  WA I+ LG+  +PESP +L ++ G   +AK + A  N   VDDPIV      +   
Sbjct: 238 LGNVWAAIVALGVHFMPESPVFLTKRLGSALKAKAAFAHMNNLDVDDPIVDSHIRKMMES 297

Query: 289 VEAERAIGN---ASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGM 345
            +AE +  N    S  E    + ++  R+ +GIMV + QQL+G NYFFYYGTT+F +VG+
Sbjct: 298 ADAEVSTHNDMKNSRFEFILGQPRLGFRLFIGIMVMAFQQLSGANYFFYYGTTLFNSVGI 357

Query: 346 DDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNG 405
           +D Y+TSI+L  VNF STF  ++ VE+ GR+ CL+ GSA M  C  V+AS+G   L    
Sbjct: 358 EDPYLTSILLSSVNFISTFFGIYLVEKLGRKACLILGSAGMFTCMSVYASVGSFAL---- 413

Query: 406 MDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWN 465
               + +++G +M+ F C++I  FA +  P++FVV++E +P R K  +MA+  + NW+ N
Sbjct: 414 --NKSPQNSGAIMVTFTCVYIMFFACTSGPVSFVVISELFPSRTKAISMAVCTSINWLCN 471

Query: 466 FAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYE 518
           F I  CTP++T  I F +GFV               + ETK  + E+ + +Y 
Sbjct: 472 FFISLCTPYVTDKIGFKFGFVFAGCLFVSFWFFTFLLKETKNKTPEQVDALYS 524

>Kwal_55.20068
          Length = 267

 Score =  328 bits (841), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 153/257 (59%), Positives = 196/257 (76%), Gaps = 2/257 (0%)

Query: 296 GNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVL 355
           G ASWAEL + K ++L+R I GIM+ SLQQLTG NYFFYYGTTIF AVG+ DS+ TSI+L
Sbjct: 3   GKASWAELITGKPQMLKRTINGIMIMSLQQLTGDNYFFYYGTTIFNAVGLKDSFQTSIIL 62

Query: 356 GVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQP--TSKS 413
           G+VNF ST +SL++V++FGRR CL++G+  M  C+ V+AS+GVT+LYP+G +    TSK 
Sbjct: 63  GIVNFVSTSLSLYTVDKFGRRNCLIYGAIGMIACYTVYASVGVTRLYPDGANHKDVTSKG 122

Query: 414 AGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTP 473
           AGNV+I FAC +IFCFA +WAPIA+V+++E+YP R+K RAM++A AANW+W F I F TP
Sbjct: 123 AGNVLICFACFYIFCFATTWAPIAYVLISETYPLRVKGRAMSLASAANWLWGFLISFFTP 182

Query: 474 FITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSS 533
           FITSAINFYYG+V               + ETKGL+LEE NEMY EG LPWKS  W+P+S
Sbjct: 183 FITSAINFYYGYVFMGCMVFAVFYVFFLIPETKGLTLEEVNEMYAEGVLPWKSANWVPAS 242

Query: 534 RRGADYDVHATQNDDQT 550
           RRGADYD  A  ++D +
Sbjct: 243 RRGADYDADALNHEDMS 259

>AFR602W [3794] [Homologous to ScYNL318C (HXT14 ) - NSH]
           complement(1523019..1524695) [1677 bp, 558 aa]
          Length = 558

 Score =  338 bits (866), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 181/484 (37%), Positives = 271/484 (55%), Gaps = 11/484 (2%)

Query: 43  GAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGEL--NDEGEYYLS 100
            +P P  +    +  CL +AF G IFGWD+GTIGG      F+   G     D G +   
Sbjct: 76  ASPVPEGSLVRPVLYCLSVAFCGIIFGWDLGTIGGISTMPSFQNTLGPRFNGDTGLHEFP 135

Query: 101 DVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYF 160
               GL++  FN+GCA GG+ + RLGD  GRKI +            +Q+ S + W +YF
Sbjct: 136 GRLLGLLIGIFNIGCAIGGLTIARLGDIKGRKIAILTSLLVYAVGMFVQLGSGHFWYRYF 195

Query: 161 IGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTN 220
           IGR+++GL VG   VL P  +SE+AP  +RG  I LYQ++I  GI +G   NY  K   +
Sbjct: 196 IGRLIAGLAVGATMVLVPMFLSELAPVRIRGAMIVLYQVVICLGIALGSIVNYACKELVH 255

Query: 221 ----SIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDP 276
               ++ W++P+     + +++ L +++ PES  +L  KG  E+AKRS A  N  + D P
Sbjct: 256 DTLSNMTWKVPIFFQIGFTVLLSLALLITPESAEFLAMKGHLEKAKRSFAVMNGLSKDHP 315

Query: 277 IV-LREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYY 335
            V  R    +   ++++    +    E      ++  R+ +G+ V +LQ L+G NYFFYY
Sbjct: 316 FVEERVASFVQVSMKSDDIEHSGDRWEFIRGNPRLGLRLFIGVTVMALQMLSGVNYFFYY 375

Query: 336 GTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFAS 395
           GTT+F+ VG++D+YVTSI++G V+   TFI ++ VER GR+ CLL G+  M  C  V+A 
Sbjct: 376 GTTLFRFVGIEDAYVTSIIIGCVDLLGTFIGVYIVERLGRKICLLSGATGMFICMTVYAC 435

Query: 396 MGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMA 455
           +G   L     D   +K+ G VMI F C+F+  FA +  P++ VV++E +P R K  +MA
Sbjct: 436 LGSFAL----KDDSNNKTVGAVMIFFTCVFVMFFAATSGPVSMVVMSEIFPIRTKVMSMA 491

Query: 456 IAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNE 515
           I  + NW+ NF I F TP +T AIN+ +GFV               V ETKGL+ E+ + 
Sbjct: 492 ICTSVNWLVNFLIAFVTPDVTDAINYRFGFVFSGCLLFSIVFFIYLVPETKGLTHEQVDA 551

Query: 516 MYEE 519
           +YE+
Sbjct: 552 IYEK 555

>Scas_716.53
          Length = 523

 Score =  332 bits (851), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/491 (39%), Positives = 273/491 (55%), Gaps = 25/491 (5%)

Query: 39  NENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGE-- 96
            EN+  P  I    T + +CL I+FGGF+FGWDIGTIGG    + FK RFG   D+G+  
Sbjct: 47  QENKKNPSLI----TPMLICLAISFGGFLFGWDIGTIGGIANMSSFKERFGTRQDQGKGT 102

Query: 97  YYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNW 156
            +   +  GLI+  FNL    GG+ L + GD++GRK               +Q+     W
Sbjct: 103 KHFPGLLIGLIIGIFNLSAGVGGVALAKCGDWWGRKRATYFFIFIYSIGLLVQLIHNRAW 162

Query: 157 IQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVG-----YCT 211
            Q FIGR++ GL +GGI V+ P  ISEIAP  +RG  ++ YQL IT GI VG      C 
Sbjct: 163 FQIFIGRLICGLAIGGINVIVPMFISEIAPLRVRGSMVTFYQLKITFGILVGNITVFLCH 222

Query: 212 NYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYL-IEKGKFEEAKRSLAKSNK 270
           N  S+S+ N   W++PLGLGF WA I++LG+   PES +YL I+K +++ A  S A+ N 
Sbjct: 223 NGFSRSHQNE-AWQIPLGLGFVWAFIVILGLYNSPESAQYLGIKKERWDAALMSTARMNN 281

Query: 271 TTVDDPIVLREFDVINAGVEAERAIGNASWAELFS---TKGKVLQRVIMGIMVQSLQQLT 327
            +  D   +   + +    E +R +  +S   +F     K K+  R+ +GIM+   QQL+
Sbjct: 282 LSTGDIRAINIVEEMQRRAEQDR-LEKSSRRNIFEFIFGKPKLGLRLFIGIMLMIFQQLS 340

Query: 328 GCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMA 387
           G NYFFYYGTTIF  VG++D Y T+I+L  VNF +TF  ++ VE   RR  L++GS  M 
Sbjct: 341 GINYFFYYGTTIFAKVGLNDPYTTAIILSSVNFVATFFGIYFVEALRRRTSLVFGSIGMF 400

Query: 388 CCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQ 447
           CC ++++SMG   L  +G         G  MIV  C++I  FA++  P+  V+V+E YP 
Sbjct: 401 CCMMIYSSMGSFALNTDG--------TGITMIVVTCVYIALFAITLGPVTIVLVSELYPM 452

Query: 448 RIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKG 507
           R K  +MA    ANWI NF I F TP IT+ I F YG+V               V ETK 
Sbjct: 453 RTKAMSMATCSFANWIMNFLITFLTPLITAQIGFKYGYVFAVCLFFSTCFDWTTVPETKN 512

Query: 508 LSLEEFNEMYE 518
            +  E + M+ 
Sbjct: 513 KTPTEIDNMFS 523

>YNL318C (HXT14) [4295] chr14 complement(38706..40328) Member of the
           hexose transporter family of the major facilitator
           superfamily (MFS) [1623 bp, 540 aa]
          Length = 540

 Score =  313 bits (801), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/521 (35%), Positives = 286/521 (54%), Gaps = 40/521 (7%)

Query: 20  FPDPKQIKSVEDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFV 79
           + D K+ +++E  + K+  N +   P         + LCL+I+ GGFIFGWDIGTIGG  
Sbjct: 36  YLDDKE-ENIEGQAAKISHNASLHIP---------VLLCLVISLGGFIFGWDIGTIGGMT 85

Query: 80  GQTDFKRRFGELN----DEGEYY----LSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGR 131
               F+ +FG  N    DE  +     L+D++ GLI+  FN+ C  G + L ++GD+ GR
Sbjct: 86  NMVSFQEKFGTTNIIHDDETIFVSTKKLTDLQIGLIISIFNISCGVGALTLSKIGDWIGR 145

Query: 132 KIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRG 191
           K G+            IQI S   W    +GR V+G+GVG   VL P  +SE +P  +RG
Sbjct: 146 KGGIWFALVVYCIGITIQILSYGRWYFLTLGRAVTGIGVGVTTVLVPMFLSENSPLKIRG 205

Query: 192 MCISLYQLMITGGIFVGYCTNY----GSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPE 247
             +S YQL++T GI +G   N+      K  T +I W++PL LG+ WA+I+ + ++ VPE
Sbjct: 206 SMVSTYQLIVTFGILMGNILNFICERCYKDPTQNIAWQLPLFLGYIWAIIIGMSLVYVPE 265

Query: 248 SPRYLIE-KGKFEEAKRSLAKSNKTTVDDPIVLREFDVI---------NAGVEAERAIGN 297
           SP+YL + K     AK S A+ N     D +V+   D +               ++++  
Sbjct: 266 SPQYLAKIKNDVPSAKYSFARMNGIPATDSMVIEFIDDLLENNYNNEETNNESKKQSLVK 325

Query: 298 ASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGV 357
            +  E    K K+  R+I+G+M+ + QQL+G NYFFYYGT++F+ VG+ D Y+TSI+L  
Sbjct: 326 RNTFEFIMGKPKLWLRLIIGMMIMAFQQLSGINYFFYYGTSVFKGVGIKDPYITSIILSS 385

Query: 358 VNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNV 417
           VNF ST + ++ VE++G + CLL+GS ++    + +A++G       G +   S     V
Sbjct: 386 VNFLSTILGIYYVEKWGHKTCLLYGSTNLLFYMMTYATVGTF-----GRETDFSNI---V 437

Query: 418 MIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITS 477
           +I+  C FIF FA++  P+ FV+V+E +P R +  +MAI    NW++NF I   TP I S
Sbjct: 438 LIIVTCCFIFWFAITLGPVTFVLVSELFPLRTRAISMAICTFINWMFNFLISLLTPMIVS 497

Query: 478 AINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYE 518
            I+F  G++               V ET+  + +E N+++E
Sbjct: 498 KIDFKLGYIFAACLLALIIFSWILVPETRKKNEQEINKIFE 538

>CAGL0M04103g 452677..454272 similar to sp|P42833 Saccharomyces
           cerevisiae YNL318c HXT1 hexose transport protein,
           hypothetical start
          Length = 531

 Score =  311 bits (796), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 176/485 (36%), Positives = 264/485 (54%), Gaps = 20/485 (4%)

Query: 46  KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELND--EGEYYLSDVR 103
           K I  +   + LC +I+FGG I GWDIGT+GG      F   FG+          LS+++
Sbjct: 52  KYIRQHTKAVVLCCLISFGGMILGWDIGTVGGVSIMPSFNNAFGDQTTIVSSAKELSNMK 111

Query: 104 TGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGR 163
            GL +  FN+GCA GGI+  RL +  GR++G+            +Q+ S  N+I     R
Sbjct: 112 RGLYISIFNIGCALGGIMFSRLSNTVGRRVGILTAIAKYTLVLTVQLFSNGNFILLLASR 171

Query: 164 IVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSY----- 218
            V G+ VG I+VL P  +SE AP  +RG  + +YQL IT GI  G   NY +  +     
Sbjct: 172 FVLGVTVGAISVLVPMFVSESAPIKIRGALVVVYQLAITLGILFGNILNYMTNKHLSMVD 231

Query: 219 -TNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIE-KGKFEEAKRSLAKSNKTTVDDP 276
             N++ W++P+  G+ WA I+ +G  + PES  +L + +  +E AK S +  N  +V D 
Sbjct: 232 PMNNMAWKIPMLFGYLWAAIVAVGACITPESVHFLAKIRNDYESAKISYSIMNNISVFDH 291

Query: 277 IVLREFD--VINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFY 334
             +   +  ++   V  E  + N  +  L+  K K  +R+++GIMV + QQL+G NYFFY
Sbjct: 292 ETIDYVNNLLVKQDVYNENDLRNHKFEFLYG-KPKYGKRLLIGIMVMAFQQLSGINYFFY 350

Query: 335 YGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFA 394
           YGT++F++VG+ D+Y T+I+L  VNF STF  ++ VE  GRR  L++GS  M  C + +A
Sbjct: 351 YGTSLFKSVGIKDTYATAIILSSVNFISTFAGIYLVESLGRRSTLIYGSFGMFICMIFYA 410

Query: 395 SMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAM 454
           S G   L  + +          V+I+  CLFI  FA++  P++FVVVAE +P R +  +M
Sbjct: 411 SFGTLSLRKDLLSF--------VLIIVTCLFISIFAITIGPVSFVVVAELFPTRTRSVSM 462

Query: 455 AIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFN 514
           +I  + NW+ NFAI   TP I + I F YGF                V ETK  + EE +
Sbjct: 463 SICSSFNWLVNFAIALATPVIINRIGFLYGFFFAGCLLLATGFEAFFVPETKNKTEEEID 522

Query: 515 EMYEE 519
            M++ 
Sbjct: 523 YMFQN 527

>Kwal_56.24841
          Length = 511

 Score =  298 bits (764), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 165/492 (33%), Positives = 263/492 (53%), Gaps = 18/492 (3%)

Query: 52  FTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTF 111
           +  + + L +AFGG +FG+D GTI G +     K  F    D G +   +  T LI    
Sbjct: 20  YRALSVGLFVAFGGILFGYDTGTISGILAMDHVKTTF---TDRGHFTAGE--TSLITSIL 74

Query: 112 NLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVG 171
           + G  FG +    + D  GR+ GL            +Q+++T   +   +GR+++G+GVG
Sbjct: 75  SAGTFFGSMSAPLVSDNLGRRYGLIVSTVIFTIGVILQVAATTQEL-LIVGRVIAGVGVG 133

Query: 172 GIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLG 231
            ++ + P   SE APK +RG  +S YQ  IT G+ +  C N G+ +  +S  +R+PL + 
Sbjct: 134 VLSAIVPLYQSEAAPKWIRGAVVSAYQWAITIGLLLAACVNQGTHARNDSGSYRIPLAIQ 193

Query: 232 FAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEA 291
           F WA+IM +GM  +PESPR+ ++KGK  EA  +L++      DDP V  E + I A    
Sbjct: 194 FLWAIIMFIGMCFLPESPRFYVKKGKVPEALSALSRLRGLPKDDPAVEAELEEILANYNY 253

Query: 292 ERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVT 351
           E++ G+ +  + F       +R+ +GI +Q+LQQLTG N+ FYYGT  FQ  G+ + +V 
Sbjct: 254 EKSFGSTTVWDCFRPANHQSKRMFIGIAIQALQQLTGINFIFYYGTQFFQHSGIRNPFVI 313

Query: 352 SIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTS 411
            +++ +VN   T   +  +E  GRR  LLWG+  M    ++ AS+G           P S
Sbjct: 314 QLIMNIVNVIFTIPGIALIELAGRRNLLLWGAIGMCVSEIIVASVGTA--------LPDS 365

Query: 412 KSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFC 471
            +A   +I F+C FI  FA +W P+A+VV+ E YP R++ +++A   A+NW++NFAI + 
Sbjct: 366 TAANKTLIAFSCTFIASFAATWGPLAWVVIGEIYPLRVRGKSVAFCTASNWLFNFAIAYA 425

Query: 472 TPFIT----SAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPWKSD 527
           TP++     + +     F+               V ETKGL+LE+ +E+++ G     S 
Sbjct: 426 TPYLVDEDRANLQSKVFFIWGGCTFLCFIFVYFCVYETKGLTLEQVDELFDSGASARTSK 485

Query: 528 TWIPSSRRGADY 539
            +IPS     DY
Sbjct: 486 RFIPSEGYAHDY 497

>Kwal_27.9678
          Length = 513

 Score =  288 bits (738), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 165/490 (33%), Positives = 262/490 (53%), Gaps = 18/490 (3%)

Query: 52  FTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTF 111
           F  + + L +AFGG +FG+D GTI G +     K+ F      G +   +  T LI    
Sbjct: 19  FRAVFIGLFVAFGGILFGYDTGTISGVLAMDYVKQHF---TSRGHFTADE--TSLITAIL 73

Query: 112 NLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVG 171
           + G   G I+     D  GR++GL            +Q+++T   +    GR+++G GVG
Sbjct: 74  SAGTFCGAILAPLASDTIGRRLGLILSTIIFTVGVVLQVAATGQDL-LIAGRVIAGAGVG 132

Query: 172 GIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLG 231
            ++ + P   SE +PK +RG  +S YQ  IT G+ +  C N G+ +  +S  +R+PL L 
Sbjct: 133 VLSAIVPLYQSEASPKWIRGAVVSCYQWAITIGLLLAACVNQGTHARQDSGSYRIPLALQ 192

Query: 232 FAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEA 291
             WALI+ +GM+++PESPR+ I K K  EA+R+L+K      +   V  E + I A  + 
Sbjct: 193 LLWALILFIGMVILPESPRFYIMKEKVPEARRALSKLRGLPEEHCAVEAELEEIVANYKF 252

Query: 292 ERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVT 351
           E + G+ S  + F      L+R+++GI VQ LQQLTG N+ FYYGT  FQ  G+ D ++ 
Sbjct: 253 ESSFGSNSVWDCFKPANHQLKRILIGIAVQGLQQLTGINFIFYYGTQFFQNSGIKDPFII 312

Query: 352 SIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTS 411
            +++ VVN   T   +  VE  GRR  LLWG+  M    ++ A++G           P S
Sbjct: 313 QLIMNVVNVIMTIPGIALVEIAGRRNLLLWGAVGMCVSELIVAAVGTA--------LPDS 364

Query: 412 KSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFC 471
            SA   +I F+C FI  FA +W P+A+VVV E +P R++ +++A+  A+NW++NFAI + 
Sbjct: 365 FSANKTLIAFSCTFIASFAATWGPLAWVVVGEIFPLRVRAKSVAVCAASNWLFNFAIAYA 424

Query: 472 TPFITSA----INFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPWKSD 527
           TP++  +    +     F+               + ETKGL+LE+ ++++E      +S 
Sbjct: 425 TPYLVDSEHANLQSKVFFIWGGCTFLCFLFVYFFIYETKGLTLEQIDQLFETCPSARQSK 484

Query: 528 TWIPSSRRGA 537
            +IP+ R  A
Sbjct: 485 GFIPTERLEA 494

>Kwal_55.20064
          Length = 238

 Score =  257 bits (656), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 151/202 (74%)

Query: 27  KSVEDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKR 86
           +S +++    K  E + A K    +  V   C+M+AFGGF+FGWD GTI GFV QTDFKR
Sbjct: 37  ESHDEIDALKKDAEEQLANKKSGDFVFVSLCCIMVAFGGFVFGWDTGTISGFVAQTDFKR 96

Query: 87  RFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXX 146
           RFG+ N +GE+YLS+VRTGL+V  FN+GCA GGI+LG+LG+ YGR++GL           
Sbjct: 97  RFGQTNSKGEHYLSNVRTGLMVSIFNIGCAIGGIVLGKLGEVYGRRLGLTIVVVIYAVGI 156

Query: 147 XIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIF 206
            IQI+S + W QYFIGRI+SGLGVG I VLSP LISE++PKHLRG  +S YQ M+TGGIF
Sbjct: 157 IIQIASIDKWYQYFIGRIISGLGVGAITVLSPMLISEVSPKHLRGTLVSCYQFMVTGGIF 216

Query: 207 VGYCTNYGSKSYTNSIQWRMPL 228
           +GYC NYG+K+Y+NS+QWR+PL
Sbjct: 217 LGYCANYGTKTYSNSVQWRVPL 238

>Scas_624.5
          Length = 798

 Score =  254 bits (648), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 158/497 (31%), Positives = 244/497 (49%), Gaps = 32/497 (6%)

Query: 45  PKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRT 104
           P P+ +      +   +A GGF+FG+D G I         K           ++ ++ + 
Sbjct: 103 PLPMRSNVMSFLVGAFVAVGGFLFGYDTGLINSLTDMAYVKSHLAP----NHHFFTNEQM 158

Query: 105 GLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXX-XXIQISSTNNWIQYFIGR 163
            ++V   +LG  FG +    + D YGRK  +             +Q++S+  W    IGR
Sbjct: 159 SIVVSFLSLGTFFGALTAPVIADSYGRKATIMFSTAVIFSIGNSLQVASSG-WKLLIIGR 217

Query: 164 IVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQ 223
           +VSGLG+G I+ + P   +E A K+LRG  IS YQ  IT G+ V    + G++   N   
Sbjct: 218 VVSGLGIGLISAVVPLYQAEAAKKNLRGAIISTYQCAITLGLLVSSAVSQGTQHINNPAS 277

Query: 224 WRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFD 283
           +R+P+GL + W+  + +GM+ +PESPRY + K   + A +SL+      + DP +L E  
Sbjct: 278 YRIPIGLQYVWSSFLAIGMIFLPESPRYYVMKDDIDRAAKSLSFLRGVPIQDPRLLEELV 337

Query: 284 VINAGVEAERAIGNASWAELFST---KGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIF 340
            I A  + E + G +S  + F +   + K + R+  GI +Q+ QQ +G N+ FYYG T F
Sbjct: 338 EIKATYDYEASFGPSSIWDCFKSSENRPKQVLRMFTGIAIQTFQQFSGINFIFYYGVTFF 397

Query: 341 QAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTK 400
              G++ SY+ S++   VN +     ++ VE  GRRK LL+G   +     V A +G   
Sbjct: 398 SKTGVNKSYMVSLITYAVNVAFNIPGMFLVEYLGRRKILLFGGIVVTASNFVIAGVGCR- 456

Query: 401 LYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAA 460
                MD   S  A  VMI F CLFI  F+ +W+   +V+ AE YP  ++ +  AI  AA
Sbjct: 457 -----MD---SVVANKVMIAFICLFIASFSATWSGAVWVISAELYPLGVRSKCTAICAAA 508

Query: 461 NWIWNFAIGFCTPFI-------TSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEF 513
           NW+ NF     TP+I       T   N +  F+               V ET GL+LEE 
Sbjct: 509 NWLVNFICALITPYIVNSGSESTMGANIF--FIWGSLNALGVVCVFFTVYETSGLTLEEI 566

Query: 514 NEMYEE-----GTLPWK 525
           +E+Y E     G++ W 
Sbjct: 567 DELYRESANCFGSIAWN 583

>CAGL0I03872g 337985..340273 some similarities with sp|Q12300
           Saccharomyces cerevisiae YDL138w RGT2 or sp|P10870
           Saccharomyces cerevisiae YDL194w SNF3, hypothetical
           start
          Length = 762

 Score =  243 bits (621), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 155/515 (30%), Positives = 247/515 (47%), Gaps = 32/515 (6%)

Query: 59  LMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFG 118
           L +A GGF++G+D G I         K            + +  +  ++V   +LG   G
Sbjct: 121 LFVAVGGFLYGYDTGLINSITDMKYVKEHIAP----NHSFFTTTQISMLVSFLSLGTFVG 176

Query: 119 GIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSP 178
            +I   + D YGRK  +                +        +GR++SG+G+G I+ + P
Sbjct: 177 ALIAPWISDIYGRKSTIIFSTMIIFSIGNSLQVAAGGLALLIVGRVISGIGIGIISAVVP 236

Query: 179 TLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIM 238
              +E A KH+RG  I+ YQL IT G+ V    + G++S      +R+P+GL + W++++
Sbjct: 237 LYQAEAAQKHMRGAIITTYQLAITLGLLVSSAVSQGTESINAPSSYRVPIGLQYVWSVVL 296

Query: 239 VLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNA 298
            +GM+ +PESPRY I K + EEA RSL+     +++DP +L E   I A  + E + G  
Sbjct: 297 GVGMVFLPESPRYYIMKDEIEEAARSLSFLRGISLEDPRLLEELVEIKANYDYESSFGPV 356

Query: 299 SWAELFST---KGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVL 355
           S  + F +   + K + R+  GI +Q+ QQ +G N+ FYYG   F   G+  SY+ S V 
Sbjct: 357 SIWDCFRSSEQRPKQVLRMFTGISIQAFQQFSGINFIFYYGVYFFNKTGIKSSYLVSFVT 416

Query: 356 GVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAG 415
             VN +     ++ ++  GRRK L++G  +M  C  + A +GV+           S  + 
Sbjct: 417 YAVNVAFNIPGMFLIDYLGRRKVLIFGGIAMTACNFIIAIVGVSA---------KSIVSN 467

Query: 416 NVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFI 475
           NVMI F C+FI  F+ +W  + +V+ AE +P  ++ +  AI  AANW+ NF     TP+I
Sbjct: 468 NVMIAFICVFIAAFSSTWGGVVWVISAELFPLGVRSKCTAICAAANWLVNFVCALMTPYI 527

Query: 476 -------TSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPWKSDT 528
                  TS++     F+               V ET+GL+LEE NE+Y     P+ S+ 
Sbjct: 528 VDTGSNYTSSMGTKIYFIWGSLNALGTIVAYLTVYETRGLTLEEINELYVNSPTPFASNE 587

Query: 529 W---------IPSSRRGADYDVHATQNDDQTFFQK 554
           W         IP      + D H     D     +
Sbjct: 588 WNRKIRTESTIPPMVHDHELDNHIVPTMDNILHSR 622

>YDL138W (RGT2) [730] chr4 (213352..215643) Low-affinity glucose
           sensor responsible for induction of gene expression in
           the presence of high glucose, member of the glucose
           sensor subfamily of the hexose transporter family of the
           major facilitator superfamily (MFS) [2292 bp, 763 aa]
          Length = 763

 Score =  241 bits (614), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 153/500 (30%), Positives = 247/500 (49%), Gaps = 21/500 (4%)

Query: 45  PKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRT 104
           P P+ +    + + + +A GGF+FG+D G I         K            Y +  + 
Sbjct: 90  PLPLRSNVMSVLVGIFVAVGGFLFGYDTGLINSITDMPYVKTYIAP----NHSYFTTSQI 145

Query: 105 GLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRI 164
            ++V   +LG  FG +I   + D YGRK  +                ++   +   +GR+
Sbjct: 146 AILVSFLSLGTFFGALIAPYISDSYGRKPTIMFSTAVIFSIGNSLQVASGGLVLLIVGRV 205

Query: 165 VSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQW 224
           +SG+G+G I+ + P   +E A K+LRG  IS YQ  IT G+ V    + G+ S      +
Sbjct: 206 ISGIGIGIISAVVPLYQAEAAQKNLRGAIISSYQWAITIGLLVSSAVSQGTHSKNGPSSY 265

Query: 225 RMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDV 284
           R+P+GL + W+ I+ +GM+ +PESPRY + K +  +A +SL+      ++DP +L E   
Sbjct: 266 RIPIGLQYVWSSILAVGMIFLPESPRYYVLKDELNKAAKSLSFLRGLPIEDPRLLEELVE 325

Query: 285 INAGVEAERAIGNASWAELFST---KGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQ 341
           I A  + E + G ++  + F T   + K + R+  GI +Q+ QQ +G N+ FYYG   F 
Sbjct: 326 IKATYDYEASFGPSTLLDCFKTSENRPKQILRIFTGIAIQAFQQASGINFIFYYGVNFFN 385

Query: 342 AVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKL 401
             G+D+SY+ S +   VN + +   ++ V+R GRR  LL G   MA   +V A +GV+  
Sbjct: 386 NTGVDNSYLVSFISYAVNVAFSIPGMYLVDRIGRRPVLLAGGVIMAIANLVIAIVGVS-- 443

Query: 402 YPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAAN 461
                 +  +  A  +MI F CLFI  F+ +W  + +VV AE YP  ++ +  AI  AAN
Sbjct: 444 ------EGKTVVASKIMIAFICLFIAAFSATWGGVVWVVSAELYPLGVRSKCTAICAAAN 497

Query: 462 WIWNFAIGFCTPFI------TSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNE 515
           W+ NF     TP+I      TS++     F+               V ET+GL+LEE +E
Sbjct: 498 WLVNFTCALITPYIVDVGSHTSSMGPKIFFIWGGLNVVAVIVVYFAVYETRGLTLEEIDE 557

Query: 516 MYEEGTLPWKSDTWIPSSRR 535
           ++ +      S  W    R+
Sbjct: 558 LFRKAPNSVISSKWNKKIRK 577

>CAGL0J09020g 887145..889715 highly similar to sp|P10870
           Saccharomyces cerevisiae YDL194w SNF3 or sp|Q12300
           Saccharomyces cerevisiae YDL138w RGT2, start by
           similarity
          Length = 856

 Score =  241 bits (616), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 169/539 (31%), Positives = 260/539 (48%), Gaps = 35/539 (6%)

Query: 25  QIKSVEDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDF 84
           ++ +V+D SL          P    ++   I +   +A GGF+FG+D G I   V     
Sbjct: 96  EMSTVDDASLLF------AEPPQKQSHMMSIVVGAFVAVGGFLFGYDTGLINSIVDM--- 146

Query: 85  KRRFGELNDEGEYYLSDVRTGLIVVTF-NLGCAFGGIILGRLGDFYGRKIGLXXXXXXX- 142
             R+   N    +     +   I+V+F +LG   G +    + D YGRK  +        
Sbjct: 147 --RYVRENIAPNHVGFTAQQLAILVSFLSLGTFVGALSAPVISDKYGRKKTIMFSTAVVF 204

Query: 143 XXXXXIQISSTNNWIQYFI-GRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMI 201
                +Q+ + N  IQ  I GR++SGLGVG ++ + P   +E A K LRG  IS YQ  I
Sbjct: 205 SLGNSLQVGAHN--IQLLIAGRVISGLGVGLVSAVVPLYQAEAAHKSLRGAIISTYQWAI 262

Query: 202 TGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEA 261
           T G+ V    + G+ +  ++  +R+P+GL + WA I+  GM+ +PESPRY + + + ++A
Sbjct: 263 TWGLLVSSAVSQGTHNRNDASSYRIPIGLQYVWAYILAAGMLWLPESPRYYVLRDQLDKA 322

Query: 262 KRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELF-STKGKVLQ--RVIMGI 318
            +SL+      + D  +L E   I A  + E + G  ++ + F S K +  Q  R+  GI
Sbjct: 323 AQSLSFLRGVPIHDSGLLEELVEIKATFDYESSFGKTTFWDCFKSNKSRPKQTLRMFTGI 382

Query: 319 MVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKC 378
            +Q+ QQ +G N+ FYYG + F   G+++SY+ S++   VN   +   ++ VE FGRR  
Sbjct: 383 AIQAFQQFSGINFIFYYGVSFFNRSGVENSYIVSLITYAVNVGFSVPGMFLVEYFGRRSV 442

Query: 379 LLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAF 438
           LL+G A M     + A +G +           S  A  VMI F CLFI  FA +W  + +
Sbjct: 443 LLYGGAIMTLSNFIIAIVGSST---------QSVVANKVMIAFICLFIASFAATWGGVVW 493

Query: 439 VVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSA------INFYYGFVXXXXXX 492
           V+ AE YP  ++ +  AI  AANW+ NF   F TP+I         I     F+      
Sbjct: 494 VISAELYPLGVRAKCTAICAAANWLINFVCAFITPYIVDTGERRALIGPKIYFIWGSLNA 553

Query: 493 XXXXXXXXXVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSR-RGADYDVHATQNDDQT 550
                    V ET+GL+LEE +E+Y +      S  W    R R   Y     QN D+ 
Sbjct: 554 LGILVVYFTVYETRGLTLEEIDELYTKSPNGIVSAKWNRRIRHREKTYGHKEQQNRDRN 612

>Kwal_56.24469
          Length = 709

 Score =  239 bits (609), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 155/493 (31%), Positives = 239/493 (48%), Gaps = 23/493 (4%)

Query: 46  KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTG 105
           +P S+  +++ + + +A GGF++G+D G I         K  F E   +     +     
Sbjct: 83  RPQSSLMSIL-VGVFVAVGGFLYGYDTGLINNITEMKYVKTHFAENKQQ----FTAKEMS 137

Query: 106 LIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIV 165
           ++V   +LG  FG ++   + D +GRK  +                + N      IGR+ 
Sbjct: 138 ILVSFLSLGTFFGALVAPFMSDTWGRKTTIIFSTFFVFMVGNSLQVAANGTTLLVIGRVF 197

Query: 166 SGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWR 225
           SG+GVG I+ + P   SE A K +RG  IS YQ  IT G+ V    + G+ +  +   +R
Sbjct: 198 SGVGVGFISAVVPLYQSEAAQKRVRGAIISTYQWAITWGLLVSSAVSQGTHNRMDPSSYR 257

Query: 226 MPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVI 285
           +P+GL F W+ I+  GM+ +PESPRY + K + + A +SLA       DD  +L E   I
Sbjct: 258 IPIGLQFVWSCILGFGMIFLPESPRYYVLKDQLDRAAKSLAFLRGVPEDDSGLLEELVEI 317

Query: 286 NAGVEAERAIGNASWAELF-STKGKVLQRVIM--GIMVQSLQQLTGCNYFFYYGTTIFQA 342
            A  + E + G+ S+ + F S+K +  QR+ M  GI +Q+ QQL+G N+ FYYG   F  
Sbjct: 318 KANYDYEMSFGSFSYLDCFRSSKSRTKQRLRMLTGIAIQAFQQLSGINFIFYYGVNFFSK 377

Query: 343 VGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLY 402
            G+ DSY+ S V   VN       L+ VE  GRRK L++G   M     V A +G  +  
Sbjct: 378 SGVGDSYLVSFVTYAVNVGFNIPGLFLVEYMGRRKVLIFGGVLMTAANFVIAIVGCVE-- 435

Query: 403 PNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANW 462
                   S  A  +MI F C+FI  F+ +W    + + AE YP  ++ +  AI  A+NW
Sbjct: 436 -------RSVIADKIMIAFVCVFIASFSATWGGCVWAISAELYPLGVRSKCTAICAASNW 488

Query: 463 IWNFAIGFCTPFI------TSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEM 516
           + NF     TP+       TS++     F+               V ET+GL+LEE + +
Sbjct: 489 LVNFICAMITPYFIHTGAHTSSLGTKVFFIWGGLNAIGVVVVYLTVYETRGLTLEEIDLL 548

Query: 517 YEEGTLPWKSDTW 529
           Y      + SD+W
Sbjct: 549 YRLSPNCFTSDSW 561

>YDL194W (SNF3) [679] chr4 (111581..114235) High-affinity glucose
           sensor responsible for induction of gene expression in
           the presence of low glucose, member of the glucose
           sensor subfamily of the hexose transporter family of the
           major facilitator superfamily (MFS) [2655 bp, 884 aa]
          Length = 884

 Score =  241 bits (615), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 155/490 (31%), Positives = 239/490 (48%), Gaps = 38/490 (7%)

Query: 45  PKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRT 104
           P    +    IC+ + +A GGF+FG+D G I         K      +D      +  + 
Sbjct: 88  PPQKQSMMMSICVGVFVAVGGFLFGYDTGLINSITSMNYVKSHVAPNHDS----FTAQQM 143

Query: 105 GLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQ------ 158
            ++V   +LG  FG +    + D YGRK  +            I I S  N +Q      
Sbjct: 144 SILVSFLSLGTFFGALTAPFISDSYGRKPTIIFST--------IFIFSIGNSLQVGAGGI 195

Query: 159 --YFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSK 216
               +GR++SG+G+G I+ + P   +E   K LRG  IS YQ  IT G+ V    + G+ 
Sbjct: 196 TLLIVGRVISGIGIGAISAVVPLYQAEATHKSLRGAIISTYQWAITWGLLVSSAVSQGTH 255

Query: 217 SYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDP 276
           +  ++  +R+P+GL + W+  + +GM  +PESPRY + K K +EA +SL+      V D 
Sbjct: 256 ARNDASSYRIPIGLQYVWSSFLAIGMFFLPESPRYYVLKDKLDEAAKSLSFLRGVPVHDS 315

Query: 277 IVLREFDVINAGVEAERAIGNASWAELF-STKGKVLQ--RVIMGIMVQSLQQLTGCNYFF 333
            +L E   I A  + E + G++++ + F S+K +  Q  R+  GI +Q+ QQ +G N+ F
Sbjct: 316 GLLEELVEIKATYDYEASFGSSNFIDCFISSKSRPKQTLRMFTGIALQAFQQFSGINFIF 375

Query: 334 YYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVF 393
           YYG   F   G+ +SY+ S +   VN       L+ VE FGRRK L+ G   M     + 
Sbjct: 376 YYGVNFFNKTGVSNSYLVSFITYAVNVVFNVPGLFFVEFFGRRKVLVVGGVIMTIANFIV 435

Query: 394 ASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRA 453
           A +G +           + +A  VMI F CLFI  F+ +W  + +V+ AE YP  ++ + 
Sbjct: 436 AIVGCSL---------KTVAAAKVMIAFICLFIAAFSATWGGVVWVISAELYPLGVRSKC 486

Query: 454 MAIAVAANWIWNFAIGFCTPFI------TSAINFYYGFVXXXXXXXXXXXXXXXVCETKG 507
            AI  AANW+ NF     TP+I      TS++     F+               V ETKG
Sbjct: 487 TAICAAANWLVNFICALITPYIVDTGSHTSSLGAKIFFIWGSLNAMGVIVVYLTVYETKG 546

Query: 508 LSLEEFNEMY 517
           L+LEE +E+Y
Sbjct: 547 LTLEEIDELY 556

>ADR091W [1832] [Homologous to ScYDL194W (SNF3) - SH; ScYDL138W
           (RGT2) - SH] complement(872925..874919) [1995 bp, 664
           aa]
          Length = 664

 Score =  227 bits (578), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 161/538 (29%), Positives = 250/538 (46%), Gaps = 30/538 (5%)

Query: 20  FPDPKQIKSVEDVSLKVKTNENE-GAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGF 78
           +  P  +  + D S      E E   P    +    I + + +A GGF++G+D G I   
Sbjct: 58  YEQPVMVTDLRDDSEGFSIQETELERPAMRQSNKMSILVGIFVAVGGFLYGYDTGLINSI 117

Query: 79  VGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXX 138
              +  K+ F           + +   ++V   +LG   G +    L D YGRK  +   
Sbjct: 118 TEMSFVKKHFAP----NHVNFTSMEMSILVSFLSLGTFIGALAAPLLADSYGRKSTVIFS 173

Query: 139 XXXXXXX-XXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLY 197
                     +Q+S+T+  +    GR+ SG+ VG I+V+ P    E A K  RG  I  Y
Sbjct: 174 TFIMFLEGTLLQVSATSMAL-LVAGRVASGVAVGLISVVVPLYQGEAAQKWCRGAIICTY 232

Query: 198 QLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGK 257
           Q  IT G+ V    + G+    ++  +R+P+ L + W +I+  GM+++PESPRY + + +
Sbjct: 233 QWAITWGLLVSSAVSQGTYLRNDASSYRIPIALQYVWCIILGSGMLLLPESPRYYVLRDQ 292

Query: 258 FEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFST---KGKVLQRV 314
            ++A  SL+       DD  +L E   I A  + E ++ ++S+ + F T   + K   R+
Sbjct: 293 LDKAALSLSFLRGVPHDDAGLLEELVEIKANYDYEMSLKSSSYLDCFRTSEHRPKQQIRM 352

Query: 315 IMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFG 374
           + GI++Q+ QQ +G N+ FYYG   F + G+  SY+ S V   VN       L+ VE  G
Sbjct: 353 LSGILLQAFQQFSGINFIFYYGVNFFSSTGISKSYLVSFVTYAVNVVFNIPGLFLVEYAG 412

Query: 375 RRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWA 434
           RRK LL G   M     + A +GV+           S  A  VMIVF C+FI  F+ +W 
Sbjct: 413 RRKLLLVGGVLMTISNFIIAIVGVST---------DSVIAKKVMIVFICMFIAAFSATWG 463

Query: 435 PIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFI------TSAINFYYGFVXX 488
            + +V+ AE YP  ++ +  AI  A+NW+ NF     TP++      TS +     FV  
Sbjct: 464 GVVWVMSAEMYPLGVRSKCAAICAASNWLVNFVCAMITPYLIDISSYTSRLGSTIFFVWG 523

Query: 489 XXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRR--GADYDVHAT 544
                        V ET GL+LEE NE+Y        S  W   +RR   +  D H T
Sbjct: 524 SLNAIGVMVVYLTVYETSGLTLEEINELYRRCPSSLASCAW---NRRIKSSPEDYHLT 578

>KLLA0F05181g 510384..512747 gi|2440082|emb|CAA75114.1 Kluyveromyces
           lactis putative glucose sensor, start by similarity
          Length = 787

 Score =  228 bits (581), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 152/498 (30%), Positives = 243/498 (48%), Gaps = 26/498 (5%)

Query: 44  APKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVR 103
           AP    +    I + + +A GGF+FG+D G I          ++F       + + +  +
Sbjct: 79  APPAKQSKKISILVGMFVAVGGFLFGYDTGLINNISEMPYVNQKFAP----NKNHFTTPQ 134

Query: 104 TGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXX-XXXXXIQISSTNNWIQYFIG 162
             ++V   +LG   G ++   + D YGRK  +             +Q+++ +  I   +G
Sbjct: 135 ISILVSFLSLGTFIGALLAPLISDSYGRKTTMIFSTFVVFMIGNSLQVAAGSMTI-LVVG 193

Query: 163 RIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSI 222
           R++SG+ VG I+   P   SE A K +RG  IS YQ  IT G+ V    + G+    ++ 
Sbjct: 194 RVLSGMSVGLISAAVPLYQSEAAQKSVRGAIISCYQWAITWGLLVASAVSQGTYKRMDAS 253

Query: 223 QWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREF 282
            +++P+GL + W+ ++ +G++ +PESPRY + K + ++A +SL+       DD  +L E 
Sbjct: 254 SYQIPIGLQYIWSFLLGVGILFLPESPRYYVFKDRLDKAAKSLSFLRGVPEDDSGLLEEL 313

Query: 283 DVINAGVEAERAIGNASWAELF-STKGKVLQRVIM--GIMVQSLQQLTGCNYFFYYGTTI 339
             I A  + E + G  S+ + F ST+ +  QR+ M  GI +Q+ QQ++G N+ FYYG   
Sbjct: 314 VEIKATYDYEMSFGKISYLDCFRSTRSRTKQRLRMLTGIALQAFQQVSGINFIFYYGVDF 373

Query: 340 FQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVT 399
           F   G+ +SY+ S V   VN +     L+ VE  GRRK LL G   M     + A +G+ 
Sbjct: 374 FNKSGVSESYLVSFVTYAVNVAFNIPGLFLVEYIGRRKLLLMGGILMTISNFIIAIVGLA 433

Query: 400 KLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVA 459
                      S  A  VMI F CLFI  F+ +W    +V+ AE YP  ++ +  AI  A
Sbjct: 434 T---------DSMVANKVMIAFICLFIASFSATWGGGVWVISAELYPLGVRAKCTAICAA 484

Query: 460 ANWIWNFAIGFCTPFI--------TSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLE 511
           +NW+ NF     TP+I         ++I     FV               V ET GLSLE
Sbjct: 485 SNWLINFICALITPYIMHIDSSVRQTSIGTKIFFVWGSLNAVGVLVVYFTVYETNGLSLE 544

Query: 512 EFNEMYEEGTLPWKSDTW 529
           E +E+Y++ +    S  W
Sbjct: 545 EIDELYKKSSSGINSIEW 562

>Scas_701.44
          Length = 876

 Score =  221 bits (564), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 145/472 (30%), Positives = 223/472 (47%), Gaps = 22/472 (4%)

Query: 67  IFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLG 126
           +FG+D G I      T+       L      + ++ +  + V   +LG  FG +      
Sbjct: 116 LFGYDTGLINSI---TEMDYVLTHLTPNHREFTTE-QLSITVSFLSLGTFFGALTAPVFA 171

Query: 127 DFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAP 186
           D YGRK+ +                + N  +   +GR++SG G+G I+ + P   +E A 
Sbjct: 172 DNYGRKVTIMISTLIIFSVGNSLQVAANGIVLLIVGRVISGFGIGIISAVVPLYQAEAAH 231

Query: 187 KHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVP 246
           K LRG  IS YQ  IT G+ V      G+ +   +  +R+P+GL + W+ I+  GM+ +P
Sbjct: 232 KSLRGAIISTYQWAITWGLLVSSAVAQGTHNRHGASSYRIPIGLQYIWSFILAFGMIFLP 291

Query: 247 ESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNAS-WAELFS 305
           ESPRY + K + ++A  SL+   +  + D  +L E   I A  + E + G+   W    S
Sbjct: 292 ESPRYYVLKDQLDKAAESLSFLRRVPIQDSGLLEELVEIKATYDYECSFGSTHFWDCFIS 351

Query: 306 TKGKVLQRVIM--GIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSST 363
           +K +  Q++ M  GI +Q+ QQ +G N+ FYYG   F   G+D+SY+ S +   VN    
Sbjct: 352 SKTRPKQKLRMFTGIAIQAFQQFSGINFIFYYGVNFFNKTGVDNSYLVSFITYAVNVIFN 411

Query: 364 FISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFAC 423
              +  VE  GRRK LL G   M     + A +G T           S  A  VMI F C
Sbjct: 412 IPGMVLVEFIGRRKVLLIGGILMLMSNFIVAIVGSTV---------ESVVADKVMIAFIC 462

Query: 424 LFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFI------TS 477
           LFI  F+ +W  + +V+ AE YP  ++ +  AI  AANW+ NF     TP+I      TS
Sbjct: 463 LFIASFSATWGGVVWVISAELYPLGVRSKCTAICAAANWLVNFICCLITPYIVDTGSHTS 522

Query: 478 AINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPWKSDTW 529
           ++     ++               V ETKGL+LE+ +E+Y   +    S  W
Sbjct: 523 SMGTKIYYIWGSLNVLGVIVVYFTVYETKGLTLEQIDELYSRASNSINSTKW 574

>Kwal_34.16261
          Length = 327

 Score =  182 bits (461), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 137/217 (63%), Gaps = 3/217 (1%)

Query: 54  VICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDE-GEYYLSDVRTGLIVVTFN 112
           V+  C  I+F GF FG+D GTIGG      + RRFG L+ E GEY+++    G++V  F+
Sbjct: 58  VVLSCFGISFTGFFFGYDTGTIGGITNMQAWLRRFGHLDVESGEYHMATALVGIVVSAFH 117

Query: 113 LGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISS-TNNWIQYFIGRIVSGLGVG 171
           +GC  GG  + RL D  GR+I +            IQ+S+  + W Q+ IGR+V+GL VG
Sbjct: 118 IGCIIGGFTIARLADHLGRRIPIAIACIIYMIGISIQMSAGQDKWYQFMIGRMVTGLTVG 177

Query: 172 GIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKS-YTNSIQWRMPLGL 230
             AVLSP L+SEIAP  +RG+ ++ YQ+ +T GI VGY   Y +KS Y++   WR+PL  
Sbjct: 178 ANAVLSPMLLSEIAPPGIRGLFVNFYQVNVTHGILVGYIVVYATKSTYSDDRMWRLPLIG 237

Query: 231 GFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAK 267
           GF +++I++  +   PESPRYLI++ +FE+AK   A+
Sbjct: 238 GFVFSMIILPLLARAPESPRYLIKRCRFEDAKCVFAR 274

>AEL042C [2464] [Homologous to ScYOL156W (HXT11) - SH]
           (557191..558834) [1644 bp, 547 aa]
          Length = 547

 Score =  187 bits (475), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 138/522 (26%), Positives = 237/522 (45%), Gaps = 33/522 (6%)

Query: 45  PKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRT 104
           PK  + Y   +  C+     G +FG+DI ++        +K  F   N+        +  
Sbjct: 23  PKVYNVYLVAVVACI----SGMMFGFDISSMSSMQDFEPYKDYFKHPNE--------LTQ 70

Query: 105 GLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRI 164
           G I  +   G   G I+   + D +GR++ L            +Q ++ N     F+GRI
Sbjct: 71  GGITASMAAGSLLGSILSPGISDAFGRRVSLHMCSSLWIIGAVLQTAAQNQ-AMLFVGRI 129

Query: 165 VSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQW 224
           V+GLGVG  + ++P   +E++P  +RG    L+QL +T GI V +   YGS S  +   +
Sbjct: 130 VAGLGVGFGSSVAPVYTAEVSPPKIRGAVGGLFQLSVTVGILVMFLIGYGSVSLNSVASF 189

Query: 225 RMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKT-TVDDPIVLREFD 283
           R+   +     ++++L   ++PESPR+L   G+++E    + K  ++  V D  +    +
Sbjct: 190 RVAWSMQLVPGVVLLLATFLLPESPRWLANHGRWDETTLVVEKVGRSVNVSDEELRIHIN 249

Query: 284 VINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAV 343
            I   V  +    + ++A+LF  K +  +++ +G+  Q  QQL G N   YY   +F+  
Sbjct: 250 EIRERVALDEMARDFTYADLFRRKTQ--RKIFIGMAAQMWQQLCGMNVMMYYIVHVFKMA 307

Query: 344 GM--DDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKL 401
           G   + + V+SIV  V+N   T  SL+ V+R GRR  L+ G   M     ++A  G+   
Sbjct: 308 GFSGNQNLVSSIVQYVLNVGMTIPSLFLVDRAGRRPVLIIGGVLMFTW--LYAVAGILAT 365

Query: 402 Y----PNGMD---------QPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQR 448
           Y    PNG++          P   SA   +IV + LF+  FA +W    +V  AE +   
Sbjct: 366 YSVPRPNGVEGNTTVRIEIPPERSSAAKAVIVCSYLFVCSFAPTWGIGIWVYCAEIFNNI 425

Query: 449 IKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGL 508
            + R  A+  + NW +NFA+    P     I +    +                 ETKG 
Sbjct: 426 ERARGSALCTSVNWAFNFALAMFVPTAFKNITWRTYIIFGTFSVALTIHAFLSFPETKGK 485

Query: 509 SLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQT 550
           +LEE +EM++     W++ ++ P   + A   + +    D T
Sbjct: 486 TLEEIDEMWDAHIPAWRTASYKPELAQMAAPKLSSGSISDAT 527

>Kwal_34.16190
          Length = 556

 Score =  179 bits (453), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 134/521 (25%), Positives = 228/521 (43%), Gaps = 29/521 (5%)

Query: 45  PKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRT 104
           PK  + Y   +  C+     G +FG+DI ++   +G  +++  FG        Y      
Sbjct: 24  PKIYNIYVVGLVACI----SGLMFGFDISSMSSMIGTPEYREHFG--------YPGSTAQ 71

Query: 105 GLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRI 164
           G I    + G   G ++     D +GR++ L            IQ ++ N  +   +GR+
Sbjct: 72  GGITGAMSGGSLLGSLVSPNFTDAFGRRVSLHLCAALWIAGAIIQCAAQNRGM-LIVGRV 130

Query: 165 VSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQW 224
           + G+GVG  + ++P   SE+AP ++RG    L+Q  +T GI + +   YG      +  +
Sbjct: 131 IGGMGVGFGSSVAPVYCSEVAPPNIRGTVCGLFQFSVTLGIMILFYVGYGCHFIHGTAAF 190

Query: 225 RMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKT-TVDDPIVLREFD 283
           R+  G+     L +++    +PESPR+L    ++EEA   +A+      VDDP V  + +
Sbjct: 191 RITWGVQIVPGLALLVAAFFLPESPRWLANNDRWEEASEVVARIGANGDVDDPRVQIQLE 250

Query: 284 VINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAV 343
            I   V  ++      +  LF  + K L ++++G+  Q  QQL G N   YY   IFQ  
Sbjct: 251 EIKEQVILDQQALGFGYRHLF--REKTLNKIVVGVCAQMWQQLCGMNVMMYYIVYIFQMA 308

Query: 344 GMDDS--YVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASM--GVT 399
           G   S   V+  +  V+N   T  +L+ V++ GRR  L+ G   M     V A +    T
Sbjct: 309 GYSGSRVLVSGSIQYVLNVVMTIPALFLVDKVGRRPVLIVGGIFMFIWLFVVAGLLANYT 368

Query: 400 KLYPNGMDQPTS---------KSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIK 450
              PNG +   +         KSA   +I  + LF+  FA SW    ++  +E +    +
Sbjct: 369 VPSPNGFEGDETVRIRIPSYNKSAAKGVIAASYLFVCSFAPSWGIGIWIYCSEIFNNMER 428

Query: 451 QRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSL 510
            R  A+  + NW +NFA+    P     I++    +                 ETKG +L
Sbjct: 429 ARGSALCTSVNWGFNFALALFVPSAFRNISWKTYIIFGVFSVVLTIQTFLMFPETKGKTL 488

Query: 511 EEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTF 551
           EE ++M+ +    WK+ +++P      D D +        F
Sbjct: 489 EEIDQMWADHVPAWKTASYVPDVPFARDEDGNKLAPKSHHF 529

>Sklu_2439.20 YDR536W, Contig c2439 31933-33648
          Length = 571

 Score =  171 bits (434), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 138/491 (28%), Positives = 229/491 (46%), Gaps = 36/491 (7%)

Query: 60  MIAFGGF-IFGWDIGTIGGFVGQTDFKRRF---GELNDEGEYYLSDVRTGLIVVTFNLGC 115
           + A  GF +FG+D G + G +   +F   F    +++D   +  + V  G +   + LGC
Sbjct: 27  ITAVTGFSLFGYDQGLMSGIITGKEFNSEFPATHKVSDHDRH--ATVVQGAVTSCYELGC 84

Query: 116 AFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTN-NWI--QYFIGRIVSGLGVGG 172
            FG + +   G+  GRK  +            I  ++   +W   Q+ IGR+++G+G G 
Sbjct: 85  FFGSLFVMFRGEHIGRKPLVIFGALLTVVGTVISTAAFGPHWGLGQFVIGRVITGIGTGM 144

Query: 173 IAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGF 232
                P   SE++    RG+ ++L   +I  G  + Y  ++G     +S+QWR P+ +  
Sbjct: 145 NTSTIPVWQSEMSKPENRGLLVNLEGSVIAVGTMIAYWIDFGLSYVNSSVQWRFPVAMQI 204

Query: 233 AWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAE 292
            +AL++++G++ +P+SPR+L+ +G+ EEA   L K +    +D  +L E  VI   V   
Sbjct: 205 FFALLLLVGIVQLPDSPRWLMSQGRREEAMYVLGKLDGLDPNDDQILAEATVIQDAVNRF 264

Query: 293 RAIGNASWAELFS-TKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIF-QAVGMDDSYV 350
           R     S  +LF+  KG+  QR ++    Q  QQ TGCN   YY T +F + + +D  Y 
Sbjct: 265 RH-QKRSVKDLFTGGKGQNFQRALIAASTQFFQQFTGCNAAIYYSTVLFNETIKLD--YR 321

Query: 351 TSIVLGVVNFSS-----TFISLWSVERFGRRKCLLWGSASMACCF-VVFASMGVTKLYPN 404
            S++LG V FS+     T  S + +E  GRRK  L G+   A  F + FA +        
Sbjct: 322 LSLILGGV-FSTIYALFTIPSFFLIESLGRRKLFLIGATGQAISFTITFACL-------- 372

Query: 405 GMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIW 464
            +D  T  + G  + +F  LFI  F V+   + ++   E    R++    A++   NW+ 
Sbjct: 373 -IDDTTQNAKGAAVGLF--LFISFFGVALLSLPWIYPPEIASMRVRSSTNALSTCTNWLC 429

Query: 465 NFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEE----FNEMYEEG 520
           NFA+   TP       +                      ET G SLEE    F + + +G
Sbjct: 430 NFAVVMFTPIFIQDAGWGCYLFFAVMNYLYIPVIFFFYPETAGRSLEEIDIIFAKSHVDG 489

Query: 521 TLPWKSDTWIP 531
           T PW+    +P
Sbjct: 490 TRPWRVAANLP 500

>KLLA0F26246g 2432209..2433960 similar to sp|P39932 Saccharomyces
           cerevisiae YDR536w STL1 member of the sugar permease
           family, start by similarity
          Length = 583

 Score =  169 bits (427), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 136/498 (27%), Positives = 225/498 (45%), Gaps = 50/498 (10%)

Query: 60  MIAFGGF-IFGWDIGTIGGFVGQTDFKRRF---GELNDEGEYYLSDVRTGLIVVTFNLGC 115
           + A  GF +FG+D G + G +    F   F    E +D+  +  + V  G +   + LGC
Sbjct: 29  ITAVTGFSLFGYDQGLMSGIITGVRFNDEFPGTKETSDDDRH--ATVVQGAVTSCYELGC 86

Query: 116 AFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISS-TNNWI--QYFIGRIVSGLGVGG 172
            FG + +   G+  GRK  +            I  ++  ++W   Q+ IGR+++GLG G 
Sbjct: 87  FFGSLFVMMRGEKIGRKPLIIFGALLTIVGAVISTAAFGDHWGLGQFVIGRVITGLGTGM 146

Query: 173 IAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGF 232
                P   SE++    RG+ ++L   +I  G  + Y  ++G      S+QWR P+ +  
Sbjct: 147 NTSTIPVWQSEMSKPENRGLLVNLEGSVIAVGTMIAYWIDFGLSYVDTSVQWRFPVAMQI 206

Query: 233 AWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAE 292
            +A+++++G++ +P+SPR+L+ +G+ EEA   L K +    +D  ++ E   I   V   
Sbjct: 207 FFAILLMIGIVQLPDSPRWLVAQGRREEAMYVLGKLDDLDPNDDQIVAEVSTIQDAVNRF 266

Query: 293 RAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIF-QAVGMDD--SY 349
           +    +    L   KG+ LQR ++    Q  QQ TGCN   YY T +F + + ++D  S 
Sbjct: 267 KHQKRSMKELLHGGKGQNLQRALVAASTQFFQQFTGCNAAIYYSTVLFKKTIKLEDRLSL 326

Query: 350 VTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVV-FASMGVTKLYPNGMDQ 408
           V   V   +   ST  S + +E  GRRK  + G+    C F++ FA +         +  
Sbjct: 327 VLGGVFATIYALSTIPSFFLIETLGRRKLFMLGAFGQGCSFLITFACL---------VHD 377

Query: 409 PTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAI 468
            T  + G  + +F  LFI  F +S   + ++   E    R++    A +   NW+ NFA+
Sbjct: 378 TTQNAKGAAVGLF--LFIVFFGMSILSLPWIYPPEIASMRVRSMTNAFSTCTNWLCNFAV 435

Query: 469 GFCTP-FITSA----------INFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEE----F 513
              TP FI  A          INF Y  V                 ET G +LEE    F
Sbjct: 436 VMFTPIFIQDAGWGCYLFFACINFLYLPVIFFFYP-----------ETAGRTLEEIDIIF 484

Query: 514 NEMYEEGTLPWKSDTWIP 531
            + Y + T  W+    +P
Sbjct: 485 AKSYTDKTAAWRVAANLP 502

>KLLA0A11110g 964084..965739 gi|1346290|sp|P49374|HGT1_KLULA
           Kluyveromyces lactis High-affinity glucose transporter,
           start by similarity
          Length = 551

 Score =  168 bits (425), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 131/500 (26%), Positives = 222/500 (44%), Gaps = 25/500 (5%)

Query: 46  KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTG 105
           K     + +  +  +    G +FG+DI ++   +G   +K  F   N +   Y      G
Sbjct: 20  KKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFS--NPDSLTY------G 71

Query: 106 LIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIV 165
            I  +   G   G +I     D +GRK+ L            +Q ++ +      +GR++
Sbjct: 72  GITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVI 130

Query: 166 SGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWR 225
           SG+G+G  +  +P   SEI+P  +RG    L+Q  +T GI V +   YG      +  +R
Sbjct: 131 SGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFR 190

Query: 226 MPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAK-SNKTTVDDPIVLREFDV 284
           +  GL     LI+++G+  +PESPR+L    ++EE    +A       V++  V  + + 
Sbjct: 191 ITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEE 250

Query: 285 INAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVG 344
           I   V  + A  N  + +LF  + K L + I+G+  Q  QQL G N   YY   IF   G
Sbjct: 251 IKEQVIIDSAAKNFGYKDLF--RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAG 308

Query: 345 M--DDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLY 402
              + + V S +  V+N   T  +L+ +++FGRR  L+ G   M       A +  T   
Sbjct: 309 YTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSV 368

Query: 403 P-----NGMDQPT------SKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQ 451
           P     NG D  T      + SA N +I  + LF+  FA +W    ++  +E +    + 
Sbjct: 369 PAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERA 428

Query: 452 RAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLE 511
           +  A++ A NW +NFA+    P     I++    +                 ETKG +LE
Sbjct: 429 KGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLE 488

Query: 512 EFNEMYEEGTLPWKSDTWIP 531
           E ++M+ +    W++  +IP
Sbjct: 489 EIDQMWVDNIPAWRTANYIP 508

>ADR139C [1880] [Homologous to ScYDR536W (STL1) - NSH]
           (950171..951847) [1677 bp, 558 aa]
          Length = 558

 Score =  161 bits (408), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 139/525 (26%), Positives = 239/525 (45%), Gaps = 61/525 (11%)

Query: 60  MIAFGGF-IFGWDIGTIGGFVGQTDFKRRFGELNDEGEY-YLSDVRTGLIVVTFNLGCAF 117
           + A  GF +FG+D G + G +    F   F    ++G+    + V  G +   + LGC F
Sbjct: 25  ITAVTGFSLFGYDQGLLSGLINGEQFNHEFPATLEQGDNDRHATVVQGAVTSCYELGCFF 84

Query: 118 GGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISS-TNNWI--QYFIGRIVSGLGVGGIA 174
           G + +   G+  GRK  +            + +++   +W   Q+ IGR+V+GLG G   
Sbjct: 85  GSLYVMVDGERRGRKPLIIMGSLLTILGTVVSVAAFREHWGLGQFVIGRVVTGLGTGLNT 144

Query: 175 VLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAW 234
              P   SE++    RG+ ++L   +I  G  + Y  ++G     +S+QWR P+ +   +
Sbjct: 145 STIPVWQSEMSKPKNRGLLVNLEGSVIAVGTMIAYWIDFGLSYVDSSVQWRFPVAMQIVF 204

Query: 235 ALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREF----DVINAGVE 290
           A+++++G++ +PESPR+L+  G+  E+K  L K +     D  VL E     D +N    
Sbjct: 205 AVLLLVGIVQLPESPRWLMAHGRTAESKYVLGKLDNLDPSDDSVLAEAAAIEDAVNRFKH 264

Query: 291 AERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYV 350
            +R++ +A    L   +G+ LQR ++    Q  QQ TGCN   YY T +F    ++  Y 
Sbjct: 265 EKRSLKDA----LTGGRGQNLQRTLVACSTQFFQQFTGCNAAIYYSTVLFHKT-INLEYR 319

Query: 351 TSIVLGVVNFSSTFI-----SLWSVERFGRRKCLLWGSASMACCF-VVFASMGVTKLYPN 404
            S++LG V FS+ +      S + +E  GRRK  L G+      F + FA +        
Sbjct: 320 LSLILGGV-FSTVYTLATIPSFFLIETVGRRKLFLIGALGQGFSFTITFACL-------- 370

Query: 405 GMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIW 464
            ++   + + G  + +F  LFI  F ++   + ++   E    +++    A++   NW+ 
Sbjct: 371 -INDTKNNAKGAAVGLF--LFIIFFGMTILSLPWIYPPEISSMKVRSITNAMSTCTNWLC 427

Query: 465 NFAIGFCTP-FITSA----------INFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEF 513
           NFA+   TP FI  A          +NF Y                    ET G SLEE 
Sbjct: 428 NFAVVMFTPIFIHEAGWGCYLFFAVMNFLY-----------VPIIFFFYPETAGRSLEEI 476

Query: 514 NEMYE----EGTLPWKSDTWIP--SSRRGADYDVH-ATQNDDQTF 551
           + +Y     +GT  W+    +P  S +   +Y +     N++  F
Sbjct: 477 DIIYAKSFVDGTQAWRVAANLPKLSLKEVEEYGIQLGLYNNEHDF 521

>YDR536W (STL1) [1346] chr4 (1507992..1509701) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1710 bp, 569 aa]
          Length = 569

 Score =  160 bits (406), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 129/479 (26%), Positives = 212/479 (44%), Gaps = 27/479 (5%)

Query: 67  IFGWDIGTIGGFVGQTDFKRRFGELNDEGEY-YLSDVRTGLIVVTFNLGCAFGGIILGRL 125
           +FG+D G +   +    F   F    + G++   + V  G     + LGC  G + +   
Sbjct: 41  LFGYDQGLMASLITGKQFNYEFPATKENGDHDRHATVVQGATTSCYELGCFAGSLFVMFC 100

Query: 126 GDFYGRKIGLXXXXXXXXXXXXIQISSTNNWI---QYFIGRIVSGLGVGGIAVLSPTLIS 182
           G+  GRK  +            I   +   +    Q+ IGR+V+G+G G      P   S
Sbjct: 101 GERIGRKPLILMGSVITIIGAVISTCAFRGYWALGQFIIGRVVTGVGTGLNTSTIPVWQS 160

Query: 183 EIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTN-SIQWRMPLGLGFAWALIMVLG 241
           E++    RG+ ++L    I  G  + Y  ++G  SYTN S+QWR P+ +   +AL ++  
Sbjct: 161 EMSKAENRGLLVNLEGSTIAFGTMIAYWIDFG-LSYTNSSVQWRFPVSMQIVFALFLLAF 219

Query: 242 MMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWA 301
           M+ +PESPR+LI + + EEA+  +   +    +D  V+ E  +++  V   +     S +
Sbjct: 220 MIKLPESPRWLISQSRTEEARYLVGTLDDADPNDEEVITEVAMLHDAVNRTKH-EKHSLS 278

Query: 302 ELFST-KGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGV--- 357
            LFS  + + LQR ++    Q  QQ TGCN   YY T +F      D  ++ I+ GV   
Sbjct: 279 SLFSRGRSQNLQRALIAASTQFFQQFTGCNAAIYYSTVLFNKTIKLDYRLSMIIGGVFAT 338

Query: 358 VNFSSTFISLWSVERFGRRKCLLWGSASMACCF-VVFASMGVTKLYPNGMDQPTSKSAGN 416
           +   ST  S + +E+ GRRK  L G+   A  F + FA +         + +    + G 
Sbjct: 339 IYALSTIGSFFLIEKLGRRKLFLLGATGQAVSFTITFACL---------VKENKENARGA 389

Query: 417 VMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFIT 476
            + +F  LFI  F +S   + ++   E    +++    A +   NW+ NFA+   TP   
Sbjct: 390 AVGLF--LFITFFGLSLLSLPWIYPPEIASMKVRASTNAFSTCTNWLCNFAVVMFTPIFI 447

Query: 477 SAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEE----FNEMYEEGTLPWKSDTWIP 531
               +                      ET G SLEE    F + YE+GT PW+    +P
Sbjct: 448 GQSGWGCYLFFAVMNYLYIPVIFFFYPETAGRSLEEIDIIFAKAYEDGTQPWRVANHLP 506

>Kwal_56.22724
          Length = 578

 Score =  159 bits (403), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 130/460 (28%), Positives = 210/460 (45%), Gaps = 46/460 (10%)

Query: 22  DPKQIKSV---EDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGF 78
           D  QI+ V   +D S+ +  N+       +S +  +I L  + +  GF+FG+D G I   
Sbjct: 43  DRIQIRPVNDEDDTSVMITFNQK------VSPF--IIILTFVASISGFLFGYDTGYISSA 94

Query: 79  VGQ--TDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLX 136
           +    TD   R     D+           +I    +LG     +  G   D +GRK  L 
Sbjct: 95  LISIGTDLDNRVLTYGDKE----------IITAATSLGALISAVAAGTCADIWGRKPCLM 144

Query: 137 XXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISL 196
                      +Q+S++  W Q  +GR++ G GVG  +++SP  I EIAPK +RG  + +
Sbjct: 145 ISNLFFVIGAVLQVSASTFW-QMAVGRLIMGFGVGIGSLISPLFIGEIAPKMIRGRLVVI 203

Query: 197 YQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKG 256
             L +TGG  + Y    G     N   WR+ +GL         +    +P++PRY + KG
Sbjct: 204 NSLCLTGGQLIAYGCGAGLDHVHNG--WRILVGLSLIPTFTQFVCFCFLPDTPRYYVMKG 261

Query: 257 KFEEAKRSLAKSNKTTVDDPI--VLREFDVINAGVEAERAIGNASWAEL--FSTKGKVLQ 312
           K ++A   LAKS      D I   ++E   +N  +  +   G   W  +    T     +
Sbjct: 262 KLDKAAEVLAKSYVDAPADLIHQKIQELHALNRTIPGDSVPGKV-WNTIKEIHTVPANFR 320

Query: 313 RVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVER 372
            +I+G  +Q +QQ  G N   Y+  TIF+ VG  +S   SIV+   NF  T ++ ++++R
Sbjct: 321 ALILGCALQGIQQFCGWNSLMYFSGTIFETVGFKNSAAVSIVVAGTNFIFTLVAFFAIDR 380

Query: 373 FGRRKCLLWG----SASMACCFVVFASMGVTKLYPNG---MDQPTSKSAGNVMIVFACLF 425
            GRR  LL G      S+  C V F  +GVT  +  G   + + T  SA  ++++ +   
Sbjct: 381 IGRRSILLIGLPGMCVSLIVCAVAFHYLGVT--FEGGGKAIIEHTGFSAWGIVVILS--- 435

Query: 426 IFCFAVSWAPIAFVVV---AESYPQRIKQRAMAIAVAANW 462
           I CFA  +A     V    +E +PQ ++    + + A NW
Sbjct: 436 IICFAAFYALGIGTVPWQQSELFPQAVRGIGTSYSTATNW 475

>Kwal_33.14911
          Length = 570

 Score =  157 bits (397), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 134/496 (27%), Positives = 221/496 (44%), Gaps = 40/496 (8%)

Query: 55  ICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRT----GLIVVT 110
           + + L    G  +FG+D G + G +   +F   F           SD RT    G +   
Sbjct: 22  LAITLTSVIGFSLFGYDQGLMSGLITGEEFNSEFPATGG------SDRRTKLVQGAVTAC 75

Query: 111 FNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTN-NWI--QYFIGRIVSG 167
           + +GC FG + +   G+  GRK  +            I  ++   +W   Q+ +GR+++G
Sbjct: 76  YEIGCFFGSLFVMFRGEQSGRKPLVIVGALLTIIGTVISTAAFGPHWGLGQFVVGRVMTG 135

Query: 168 LGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMP 227
           +G G      P   SE++    RG+ ++L   MI  G  + Y  ++G     +S+QWR P
Sbjct: 136 VGTGLNTSTIPVWQSEMSKPENRGILVNLEGSMIAVGTMIAYWIDFGLSYVGSSVQWRFP 195

Query: 228 LGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVINA 287
           + +   +AL ++ G+  +P+SPR+L+ +G+ ++A   LAK +   +DD  ++ E   I  
Sbjct: 196 VAMQIFFALFLLAGIWELPDSPRWLMSRGRRDDALYVLAKLDDLPIDDDAIVAEATAIQD 255

Query: 288 GVEAERAIGNASWAELFS-TKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIF-QAVGM 345
            V   R     S  +LF+  K + LQR ++    Q  QQ TGCN   YY T +F +++G+
Sbjct: 256 AVNRFRH-EKRSVKDLFTGGKTQNLQRALIASSTQFFQQFTGCNAAIYYSTVLFKESIGL 314

Query: 346 DDSYVTSIVLGVVNFSS-----TFISLWSVERFGRRKCLLWGSASMACCF-VVFASMGVT 399
                  ++LG V F++     T  S + VE  GRRK  L G+   A  F + FA +  T
Sbjct: 315 TGKL--PLILGGV-FATIYTMFTIPSFFLVETLGRRKLFLLGATGQAISFTITFACL--T 369

Query: 400 KLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVA 459
           K      D   +K A   + +F C     F +S   + ++   E    R++    A++  
Sbjct: 370 K-----DDAEVAKGAAVGLFLFICF----FGMSLLSLPWIYPPEIASMRVRSATNALSTC 420

Query: 460 ANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEE----FNE 515
            NW+ NFA+   TP       +                      ET G SLEE    F +
Sbjct: 421 TNWLCNFAVVMFTPIFIDDTGYGCYLFFAVMNYIYIPVIFFFYPETAGRSLEEIDIIFAK 480

Query: 516 MYEEGTLPWKSDTWIP 531
            Y +G  PW+    +P
Sbjct: 481 SYVDGIQPWRVAANLP 496

>Scas_637.9
          Length = 607

 Score =  154 bits (390), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 129/463 (27%), Positives = 215/463 (46%), Gaps = 46/463 (9%)

Query: 24  KQIKSVEDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQ-- 81
           K +   +D S+ +  N+       ISA+  +I L  + +  GF+FG+D G I   +    
Sbjct: 88  KPVNDEDDTSVIITFNQG------ISAF--IITLTFVASISGFMFGYDTGYISSALVSIG 139

Query: 82  TDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXX 141
           TD   +     D+           +I    +LG      + G   D +GR+  L      
Sbjct: 140 TDLDNKVLSYGDKE----------IITAATSLGALITSTMAGTAADIFGRRPCLMFSNVM 189

Query: 142 XXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMI 201
                 +QI++   W Q  +GR++ G GVG  +++SP  ISEIAPK +RG    +  L +
Sbjct: 190 FVIGAILQITAHKFW-QMAVGRLIMGFGVGIGSLISPLFISEIAPKMIRGRLTVINSLWL 248

Query: 202 TGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEA 261
           TGG  + Y    G     N   WR+ +GL     ++     + +P++PRY + KG++++A
Sbjct: 249 TGGQLIAYGCGAGLNHVNNG--WRILVGLSLIPTVLQFSFFLFLPDTPRYYVMKGRYDDA 306

Query: 262 KRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRV------- 314
           K  L +S K   DD I+ R+ + +    E   +I   +  + F    K L RV       
Sbjct: 307 KSVLHRSYKGASDD-IIERKVEELR---ELNHSIEGKNIPQRFWNTVKELHRVPSNFRAL 362

Query: 315 IMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFG 374
           I+   +Q++QQ TG N   Y+  TIF+ VG  +S   SI++   NF  T ++ +++++ G
Sbjct: 363 IIACGLQAIQQFTGWNSLMYFSGTIFETVGFSNSSAVSIIVSGTNFIFTLVAFFAIDKIG 422

Query: 375 RRKCLLWG----SASMACCFVVFASMGVTKLYPNGMDQPTSKSA----GNVMIVFACLFI 426
           RR  LL G    + S+  C + F  +G+      G D   S S     G V+IVF  +F 
Sbjct: 423 RRYILLIGLPGMTGSLTVCAIAFHFIGIRF---EGNDAVVSHSGFTAWGIVIIVFIIVFA 479

Query: 427 FCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIG 469
             +A+    + +   +E +PQ ++    + A A NW  +  I 
Sbjct: 480 AFYALGIGTVPW-QQSELFPQNVRGVGTSYATATNWAGSLVIA 521

>KLLA0E00264g 15302..16837 weakly similar to sp|P54854 Saccharomyces
           cerevisiae YDL245c HXT15, start by similarity
          Length = 511

 Score =  153 bits (386), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 126/454 (27%), Positives = 212/454 (46%), Gaps = 29/454 (6%)

Query: 69  GWDIGTIGGFVGQTDFKRRFGELNDE-GEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGD 127
           G+D            F  +FG+ + + G Y +  V    +     +G AFG +    +  
Sbjct: 57  GFDNQGFATIQAMDSFIEKFGQYDAQTGAYAIPPVFLSFLNSFQYIGFAFGLVCGSIVSS 116

Query: 128 FYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPK 187
            +GRKI +            I I+S N+  Q    R+++ + +G    + P   +EI P 
Sbjct: 117 RFGRKICVLSMSLYALITATIGITS-NSKEQILSARVLNYVFIGMEMAVIPVFQAEIVPP 175

Query: 188 HLRGMCISLYQLMIT-GGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVP 246
           + RG  +  +QL +  GG+ +   TN  +     +  WR+PLGL + +  ++   +M +P
Sbjct: 176 NTRGFFVGAFQLSLNIGGLVIHIITN-STAHIDGTSSWRIPLGLYYIFPSVIASLVMFIP 234

Query: 247 ESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFST 306
           ESPR+LI KGK EEA RSL +    T+ +  ++ E++ I + VEAE+    + + ELF+ 
Sbjct: 235 ESPRWLILKGKKEEAMRSLVRLRNGTIYESEIINEYESIISSVEAEKQ-EKSKYTELFTG 293

Query: 307 KGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFIS 366
             K  +R ++ I+    QQ+TG  +   YGT   +++   D +  SIV  VV   +  I 
Sbjct: 294 TNK--RRTLIVILANIFQQVTGQAFASQYGTIFIKSLNTVDPFQMSIVSSVVAIVAVIIV 351

Query: 367 LWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFI 426
           L   + FGR+K L+ GS   A   +V   +G         D  T+K  G V  +    F 
Sbjct: 352 LLFTDEFGRKKFLVIGSVIQAIALLVMGGLGTG-------DVTTAKKNGIVATMMINSFA 404

Query: 427 FCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPF--------ITSA 478
           +C  +SWAP+++V+ +E    R++ +  A+ +  N ++ F   F  P+        + S 
Sbjct: 405 YC--ISWAPLSYVISSEIPTPRLRDKTYAVGILFNILFAFITAFTLPYLLSKPYANLQSK 462

Query: 479 INFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEE 512
           + F YG                 + E +GLSLEE
Sbjct: 463 VGFIYG-----AFTVLSVVFSYYLPECRGLSLEE 491

>Sklu_2427.8 , Contig c2427 19304-21040
          Length = 578

 Score =  153 bits (386), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 130/520 (25%), Positives = 237/520 (45%), Gaps = 22/520 (4%)

Query: 40  ENEGAPKPISAYFTVICLCLMIA-FGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYY 98
           + E  P P   Y   I    MIA     + G+D G +GG      F R FG   D     
Sbjct: 34  KTEDRPTPPEVYNWRIYATAMIASTASILIGYDTGFVGGCFSNEYFLRNFGYEKDTPT-- 91

Query: 99  LSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISS-TNNWI 157
            +D  + +I   F+    FG +I   +  ++GR++ L            + +++ T++  
Sbjct: 92  ANDALSNMISC-FHAAAFFGALISYPMSHYWGRRVSLIIAAGVAAIGAALMMAAVTSHLA 150

Query: 158 QYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKS 217
             +IGR+++GL VG    L+   +SE++P  +RG  I+ Y++    G  +G+  N+G   
Sbjct: 151 PLYIGRVLTGLTVGASTNLTVVYLSEVSPAPIRGQIIAFYEVGWRIGDLIGFWINFGVSE 210

Query: 218 YTN--SIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDD 275
           + +  + QW +PLG+    A +  +G  ++ ESPR+L +  +  EA  +L    +   D 
Sbjct: 211 HISPGNKQWIIPLGVQLIPAGMFFVGSFIMKESPRWLFQMDRDHEAIENLHYLRQLPEDH 270

Query: 276 PIVLREFDVINAGVEAERA-IGNASW---AELFSTKGKVLQRVIMGIMVQSLQQLTGCNY 331
             ++ E + I   +E + + +G   +    E+F    K  +R+++  ++   Q   G   
Sbjct: 271 EYMVWEINSIKNSIEEQNSTVGLGMFDPVKEVFVRNRKYSRRLVITALLFLFQNFMGIQS 330

Query: 332 FFYYGTTIFQAVGMDDSYVT---SIVLGVVNFSSTFIS-LWSVERFGRRKCLLWGSASMA 387
             YY   IF+++G+  +  T   S + GVV F  TFI  L+ V+ FGRR+  +W ++  +
Sbjct: 331 INYYSPRIFKSIGVQGTNATLFSSGMFGVVKFICTFIYILFIVDNFGRRRAFMWSASVCS 390

Query: 388 CCF-VVFASMGVTKLYPNGMDQ-PTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESY 445
            CF  V A + +      G+   P  K+A   M ++   FI    ++W+   FV  AE Y
Sbjct: 391 VCFWYVGAYLKINDPSKPGVSAGPGGKAAIGFMFIWTASFI----LAWSGGPFVWGAEVY 446

Query: 446 PQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCET 505
            Q I+    +I  A +W+  F +   T  +   + +   F                V ET
Sbjct: 447 EQNIRSFVQSINAAISWVPIFIMTRMTNDMVDKMQYGIFFFFASLAALAVPFVFFFVPET 506

Query: 506 KGLSLEEFNEMYEEGTLPWKS-DTWIPSSRRGADYDVHAT 544
           KG++LE+ ++++++      +    +  SRR  + + H  
Sbjct: 507 KGIALEDIDKLFDKKLSAHNAYKVVMEESRRTVEENKHGN 546

>Sklu_2313.3 YDR497C, Contig c2313 3640-5376 reverse complement
          Length = 578

 Score =  148 bits (374), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 115/380 (30%), Positives = 173/380 (45%), Gaps = 34/380 (8%)

Query: 24  KQIKSVEDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQ-- 81
           K +   +D S+ +  N+       +S +  +I L  + +  GF+FG+D G I   +    
Sbjct: 46  KPVNDEDDTSVMITFNQK------VSPF--IIILTFVASISGFMFGYDTGYISSALVSIG 97

Query: 82  TDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXX 141
           TD   +           L+     +I    +LG     +  G   D +GRK  +      
Sbjct: 98  TDLDNK----------TLTYGEKEIITAATSLGALITAVFAGVSADLFGRKPCIMFSNLL 147

Query: 142 XXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMI 201
                 +Q+S+   W Q  IGR+V G GVG  +++SP  ISEIAPK +RG    +  L +
Sbjct: 148 FVIGAILQVSAHTFW-QMAIGRLVMGFGVGIGSLISPLFISEIAPKMIRGRLTVVNSLCL 206

Query: 202 TGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEA 261
           TGG  + Y    G     N   WR+ +GL     +I     M +P++PRY + KG  E+A
Sbjct: 207 TGGQLIAYACGAGLDKVHNG--WRILVGLSLIPTVIQFTMFMFLPDTPRYYVMKGNLEKA 264

Query: 262 KRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRV------- 314
            + L KS    VD P  L E  V N  VE    I  A+  E      K +  V       
Sbjct: 265 AQVLGKS---YVDAPGDLIERKV-NELVELNTTIPGANIFEKVRNTVKEIHVVPANFRAL 320

Query: 315 IMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFG 374
           I+G  +Q +QQ  G N   Y+  TIFQ VG ++S   SI++   NF  T ++ +++++ G
Sbjct: 321 IIGCALQGIQQFCGWNSLMYFSGTIFQTVGFENSTAVSIIVAGTNFIFTLVAFFAIDKIG 380

Query: 375 RRKCLLWGSASMACCFVVFA 394
           RR  LL G   M    +V A
Sbjct: 381 RRAILLIGLPGMMVSLIVCA 400

>KLLA0C12309g 1046848..1048557 highly similar to sp|P30606
           Saccharomyces cerevisiae YOL103w ITR2 myo-inositol
           permease, minor, start by similarity
          Length = 569

 Score =  146 bits (369), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 134/550 (24%), Positives = 237/550 (43%), Gaps = 48/550 (8%)

Query: 24  KQIKSVEDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQ-- 81
           K +   +D S+ +  N+       IS +  ++ L    +  GF+FG+D G I   +    
Sbjct: 39  KPVNDEDDTSVMITFNQK------ISPF--ILILTFTASISGFMFGYDTGYISSALVSIG 90

Query: 82  TDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXX 141
           TD   +     D+           +I    +LG     +  G   D +GRK  L      
Sbjct: 91  TDLDNKALTYGDKE----------IITAATSLGALISAVFAGISADIFGRKPCLMFSNIL 140

Query: 142 XXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMI 201
                 +Q+S+ + W Q  +GR++ G GVG  ++L+P  ISEIAPKH+RG    +  L +
Sbjct: 141 FVIGAALQVSAHSFW-QMAVGRLIMGFGVGIGSLLAPLFISEIAPKHIRGRLTVINSLWL 199

Query: 202 TGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEA 261
           TGG  + Y    G     N   WR+ +GL     ++       +P++PR+ + KG +++A
Sbjct: 200 TGGQLIAYACGAGLNKVHNG--WRILVGLSLIPTVVQFTCFSFLPDTPRFYVIKGNYKKA 257

Query: 262 KRSLAKS----NKTTVDDPIVLREFDVINAGVEAERAIGN--ASWAELFSTKGKVLQRVI 315
              L KS     +  +D  I  RE   +N  +  +  +     +  EL +      + ++
Sbjct: 258 AEVLQKSYINAPQELIDQKI--RELSDLNEAIPGKTPVHKFFNTVKELHTVPCN-FRALV 314

Query: 316 MGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGR 375
           +G  +Q +QQ  G N   Y+  TIFQ VG ++S   SI++   NF  T ++ +++++ GR
Sbjct: 315 IGCALQGIQQFCGWNSLMYFSGTIFQTVGFENSTAVSIIVAGTNFVFTLVAFFAIDKVGR 374

Query: 376 RKCLLWG----SASMACCFVVFASMGVTKLYPNGMDQPTS---KSAGNVMIVFACLFIFC 428
           R  LL G      S+  C + F  + + K    G  + ++    S G V+IVF  ++   
Sbjct: 375 RAILLIGLPGMMVSLVMCAIAFHFLDI-KFTGAGESEVSNGGFSSWGIVVIVFIMVYAAF 433

Query: 429 FAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFY-YGFVX 487
           +A+    + +   +E +   ++    +   A NW  +  I   + F+T   N    G   
Sbjct: 434 YALGIGTVPW-QQSELFATSVRGVGTSYCTATNWAGSLIIA--STFLTMLQNITPTGTFS 490

Query: 488 XXXXXXXXXXXXXXVC--ETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHAT- 544
                         +C  E  GL LEE   +  +G    K+   +   R+  + ++    
Sbjct: 491 LFAALAAVSTVFCYLCYPELSGLELEEVQTILSDG-FNIKASKQLAKKRKQQNSEMQRRF 549

Query: 545 QNDDQTFFQK 554
           +  D   +QK
Sbjct: 550 REKDMEAYQK 559

>Scas_581.6
          Length = 587

 Score =  145 bits (365), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 145/549 (26%), Positives = 241/549 (43%), Gaps = 47/549 (8%)

Query: 22  DPKQIKSV---EDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGF 78
           D  QIK V   +DVS+ +  N+       IS +  ++ L  + +  GF+FG+D G I   
Sbjct: 61  DRIQIKPVNDEDDVSVIITFNQG------ISPF--ILILTFVASISGFMFGYDTGYISSA 112

Query: 79  VGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXX 138
           +      +  G     G+         +I    +LG     I  G   D +GRK  L   
Sbjct: 113 L--ISINKDLGRTLTYGD-------KEIITAATSLGALISSIFAGTAADIFGRKPCLMFS 163

Query: 139 XXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQ 198
                    +QI++   W Q   GR++ G GVG  +++SP  ISEIAPK +RG    +  
Sbjct: 164 NVLFVIGAILQITAHRFW-QMNAGRLIMGFGVGIGSLISPLFISEIAPKMIRGRLTVINS 222

Query: 199 LMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKF 258
           L +TGG  + Y    G     N   WR+ +GL     ++     + +P++PRY + KG +
Sbjct: 223 LWLTGGQLIAYGCGAGLNHVHNG--WRILVGLSLIPTVLQFSFFLFLPDTPRYYVMKGDY 280

Query: 259 EEAKRSLAKSNKTTVDDPI--VLREFDVINAGVEAE-RAIGNASWAELFSTKGKVLQRVI 315
           E AK  L +S     +D I   + E   +N  +  + +A+   +  +   T     + +I
Sbjct: 281 ENAKAVLRRSYINAPEDIIDRKVEELTELNHSIPGKNKAVQVWNTVKELHTNPANFRALI 340

Query: 316 MGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGR 375
           +   +Q++QQ TG N   Y+  TIF+ VG  +S   SI++   NF  T ++ +++++ GR
Sbjct: 341 IACGLQAIQQFTGWNSLMYFSGTIFETVGFSNSSAVSIIVSGTNFVFTLVAFFAIDKIGR 400

Query: 376 RKCLLWG----SASMACCFVVFASMGVTKLYPNGMDQPTSKSA----GNVMIVFACLFIF 427
           R  LL G    + ++  C + F  +G+  +   G D   S S     G V+IVF  +F  
Sbjct: 401 RAILLIGLPGMTMALTICAIAFHFIGIQFV---GNDAVVSNSGFTAWGIVIIVFIIVFAA 457

Query: 428 CFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFY-YGFV 486
            +A+    + +   +E +P  ++    + A A NW  +  I   + F+T   N    G  
Sbjct: 458 FYALGIGTVPW-QQSELFPTNVRGVGTSYATATNWAGSLVI--ASTFLTMLQNITPTGTF 514

Query: 487 XXXXXXXXXXXXXXXVC--ETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHAT 544
                           C  E  GL LEE   + ++G    K+   +   R+     V   
Sbjct: 515 AFFAGLSFVSFIFCYFCYPELSGLELEEVQSILKDG-FNIKASKELAKKRK---QQVARI 570

Query: 545 QNDDQTFFQ 553
            +DDQ  F+
Sbjct: 571 IDDDQLKFE 579

>AFR343C [3535] [Homologous to ScYOL103W (ITR2) - SH; ScYDR497C
           (ITR1) - SH] (1060729..1062444) [1716 bp, 571 aa]
          Length = 571

 Score =  144 bits (363), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 124/489 (25%), Positives = 212/489 (43%), Gaps = 49/489 (10%)

Query: 54  VICLCLMIAFGGFIFGWDIGTIGGFVGQ--TDFKRRFGELNDEGEYYLSDVRTGLIVVTF 111
           ++ L  + +  GF+FG+D G I   +    TD   +      + EY  S    G ++   
Sbjct: 66  IVMLTFVASLSGFLFGYDTGYISSALQSVGTDLGHQL--TYRDKEYITSATSLGALIAAL 123

Query: 112 NLG-CAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGV 170
             G CA          D +GR+  +            +Q+++ N W Q  +GR+V G G+
Sbjct: 124 GAGICA----------DLFGRRKCIMFSNILFVVGTVLQVAAFNFW-QMVVGRLVMGFGI 172

Query: 171 GGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGL 230
           G  +++SP  ISEIAPK +RG    +  L +TGG  + Y    G +   +   WR+ +G+
Sbjct: 173 GFGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYACGAGFQHVKHG--WRILVGI 230

Query: 231 GFAWALIMVLGMMMVPESPRYLIEKGKFEEA----KRSLAKSNKTTVDDPIVLREFDVIN 286
               A++  +  + +P++PR+ + KG+ E+A    +R+   + +  +D  I   E  ++N
Sbjct: 231 SMLPAVLQFVSFIFLPDTPRFYVMKGRLEDAANVLERTYVGAERALIDRKI--EELVLLN 288

Query: 287 AGVEAERAIGNASWAELFS--TKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVG 344
             +   R + +  W  + +  T    L+ +I+   +Q +QQ  G N   Y+   IF  VG
Sbjct: 289 KTIPG-RTVFHRVWNTIVAIHTVPANLRALIIACGLQGIQQFCGWNSLMYFSGDIFSLVG 347

Query: 345 MDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWG----SASMACCFVVFASMGV-- 398
             D    SIV+   NF  T ++ +++++ GRR  LL G    + +M  C + F  +    
Sbjct: 348 FKDPVAVSIVVAATNFIFTLVAFFAIDKIGRRIILLIGLPGMTTAMTVCAIAFHYIKTEV 407

Query: 399 --TKLYPNGMDQPTSKSAGNVMIVFACLFIFCFA-VSWAPIAFVVVAESYPQRIKQRAMA 455
              KL P G            +IV+A  +      V W        +E +PQ ++    +
Sbjct: 408 DGEKLKPVGESNAWGIVVVIFIIVYAAFYALGIGTVPWQQ------SELFPQPVRGVGTS 461

Query: 456 IAVAANWIWNFAIG--FCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVC--ETKGLSLE 511
            A A NW  +  I   F T F        +GF                +C  E  GL LE
Sbjct: 462 FATATNWAGSMVIASTFLTMFKNITPTATFGFF---AGISVISLVAVYLCYPELSGLELE 518

Query: 512 EFNEMYEEG 520
           E   + ++G
Sbjct: 519 EVQFVLKDG 527

>YOL103W (ITR2) [4718] chr15 (124000..125829) Myo-inositol permease
           (minor), closely related to Itr1p, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1830 bp, 609 aa]
          Length = 609

 Score =  143 bits (361), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 123/457 (26%), Positives = 207/457 (45%), Gaps = 34/457 (7%)

Query: 24  KQIKSVEDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTD 83
           K +   +D S+ +  N++      IS +  +I L  + +  GF+FG+D G I   +   +
Sbjct: 87  KPVNDEDDTSVIITFNQS------ISPF--IITLTFVASISGFMFGYDTGYISSALISIN 138

Query: 84  FKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXX 143
                    D     L+     LI    +LG     +  G   D +GR+  L        
Sbjct: 139 --------RDLDNKVLTYGEKELITAATSLGALITSVGAGTAADVFGRRPCLMFSNLMFL 190

Query: 144 XXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITG 203
               +QI++   W Q   GR++ G GVG  +++SP  ISEIAPK +RG    +  L +TG
Sbjct: 191 IGAILQITAHKFW-QMAAGRLIMGFGVGIGSLISPLFISEIAPKMIRGRLTVINSLWLTG 249

Query: 204 GIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKR 263
           G  + Y    G     N   WR+ +GL     ++       +P++PRY + KG  + AK 
Sbjct: 250 GQLIAYGCGAGLNHVKNG--WRILVGLSLIPTVLQFSFFCFLPDTPRYYVMKGDLKRAKM 307

Query: 264 SLAKSNKTTVDDPI--VLREFDVINAGVEAERAIGNA-SWAELFSTKGKVLQRVIMGIMV 320
            L +S   T D+ I   + E   +N  +  +  I    +  +   T     + +I+G  +
Sbjct: 308 VLKRSYVNTEDEIIDQKVEELSSLNQSIPGKNPITKFWNMVKELHTVPSNFRALIIGCGL 367

Query: 321 QSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLL 380
           Q++QQ TG N   Y+  TIF+ VG  +S   SI++   NF  T I+ + +++ GRR  LL
Sbjct: 368 QAIQQFTGWNSLMYFSGTIFETVGFKNSSAVSIIVSGTNFVFTLIAFFCIDKIGRRYILL 427

Query: 381 WG----SASMACCFVVFASMGVTKLYPNGMDQPTS----KSAGNVMIVFACLFIFCFAVS 432
            G    + ++  C + F  +G+     NG D   +     S G V+IVF  ++   +A+ 
Sbjct: 428 IGLPGMTVALVICAIAFHFLGIKF---NGADAVVASDGFSSWGIVIIVFIIVYAAFYALG 484

Query: 433 WAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIG 469
              + +   +E +PQ ++    + A A NW  +  I 
Sbjct: 485 IGTVPW-QQSELFPQNVRGVGTSYATATNWAGSLVIA 520

>YDR497C (ITR1) [1312] chr4 complement(1443701..1445455)
           Myo-inositol permease (major), closely related to Itr2p,
           member of the hexose transporter family of the major
           facilitator superfamily (MFS) [1755 bp, 584 aa]
          Length = 584

 Score =  142 bits (357), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 108/380 (28%), Positives = 174/380 (45%), Gaps = 31/380 (8%)

Query: 22  DPKQIKSV---EDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGF 78
           D  QIK V   +D S+ +  N++      +S +  +I L  + +  GF+FG+D G I   
Sbjct: 59  DRIQIKPVNDEDDTSVMITFNQS------LSPF--IITLTFVASISGFMFGYDTGYISSA 110

Query: 79  VGQ--TDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLX 136
           +    TD   +           L+     ++    +LG     I  G   D +GRK  L 
Sbjct: 111 LISIGTDLDHKV----------LTYGEKEIVTAATSLGALITSIFAGTAADIFGRKRCLM 160

Query: 137 XXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISL 196
                      +Q+S+   W Q  +GR++ G GVG  ++++P  ISEIAPK +RG    +
Sbjct: 161 GSNLMFVIGAILQVSAHTFW-QMAVGRLIMGFGVGIGSLIAPLFISEIAPKMIRGRLTVI 219

Query: 197 YQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKG 256
             L +TGG  V Y    G     N   WR+ +GL      +    +  +P++PRY + KG
Sbjct: 220 NSLWLTGGQLVAYGCGAGLNYVNNG--WRILVGLSLIPTAVQFTCLCFLPDTPRYYVMKG 277

Query: 257 KFEEAKRSLAKSNKTTVDDPI--VLREFDVINAGVEAERAIGNASWAEL--FSTKGKVLQ 312
               A   L +S   T ++ I   + E   +N  +   + +    W  +    T    L+
Sbjct: 278 DLARATEVLKRSYTDTSEEIIERKVEELVTLNQSIPG-KNVPEKVWNTIKELHTVPSNLR 336

Query: 313 RVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVER 372
            +I+G  +Q++QQ TG N   Y+  TIF+ VG  +S   SI++   NF  T ++ +S+++
Sbjct: 337 ALIIGCGLQAIQQFTGWNSLMYFSGTIFETVGFKNSSAVSIIVSGTNFIFTLVAFFSIDK 396

Query: 373 FGRRKCLLWGSASMACCFVV 392
            GRR  LL G   M    VV
Sbjct: 397 IGRRTILLIGLPGMTMALVV 416

>CAGL0I07447g 716104..717816 highly similar to sp|P30606
           Saccharomyces cerevisiae YOL103w ITR2 myo-inositol
           permease, minor, hypothetical start
          Length = 570

 Score =  142 bits (357), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 123/462 (26%), Positives = 210/462 (45%), Gaps = 44/462 (9%)

Query: 24  KQIKSVEDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQ-- 81
           K +   +DVS+ +  N N+G      ++F +I L  + +  GF+FG+D G I   +    
Sbjct: 51  KPVNDEDDVSVMI--NFNQGV-----SHF-IIMLTFVASLSGFLFGYDTGYISSALISIG 102

Query: 82  TDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXX 141
           TD   +  EL   GE  ++   T L  + F L   F         D +GRK  L      
Sbjct: 103 TDLDNK--ELT-YGEKEITTAATSLGALIFALVAGFSV-------DIFGRKPCLMFSNIM 152

Query: 142 XXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMI 201
                 +Q+++   W Q   GR + G GVG  ++++P  ISEIAPK +RG    +  L +
Sbjct: 153 FLIGAILQVTAHKFW-QMTAGRFIMGFGVGIGSLIAPLYISEIAPKMIRGRLTVINSLWL 211

Query: 202 TGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEA 261
           TGG  + Y    G     N   WR+ +GL     ++  +  + +P++PRY + KG +E+A
Sbjct: 212 TGGQLIAYGCGAGLNHVHNG--WRILVGLSLIPTVLQFVFFIFLPDTPRYYVMKGDYEKA 269

Query: 262 KRSLAKSNKTTVDDPI--VLREFDVINAGVEAERAIGNASWAEL--FSTKGKVLQRVIMG 317
           K  L +S     D+ I   + E   +N  +  +  +   +W  +    TK    + +I+ 
Sbjct: 270 KSVLKRSYNGVSDELIDRKIEELLALNQSIPGKNHV-ERTWNAVKELHTKPANFRALIIA 328

Query: 318 IMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRK 377
             +Q +QQ TG N   Y+  TIF++VG  +S   SI++   NF  T ++ + +++ GRR 
Sbjct: 329 CGLQGIQQFTGWNSLVYFSGTIFESVGFKNSSAVSIIVSGTNFIFTLVAFFCIDKIGRRN 388

Query: 378 CLLWGSASMACCFVV----FASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCF---- 429
            L+ G   M    V+    F  +G+  +    + + +  S+  ++I+   +    F    
Sbjct: 389 ILIIGIPGMTVAHVMSAIAFHFIGIKFVGNTAIVEHSGFSSWGIVIIVFIIMFAAFYALG 448

Query: 430 --AVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIG 469
              V W        +E +PQ ++    A A A NW  +  I 
Sbjct: 449 IGTVPWQQ------SELFPQNVRGVGTAFATATNWAGSLVIA 484

>Kwal_27.11638
          Length = 723

 Score =  138 bits (347), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 128/477 (26%), Positives = 211/477 (44%), Gaps = 38/477 (7%)

Query: 51  YFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVT 110
           YFT +     ++ G F+FG+D G + G +    FK  F   +D   + +     G +V  
Sbjct: 114 YFTSV----FVSLGVFLFGYDQGVMSGIITGPLFKDYF---HDPSRFAI-----GNMVSI 161

Query: 111 FNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGV 170
             +G     +++GRLG+ +GR+  +             Q S+T       IGR++SGLGV
Sbjct: 162 LEIGALISSLMVGRLGEKWGRRRTIRYGSFVFIIGGLFQTSATK-LSHLIIGRVISGLGV 220

Query: 171 GGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCT----NYGSKSYTNSIQWRM 226
           G ++ + P   SEI+P H RG    L  +  TG I VGYC+    +YG     N+  WR+
Sbjct: 221 GLLSTIVPIYQSEISPPHNRG---KLACIEFTGNI-VGYCSSVWVDYGCSYIPNNAAWRL 276

Query: 227 PLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKT-TVDDPIVLREFDVI 285
           PL +     L ++LG  ++ E+PR+L+      E    +A  +    V D     EF  I
Sbjct: 277 PLFIQCVMGLGLMLGTFVIVETPRWLLNHDHDVEGLIVIADLHSNGDVQDQRAHAEFQAI 336

Query: 286 NAGVEAERAIG-NASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVG 344
              V   R  G   S++ +F    +   R+++ +  Q   QL G N   YY   +F+  G
Sbjct: 337 KETVLISRLEGEKKSYSYVFK---RYRTRMLIAMSSQMFAQLNGINVISYYAPLVFEQAG 393

Query: 345 M--DDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLY 402
               D+ + + +  V+   ST +    V+++GR+  LL G   M    V  ++     LY
Sbjct: 394 WVGRDAILMTGINSVIYVLSTILPWHLVDKWGRKPILLIGGMVMGLSLVSISA----ALY 449

Query: 403 PNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANW 462
            N    PT      +++VF  +F   F  SW PI ++   E  P   +    + + A NW
Sbjct: 450 INIASTPT------LVVVFVVVFNAFFGFSWGPIPWLYPVEIAPLSARSAMASASTATNW 503

Query: 463 IWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEE 519
           + N+ +G  TP +   I +    +                 ET GL LE+   ++++
Sbjct: 504 LCNWLVGIMTPVLQEKIQWRMYLIHAASCFISFWCVLRVYPETAGLRLEDMGSVFDD 560

>KLLA0F06853g 656373..657959 gi|24943210|gb|AAN65374.1 Kluyveromyces
           lactis YGL104C, start by similarity
          Length = 528

 Score =  134 bits (337), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 114/445 (25%), Positives = 200/445 (44%), Gaps = 60/445 (13%)

Query: 99  LSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQ 158
           L+D + GLI   F++G   G ++ G L D YGRK  +            + + S+NN++ 
Sbjct: 89  LTDSQFGLITSVFSVGGLIGSLVAGPLADSYGRK-PISYWNCSVGILGAVCLFSSNNYLG 147

Query: 159 YFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSY 218
              GR+++G+  G + V++P  I+E++P HL+G   S+ Q+ I  GI V   T   +  +
Sbjct: 148 MLFGRLLAGISCGSLIVVTPLFINEMSPVHLKGSLGSMNQVSINCGILV---TQSLAMLW 204

Query: 219 TNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLA-------KSNKT 271
            N +QWR  L  G   +L+    +  + ESPR+L+ KG   +A+  L+       + ++ 
Sbjct: 205 ANMLQWRWILLFGGLISLLNFGLLFRINESPRWLVSKGNMTDAEDVLSQLRGNSRQESRQ 264

Query: 272 TVD------DPIVLREFDVINAGVEAERAIGNASWAELFST------------------- 306
            +D       P+  R F  + A   ++  +G+    E  S+                   
Sbjct: 265 EIDGWLQGSQPV--RTFSDLEAHTNSQMNLGSNLNLERPSSTRSSLRDSESITVVEYWKD 322

Query: 307 -KGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFI 365
            K K  +RVI  I++   QQ  G N   +YG  + +    D + + +  + +VN   TF 
Sbjct: 323 PKYKYPRRVITTILMA--QQFCGINSIVFYGVKVIKKAFPDTAIIINFAISIVNVLMTFF 380

Query: 366 SLWSVERFGRRKCLLWGSASMACC--FVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFAC 423
           S   V+ +GR+  L+  S  M+ C   + F  +G               +A  ++++F  
Sbjct: 381 SSPLVDHWGRKPLLISSSTLMSICSFMICFGIVG---------------NAPMILVIFVI 425

Query: 424 LFIFCFAVSWAPIAFVVVAE-SYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFY 482
           L+I  FA    PI F++++E S+P+ +   A +     NWI  F +G+  P + S ++ Y
Sbjct: 426 LYITAFAGGLGPIPFLIISELSHPETVGV-AQSYGTTMNWIATFMVGYGFPALNSVMDGY 484

Query: 483 YGFVXXXXXXXXXXXXXXXVCETKG 507
              +               V ETKG
Sbjct: 485 VFLLFSAVAICFSFYVYRFVPETKG 509

>Scas_552.0d
          Length = 112

 Score =  117 bits (294), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 56/106 (52%), Positives = 69/106 (65%)

Query: 454 MAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEF 513
           MA+A   NW WNF I F TPFIT AINFYYG+V               V E KGL+LEE 
Sbjct: 7   MALANGCNWFWNFLISFFTPFITGAINFYYGYVFMGCMVFGYFYVFFFVPEMKGLTLEEV 66

Query: 514 NEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIFSKK 559
           NE++E+G LPWKS  W+PSSRRGAD ++   Q DD+  F+K+F +K
Sbjct: 67  NELWEDGVLPWKSPNWVPSSRRGADVNMDEFQKDDKPLFKKMFGRK 112

>KLLA0A03223g 290002..292035 some similarities with sp|P39932
           Saccharomyces cerevisiae YDR536w STL1 member of the
           sugar permease family P33.1.f24.1, hypothetical start
          Length = 677

 Score =  127 bits (319), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 116/480 (24%), Positives = 204/480 (42%), Gaps = 44/480 (9%)

Query: 51  YFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVT 110
           YFT I     ++ G F+FG+D G + G +    FK  F           +    G +V  
Sbjct: 117 YFTSI----FVSLGVFLFGYDQGVMSGIITGPYFKTYFNNP--------TAATIGTMVSI 164

Query: 111 FNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWI--QYFIGRIVSGL 168
             +G     +++  +G+ +GR+  +            +Q   T +W       GRI+SG+
Sbjct: 165 LEIGALVSSLLVSNIGEKFGRRFTIKYGSLIFILGGLVQ---TFSWEMGHMIFGRIISGI 221

Query: 169 GVGGIAVLSPTLISEIAPKHLRG--MCISLYQLMITGGIFVGYCT----NYGSKSYTNSI 222
           GVG ++ + P   SEI+P H RG   CI       TG I VGY +    +Y      +  
Sbjct: 222 GVGLLSTIVPIYQSEISPPHNRGKLACIEF-----TGNI-VGYASSVWVDYACSYIESDT 275

Query: 223 QWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKT-TVDDPIVLRE 281
            WR+PL +     L++ LG  ++ E+PR+L+      E    +A  +    V       E
Sbjct: 276 SWRLPLFIQCVMGLLLFLGSFVIVETPRWLLNHDHDIEGLVVIADLHSDGDVLHSKAHEE 335

Query: 282 FDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQ 341
           + +I   V   R  G    +  F+ K +   R+++ +  Q   QL G N   YY   +F+
Sbjct: 336 YKLIKETVLISRLEGEKK-SLRFAFK-RYRTRMLIAMSSQMFAQLNGINVISYYAPLVFE 393

Query: 342 AVGM--DDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVT 399
             G    ++ + + +  ++   ST +    V+++GR+  LL G+  M    +  A     
Sbjct: 394 QAGWVGREALLMTGINSIIYILSTILPWKLVDKWGRKPILLSGALVMGTSLLAIA----M 449

Query: 400 KLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVA 459
            L+ N    P       +++VF  +F   F  SW PI ++   E  P   +    + + A
Sbjct: 450 SLWANVAATP------RLVVVFVIIFNAFFGYSWGPIPWLYPVEIAPAMARSAMASASTA 503

Query: 460 ANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEE 519
            NW++N+ +G  TP +   I++    +                 ET GL LE+ + ++++
Sbjct: 504 TNWLFNWLVGIMTPILQEKIHWRMYLIHTVSCYLSFWCVLKVYPETAGLRLEDMDSVFDD 563

>Kwal_34.16266
          Length = 158

 Score =  117 bits (293), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 92/157 (58%), Gaps = 2/157 (1%)

Query: 363 TFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFA 422
           T++S++  +  GR+K LLWGS S   C  +F+++GV  +  +    P  K +G VMI+F 
Sbjct: 2   TYVSIFVADNLGRKKGLLWGSISCFICLFIFSTVGVVMV--DHAADPDYKLSGYVMIIFT 59

Query: 423 CLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFY 482
           C F+  F  SW+ IA V+V+E +   IK +AMA++ A NW  NF I  CTP IT+ I + 
Sbjct: 60  CFFVVSFCCSWSAIASVLVSEIFTLEIKSQAMALSQAFNWGANFFIALCTPIITARIGYA 119

Query: 483 YGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEE 519
           +G+V               + ETKGL+LEE +E YE+
Sbjct: 120 FGYVFTGFMFVAIFFVYVFIPETKGLTLEEIDEFYEK 156

>Sklu_2144.6 YFL040W, Contig c2144 7747-9330 reverse complement
          Length = 527

 Score =  122 bits (306), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 115/484 (23%), Positives = 214/484 (44%), Gaps = 37/484 (7%)

Query: 71  DIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYG 130
           DI ++  F+G   F + F         Y + +  GL+      G   G I+ G L +  G
Sbjct: 27  DISSMAIFIGSETFNKYFN--------YPNPLEQGLVAGANPSGALVGCIVYGMLSEKSG 78

Query: 131 RKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLR 190
           R   +            I I   N W+   + R++ G+ VG  + L P  I E+ PK  +
Sbjct: 79  RVSTIKVSSGIWIFGSFISIFVLNIWM-VILSRLIKGVSVGIFSALLPVYIGEVIPKKRK 137

Query: 191 GMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPR 250
           G   S  QL +T  I + +   +      N + +R+  GL    AL++     ++PESPR
Sbjct: 138 GTATSTIQLALTAAILLMFYVCFFMNFIGNHLSFRISWGLEMIPALLLFFLAFLLPESPR 197

Query: 251 YLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVINA-GVEAERAIGNASWAELFSTKGK 309
           +L+  GK+ +A+  L +   T     +   + D+++  G  ++R     ++ +LF  K  
Sbjct: 198 WLVTHGKYTDAQELLERLKSTKFGKGV--SKIDILDKYGSSSQR----CTYLDLF--KKT 249

Query: 310 VLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGM--DDSYVTSIVLGVVNFSSTFISL 367
           + +  I+G+ +Q+L Q  G     YY   I + +G+  D    ++ +  ++N   T   +
Sbjct: 250 LWRHTIIGMTIQALVQCCGIGVLMYYVVYICEMIGLEGDIRLFSASIQYIINVLFTIFPI 309

Query: 368 WSVERFGRRKCLLWGSASMACCFVVFASMGVT------KLYP-NG---MDQPTSKSAGNV 417
             +++F R+  +++GS  +A   V+  S+G T      ++ P NG   M        G+V
Sbjct: 310 IWLDKFRRKDVIVYGSYLLA---VIMFSIGFTMNWYGHEVPPINGNKAMVWEVKGRPGSV 366

Query: 418 MIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITS 477
           ++    LF+  FA + +  A++   E  P + K + M+I +A +W+ NF + F  P++ +
Sbjct: 367 ILGLCFLFVAIFAATLSCGAWLYTNEILPAKTKAKGMSICMAMSWVMNFILTFLAPWLLN 426

Query: 478 AINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGA 537
            I +    +                 ET GL+  E  ++YE    P +++       +G 
Sbjct: 427 RIKWVTFIILGGMTLVITTIVAFSFPETYGLTDLEIEKLYE----PLENNFTEKDEEKGE 482

Query: 538 DYDV 541
           D  V
Sbjct: 483 DSSV 486

>KLLA0E02970g complement(278965..280587) similar to sgd|S0002795
           Saccharomyces cerevisiae YDR387c, start by similarity
          Length = 540

 Score =  120 bits (301), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 131/552 (23%), Positives = 222/552 (40%), Gaps = 85/552 (15%)

Query: 22  DPKQIKSVEDV--------SLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIG 73
            P++  SVEDV        S    T  N+   +P    +    + +    GG +FG+D G
Sbjct: 10  SPQRDSSVEDVYSDLYSTFSQMTTTTANDIEQRPYPFTWRTGIMFVSSTIGGMLFGYDTG 69

Query: 74  TIGGFVGQTDFKRRFGELNDEG-EYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRK 132
            I G +   + K    +LN    E +  ++ T +       G   G II   L D  GRK
Sbjct: 70  VISGVLIAMNPK----DLNFHSLEIWQKEIITSITCA----GSFIGSIIAFPLADRCGRK 121

Query: 133 IGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGM 192
             L            + ++ +  +     GR+V G+ VG  A   P  ++EI+P  +RG 
Sbjct: 122 HTLTVCCIIFAASSML-MAVSYTFEMLVTGRLVVGIAVGIAAQCIPIYLTEISPAKIRGT 180

Query: 193 CISLYQLMITGGIFVGYCTNY---GSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESP 249
            ++L  + ITGG F  Y   Y    +    ++  WR    LG   A++ +L +  +PESP
Sbjct: 181 MLTLNSISITGGQFAAYVIAYFMIDNDHPQSTAAWRYLFALGSIPAIVFLLTLDFIPESP 240

Query: 250 RYLIEKGKFEEAKRSLAKS-------------NKTTVD-----------DPIV--LREFD 283
           R+L+ K +  EA+ +L K               K T D           DP++  + +  
Sbjct: 241 RWLLSKSRLVEAELALHKVYPAATVPEIRHKLRKLTSDLNKLRYHNDETDPLLFPVNKRR 300

Query: 284 VINAGVEAERAIGNASWAELFSTK-----GKVLQRVIMGIMVQSLQQLTGCNYFFYYGTT 338
            + +      ++G   + E    K     GK  + +I+G ++   QQ +G N F YY  T
Sbjct: 301 SVASTRTGRSSLGATYYNEQLGKKRHRWEGKSKRALIIGCVLMFFQQTSGFNAFMYYSAT 360

Query: 339 IFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWG----SASMACCFVVFA 394
           IF+ VG  +  V +I++   NFS T +++  ++  G+R  LL      +  +  C V F 
Sbjct: 361 IFEQVGFTNPLVPAIIVAFTNFSFTLLAMKLIDTMGKRTLLLMTIWIMTVGLLLCSVGFE 420

Query: 395 SMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFA-----VSWAPIAFVVVAESYPQRI 449
              +                  +++V   +++  +A     V W+ + F+      P   
Sbjct: 421 LNNLA-----------------LLVVSVIVYVGAYATGMGVVPWSSVEFL------PLNR 457

Query: 450 KQRAMAIAVAANWIWNFAIGFCTPFITSAI-NFYYGFVXXXXXXXXXXXXXXXVCETKGL 508
           +    ++    NW+ N  +      IT  I N     +                 E KGL
Sbjct: 458 RAVGGSMISCTNWLTNSVLSLTYLTITDRIGNENTMLLFALFTIFNWLFVYIWYPEVKGL 517

Query: 509 SLEEFNEMYEEG 520
           SLEE  +++E G
Sbjct: 518 SLEEIGQVFENG 529

>ABR223C [817] [Homologous to ScYFL040W - SH] (820632..822506) [1875
           bp, 624 aa]
          Length = 624

 Score =  120 bits (301), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 104/439 (23%), Positives = 204/439 (46%), Gaps = 39/439 (8%)

Query: 65  GFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGR 124
           G + G DI  +  F+    F R F        +Y +    G++     +    G ++ G 
Sbjct: 18  GLVLGIDISAMAVFISSDYFNRYF--------HYPNAFEQGMVSGAHPMEGLTGCLLFGY 69

Query: 125 LGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEI 184
           +G+   R +G             I      +     IGR + G+ VG ++V++   + EI
Sbjct: 70  VGERVSR-LGCFRYFTFIWIIGCIVSVLVMDIYMVAIGRFIKGVAVGSLSVVASVYLVEI 128

Query: 185 APKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMM 244
            P + +G+  +L QL +T GIF+ Y   +    + N + +R+  GL    A+ ++ G + 
Sbjct: 129 FPSNRKGIATALVQLTLTFGIFLMYMLCWTFSRFNNHMAFRISWGLEIIPAVALISGTLF 188

Query: 245 VPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELF 304
           VPESPR+ + +G++++A+  L   N  + ++     +  ++N   +  +    AS+ +L 
Sbjct: 189 VPESPRWFVMQGQYKKAQEILTLLNCRSKNE---FNKQTLLNMYGDTAK----ASFKDLI 241

Query: 305 STKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMD--DSYVTSIVLGVVNFSS 362
             K   ++++IMG+ +Q+L Q TG N   YY   I +  G++  +    + +  ++N   
Sbjct: 242 --KLPYIKQLIMGMTIQALVQFTGINVVMYYVVYICEMAGLEGREKMNVASIPYLLNILF 299

Query: 363 TFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMD------QPT-----S 411
           TFI L  ++R  R+  +++GS ++A    +   +G+T ++ +G D       P      S
Sbjct: 300 TFIPLHLLDRVQRKVLIVYGSFALAA---IMNLIGLT-MWIHGHDVSPINGNPALVWKLS 355

Query: 412 KSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFC 471
              G + I     FI  FA + +   ++   E    +I+ R ++I ++ +WI N  + F 
Sbjct: 356 PLGGQITISLCFAFIAIFASTLSCAGWLYTNEVLADKIRSRGLSICMSVSWICNAVLTFL 415

Query: 472 TPFITSAIN----FYYGFV 486
           +P + S +     F +G V
Sbjct: 416 SPLMMSTMKWGTFFLFGMV 434

>Scas_632.14
          Length = 553

 Score =  119 bits (298), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 131/545 (24%), Positives = 221/545 (40%), Gaps = 91/545 (16%)

Query: 39  NENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYY 98
           N+ E  P PI+     I +      GG +FG+D G I G +          +  D     
Sbjct: 26  NDIELLPYPIT--LKTILIFAGATVGGLLFGYDTGVISGVLLTL-------KPQDLSRSV 76

Query: 99  LSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQ 158
           L++     I    + G   G II   L D  GR+  L            + ++ +   + 
Sbjct: 77  LTNFDKETITSITSFGSFIGSIIAFPLADRCGRRKTLAICCFIFIIAA-LWMAGSTTLLL 135

Query: 159 YFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSY 218
             +GR + G  VG  A   P  +SEI+P  +RG  ++L  L ITGG  + Y   Y   + 
Sbjct: 136 LVLGRFIVGCAVGVAAQCVPIYLSEISPSSIRGFILTLNSLAITGGQLLSYIAAYFLANV 195

Query: 219 TNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLA------------ 266
            +S  WR   G+    A+I++L +  +PESPR+LI KG+F EA +SL             
Sbjct: 196 NHS--WRYLFGISSIPAIILMLLLDFIPESPRWLISKGEFSEAHKSLTMIYPTASHYQVN 253

Query: 267 -KSNKTTVD-----------DPIVLRE--------FDVINAGVEAERAIGN--------- 297
            K  K  +D           +P+++R           +++   E   A G          
Sbjct: 254 LKLRKLIIDLGKLRHYQDIEEPLLIRSRSFLRSLNSSLLSQNREQSTAAGGPIQPQPFTS 313

Query: 298 ----ASWAEL---------------FSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTT 338
               AS A+L                  + +  + +I+G ++   QQ+TG N F YY   
Sbjct: 314 IAGLASIADLTAPIPIPPRTSKKHVHKMEARTKRALIIGCVLMFFQQITGFNAFMYYAAV 373

Query: 339 IFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGV 398
           IF  + +++  + +I++ + NF  TF++L  V++ G+R  LL+         +V  S+G+
Sbjct: 374 IFSKLNLENPLLPAILVALTNFLFTFVALRYVDKIGKRLMLLYT--------LVVMSIGL 425

Query: 399 TKLYPNGMDQPTSKSAGNVMIVFACLFIFC--FAVSWAPIAFVVVAESYPQRIKQRAMAI 456
             L   G D+       N++++   + IF   +A +   + +  V E  P   +    + 
Sbjct: 426 L-LVSIGFDK------NNMILILISIVIFVGGYASALGTVPWTCV-EFLPLNRRAFGSSC 477

Query: 457 AVAANWIWNFAIGFCTPFITSAI-NFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNE 515
               NW+ N  +      +  +I N     +                 E KGLSLEE  +
Sbjct: 478 ISCTNWLTNAIVALSYLSLMDSIGNGNTMLIFAGFTSLAWLFVYFFYPEVKGLSLEEIGK 537

Query: 516 MYEEG 520
           ++E G
Sbjct: 538 VFEHG 542

>CAGL0M01672g 186088..187731 similar to tr|Q04162 Saccharomyces
           cerevisiae YDR387c, hypothetical start
          Length = 547

 Score =  118 bits (295), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 124/531 (23%), Positives = 220/531 (41%), Gaps = 72/531 (13%)

Query: 35  KVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDE 94
            + TN+ +    P++  +  + L      GG +FG+D G I G +          +  D 
Sbjct: 33  SLTTNDVDNTTYPMT--WKTVALFGSSTVGGLLFGYDTGVISGVLLSL-------KPQDL 83

Query: 95  GEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTN 154
           G   +SD    LI     LGC  G ++   L D YGR+I L            + ++  +
Sbjct: 84  GRATISDWDKELITSITCLGCFVGSLLGSPLADKYGRRITLAIFCVLFIVAA-LWMALAS 142

Query: 155 NWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYG 214
           N +    GR V G+ VG  A  +P  + EI+P  +RG  ++L  + +TGG F+ Y   Y 
Sbjct: 143 NLVLLVFGRFVVGIAVGTAAQCTPVYLCEISPAKIRGQILALNSIAVTGGQFLSYIFAY- 201

Query: 215 SKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLA-------- 266
            + Y  +  WR+  GL    A+I +  +  +PESPR+L+   K++ AK +L         
Sbjct: 202 -ELYDVNGSWRILFGLSAVPAIIFLSMLDFIPESPRWLVSMSKYDSAKAALRMIYPTASP 260

Query: 267 --------------------KSNKTTVDDPIVLREFDV-IN-------AGVEAERAIGNA 298
                               +  +T++  P+ +R   V IN       A + +  ++ N 
Sbjct: 261 GQINLKFNELVINLSKLKHYQDEQTSLMVPLSVRSSRVTINSADYGSVANLRSLHSLMNE 320

Query: 299 SWAELFSTKG-------KVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVT 351
                 S K        +  + +++G ++   QQ+TG N F YY   IF  +   +  + 
Sbjct: 321 PSGTNHSNKTVHHRMEPRTKRALLIGCVLMFFQQITGFNAFMYYAPLIFSKLNSHNPLLP 380

Query: 352 SIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTS 411
           ++ +   NF  TF++++ V+  GRR  LL  +  +    ++ +++G              
Sbjct: 381 AMSIAFTNFLFTFLAVYLVDLVGRRSMLL-NTIWIMTVGLLLSTIGF------------- 426

Query: 412 KSAGNVMIVFAC-LFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGF 470
           +    V+++FA  +F+  +A +   I +  V E  P   +    +     NW+ NF I  
Sbjct: 427 QHENVVVLLFAVSIFVAAYASAMGTIPWSSV-EFLPLNRRSFGASCISCTNWLTNFVITA 485

Query: 471 CTPFITSAINFYYGFVXXXXXXXXX-XXXXXXVCETKGLSLEEFNEMYEEG 520
               + + I      +                  E KGLSLEE  +++E G
Sbjct: 486 SYLSVMNKIGTEDTMLFFALFSVMAWFFVYFWYPEVKGLSLEEIGKVFENG 536

>KLLA0D00374g 30962..32632 weakly similar to sp|Q9P8X7 Aspergillus
           parasiticus Hexose transporter protein, start by
           similarity
          Length = 556

 Score =  117 bits (293), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 118/481 (24%), Positives = 200/481 (41%), Gaps = 50/481 (10%)

Query: 68  FGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLG- 126
            G+D   + G     D+    G  N            G  +   + G  FG +IL +L  
Sbjct: 67  LGYDGSLLNGLYAMPDYLNAMGNPN------------GAELGVISNGMVFGMLILFQLAP 114

Query: 127 ---DFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQ--------------YFIGRIVSGLG 169
              D YGRK+G+            IQ + +  WI               +   RI+ G G
Sbjct: 115 YIIDKYGRKVGMYVGNVLICIGVLIQ-ALSGTWINGLPEDYDKKDVFGMFVASRIILGSG 173

Query: 170 VGGIAVLSPTLISEIA-PKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPL 228
           V  I++ +P LISEI+ P H R +C S+Y      G  V     YG ++  +   WR+P 
Sbjct: 174 VLLISIATPALISEISYPPH-RELCTSIYNTCWYLGAIVSAWVTYGCRNLAHHWNWRIPS 232

Query: 229 GLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDV--IN 286
            +   + L+ ++ +   PESPRYL+   +  EA+  L K +    ++   L +F++  I 
Sbjct: 233 IIQALFPLVQLVALYKCPESPRYLVFHNRDAEARAILNKYHAGNNEEYAGLIDFELAEIK 292

Query: 287 AGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGM- 345
             +E E+A  +  +++   T G    R+ + I      QL+G     YY + +F ++G+ 
Sbjct: 293 LAIEQEKASQSTKFSDFIKTSGN-RHRLWILIWTAIFTQLSGNGLVSYYLSKVFNSIGIT 351

Query: 346 --DDSYVTSIVLGVVNFSSTFISL-WSVERFGRRKCLLWGSASMACCFVVFASMGVTKLY 402
             DD    +  L + N+  + I + +    F RR+  L    SM  C+VV+ ++      
Sbjct: 352 DPDDQLKWNGWLMLYNWLCSLILIGYIAPFFKRRQLFLISLVSMTSCYVVWTALSAENQK 411

Query: 403 PNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAI---AVA 459
            N  D    KS  N ++    L+   +   +     +   E  P  ++ + + I   A++
Sbjct: 412 RNFED----KSLANGVLAMIFLYYLSYNFGFNGFPNLYTTEILPYTLRGKGLTIFQLAIS 467

Query: 460 ANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEE 519
            + I+N   GF  P    AI + Y                    ET G SLEE +E++ +
Sbjct: 468 ISVIFN---GFVNPVAMDAIEWKYYIFYCCFLAVEIVVCYFTFVETSGRSLEEVDEVFGD 524

Query: 520 G 520
           G
Sbjct: 525 G 525

>YBR241C (YBR241C) [420] chr2 complement(702546..704012) Member of
           the hexose transporter family of the major facilitator
           superfamily (MFS) [1467 bp, 488 aa]
          Length = 488

 Score =  114 bits (286), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 102/385 (26%), Positives = 166/385 (43%), Gaps = 33/385 (8%)

Query: 99  LSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQ 158
           L+D + G I   F++G  FG    G   + YGRK  +            + +  +N+++Q
Sbjct: 82  LTDSQYGAITSIFSIGGLFGSYYAGNWANRYGRKY-VSMGASAMCMVSSLLLFFSNSYLQ 140

Query: 159 YFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSY 218
              GR + G+  G   V++P  I+EIAP   RG   S+ Q+ I  GI +   T   +  Y
Sbjct: 141 LLFGRFLVGMSCGTAIVITPLFINEIAPVEWRGAMGSMNQVSINLGILL---TQTLALKY 197

Query: 219 TNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAK-------SNKT 271
            +S  WR  L  G   A+  +L  + V ESPR+L+  G   EA+ +L K         K 
Sbjct: 198 ADSYNWRWLLFSGSVIAVANILAWLKVDESPRWLVSHGFVSEAETALFKLRPGTYQQAKQ 257

Query: 272 TVDDPIVLREFDVINAGVEA--ERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGC 329
            + D    +     N   E+  E   G   W  +     K  + VI+ I+  S QQ  G 
Sbjct: 258 EIQD---WQRSHGHNRDPESSEETHSGPTLWQYVTDPSYKKPRTVILAIL--SCQQFCGI 312

Query: 330 NYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACC 389
           N   +YG  +   +  D S   +  + ++N   T  +   ++  GRR  LL  S ++   
Sbjct: 313 NSIIFYGVKVIGKILPDYSIQVNFAISILNVVVTLAASAIIDHVGRRPLLL-ASTTVMTA 371

Query: 390 FVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAE-SYPQR 448
             +  S+G+T             S   +++    ++I  FA+   PI F+++ E SYPQ 
Sbjct: 372 MSLLISVGLT------------LSVSFLLVTATFVYIAAFAIGLGPIPFLIIGELSYPQD 419

Query: 449 IKQRAMAIAVAANWIWNFAIGFCTP 473
               A +     NW+  F +G+  P
Sbjct: 420 -AATAQSFGTVCNWLATFIVGYLFP 443

>KLLA0E14696g 1309427..1310860 weakly similar to sp|Q9P8X7
           Aspergillus parasiticus Hexose transporter protein,
           hypothetical start
          Length = 477

 Score =  114 bits (285), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 104/417 (24%), Positives = 180/417 (43%), Gaps = 32/417 (7%)

Query: 127 DFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQ--------------YFIGRIVSGLGVGG 172
           D YGRK+G+            IQ + +  WI               +   RIV G GV  
Sbjct: 39  DKYGRKVGMYVGNVLICIGVLIQ-AVSGAWINGLPEDYDKKDVFGMFVASRIVLGTGVLL 97

Query: 173 IAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGF 232
           I++ +P LISEI+    R +C S+Y      G  V     YG ++  +   WR+P  +  
Sbjct: 98  ISISTPALISEISYPPHRELCTSIYNTCWYLGAVVSAWVTYGCRNLAHHWNWRIPSIIQA 157

Query: 233 AWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDV--INAGVE 290
            + ++ ++ +   PESPRYL+   +  EA+  L K +    ++   L +F++  I   +E
Sbjct: 158 FFPIVQLIVLYNCPESPRYLVFHNRDSEARAILNKYHAGDNEEYAGLIDFELAEIKLAIE 217

Query: 291 AERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGM---DD 347
            E+A    ++++ F T G    R+ + I      QL+G     YY + +F ++G+   D+
Sbjct: 218 QEKASQATNFSDFFKTSGN-RHRLWILIWTAIFTQLSGNGLVSYYLSKVFNSIGITDPDE 276

Query: 348 SYVTSIVLGVVNFSSTFISL-WSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGM 406
               +  L + N+  + I + +    F RR+  L    SMACC++V+ ++       N  
Sbjct: 277 QLEWNGWLMLYNWLCSLILMSYIAPFFKRRQLFLISLTSMACCYIVWTALSAENQKRNFE 336

Query: 407 DQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAI---AVAANWI 463
           D    KS  N ++    L+   +   +    F+   E  P  ++ + + I   A++   I
Sbjct: 337 D----KSLANGVLAMIFLYYLSYNFGFNGYPFLYTTEILPYTLRGKGLTIFQLAISLAVI 392

Query: 464 WNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEG 520
           +N   GF       AI + Y                    ET G SLEE +E++ +G
Sbjct: 393 FN---GFVNSIAMDAIEWKYYIFYCCFLAVEIVVCYFTFVETSGRSLEEVDEVFGDG 446

>KLLA0E25025g complement(2219051..2220721) weakly similar to
           sp|P32466 Saccharomyces cerevisiae YDR345c HXT3
           low-affinity hexose transporter P33.1.f24.1,
           hypothetical start
          Length = 556

 Score =  115 bits (287), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 116/478 (24%), Positives = 198/478 (41%), Gaps = 50/478 (10%)

Query: 68  FGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGD 127
            G+D   + G     D+    G  N      +S+            G  FG +IL +L  
Sbjct: 67  LGYDGSLLNGLYAMPDYLNAMGNPNGAELGVISN------------GMVFGMLILFQLAP 114

Query: 128 F----YGRKIGLXXXXXXXXXXXXIQISSTNNWIQ--------------YFIGRIVSGLG 169
           F    YGRK+G+            IQ + +  WI               +   RI+ G G
Sbjct: 115 FIIDKYGRKVGMYVGNVLICIGVLIQ-ALSGTWINGLPEDYDRKDVFGMFVASRIILGSG 173

Query: 170 VGGIAVLSPTLISEIA-PKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPL 228
           V  I++ +P LISEI+ P H R +C S+Y      G  V     YG ++  +   WR+P 
Sbjct: 174 VLLISIATPALISEISYPPH-RELCTSIYNTCWYLGAIVSAWVTYGCRNLAHHWNWRIPS 232

Query: 229 GLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDV--IN 286
            +   + L+ ++ +   PESPRYL+   +  EA+  L K +    ++   L +F++  I 
Sbjct: 233 IIQALFPLVQLVALYKCPESPRYLVFHNRDAEARAILNKYHAGNNEEYAGLIDFELAEIK 292

Query: 287 AGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGM- 345
             +E E+A  +  +++   T G    R+ + I      QL+G     YY + +F ++G+ 
Sbjct: 293 LAIEQEKASQSTKFSDFIKTSGN-RHRLWILIWTAIFTQLSGNGLVSYYLSKVFNSIGIT 351

Query: 346 --DDSYVTSIVLGVVNFSSTFISL-WSVERFGRRKCLLWGSASMACCFVVFASMGVTKLY 402
             DD    +  L + N+  + I + +    F RR+  L    SM  C+VV+ ++      
Sbjct: 352 DPDDQLKWNGWLMLYNWLCSLILIGYIAPFFKRRQLFLISLVSMTSCYVVWTALSAENQK 411

Query: 403 PNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAI---AVA 459
            N  D    K+  N ++    L+   +   +     +   E  P  ++ + + I   A++
Sbjct: 412 RNFED----KTLANGVLAMIFLYYLSYNFGFNGFPNLYTTEILPYTLRGKGLTIFQLAIS 467

Query: 460 ANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMY 517
            + I+N   GF  P    AI + Y                    ET G SLEE +E++
Sbjct: 468 ISVIFN---GFVNPIAMDAIEWKYYIFYCCFLSVEIVVCYFTFVETSGRSLEEVDEVF 522

>YDR387C (YDR387C) [1215] chr4 complement(1248142..1249809) Member
           of the hexose transporter family of the major
           facilitator superfamily (MFS) [1668 bp, 555 aa]
          Length = 555

 Score =  111 bits (278), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 129/530 (24%), Positives = 201/530 (37%), Gaps = 107/530 (20%)

Query: 64  GGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILG 123
           GG +FG+D G I G +          +  D     L+DV+  LI  + ++G  FG I+  
Sbjct: 49  GGLLFGYDTGVISGVLLSL-------KPEDLSLVVLTDVQKELITSSTSVGSFFGSILAF 101

Query: 124 RLGDFYGRKIGLXXXXXXXXXXXX-IQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLIS 182
            L D YGR+I L             + I+ T  ++    GR++ G+ VG  A   P  +S
Sbjct: 102 PLADRYGRRITLAICCSIFILAAIGMAIARTLTFL--ICGRLLVGIAVGVSAQCVPLFLS 159

Query: 183 EIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGM 242
           EI+P  +RG  ++L  + ITGG  V Y      K   NS  WR    L    A++ +  +
Sbjct: 160 EISPSRIRGFMLTLNIIAITGGQLVSYVIASLMKEIDNS--WRYLFALSAIPAILFLSIL 217

Query: 243 MMVPESPRYLIEKGKFEEAKRSLA------------------------------KSNKTT 272
             +PESPR+ I KG     + SL                                S    
Sbjct: 218 DFIPESPRWSISKGDILYTRDSLRMLYPTASTYHVNSKIKQLIIELDKLRLYEDASEPLL 277

Query: 273 VDDPIVLREFDVINAGVEAERAI-------------------------GNASWAELFSTK 307
           V    V+R  D   +G  +   I                         G A    L S K
Sbjct: 278 VQSQSVIRYMDSSTSGTLSPPNIKRLSSNTERTSNTMSSSSAYLSALRGPAPNGALASNK 337

Query: 308 GK-------VLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNF 360
            K        ++ +I+G M+   QQ+TG N F YY   IF    + +  +  I++   NF
Sbjct: 338 KKRHRMEPRTIRALIVGCMLMFFQQITGFNAFMYYAAIIFSKFNIKNPLLPPILIASTNF 397

Query: 361 SSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIV 420
             TF ++++++  GRR  LL     M    ++  S+G       G DQ       N++++
Sbjct: 398 IFTFFAMYTMDSLGRRAILLRTILIMTVG-LLLCSVGF------GHDQV------NLLLI 444

Query: 421 FACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAIN 480
              +++  +A +   + +  V E  P   +    +     NW+ N    F +    S IN
Sbjct: 445 SVVIYVAAYASAMGSVPWTCV-EFLPLNRRSFGASCIACTNWLTN---AFVSMTYLSTIN 500

Query: 481 FYYGFVXXXXXXXXXXXXXXXVC----------ETKGLSLEEFNEMYEEG 520
                                VC          E KGLSLEE   +++ G
Sbjct: 501 ------TIGDENTMLIFAFFTVCAWFFVYFWYPEVKGLSLEEVGRVFDNG 544

>Kwal_14.1105
          Length = 522

 Score =  108 bits (271), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 103/420 (24%), Positives = 192/420 (45%), Gaps = 29/420 (6%)

Query: 60  MIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGG 119
           ++A  G I G DI +I  F+    FK  F   N+ G      + TG   V   +GC   G
Sbjct: 14  ILAVAGTILGMDISSISIFLTSDFFKSYF---NNPGPAA-QGIMTGANPVGGLVGCVLFG 69

Query: 120 IILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPT 179
           ++  R G     +I              +     N W+   +GR+V G+ VG  +VL P 
Sbjct: 70  VLTERTGRVSTFRILSLIWILGSIFSALV----LNVWM-ITVGRLVRGMAVGSFSVLLPV 124

Query: 180 LISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMV 239
            I E+ P H +G   ++ QL IT  I V +   +      +   +R+  GL    AL+++
Sbjct: 125 YIGEVIPAHKKGTATAVVQLSITSAILVTFFVCFLLSFLGDQASFRIAWGLEMIPALLVL 184

Query: 240 LGMMMVPESPRYLIEKGKFEEAKRSLAKSNKT-----TVDDPIVLREFDVINAGVEAERA 294
           L    + ESP++L+  G++++A+  L            V + + + + D++     A++ 
Sbjct: 185 LLSFSLIESPKWLVSHGEYDKAREILQHFKPPGMPGEKVTNNVRVSKIDILELYGTAQK- 243

Query: 295 IGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGM--DDSYVTS 352
                +++LFS    + +  I GI +Q L Q  G N   +Y   I + +G+   +  V +
Sbjct: 244 ---TRYSDLFSR--SLWKHTIAGITIQVLVQTCGINTLMFYIVYICEMIGLRGKNKLVAA 298

Query: 353 IVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVF-ASMGV---TKLYPNGMDQ 408
           ++  ++N   TF+ + +++   R+  ++ G  ++A   ++   +MGV        NG   
Sbjct: 299 LIPCLINVVFTFVPILTLDHLRRKVVIVSGGFTLAAIMILIGGTMGVFGHAVATVNGNST 358

Query: 409 PTSK---SAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWN 465
            T K   ++G +++    LF+  FA + +  A++  +E +P R K + MA  +A +W  N
Sbjct: 359 VTWKVEGASGFLVMALCFLFVAIFASTLSCCAWLYTSEIFPLRAKPKGMAFCMAISWFLN 418

>Kwal_14.1625
          Length = 506

 Score =  108 bits (269), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 121/530 (22%), Positives = 202/530 (38%), Gaps = 80/530 (15%)

Query: 45  PKPISAYFTVICLCLMIA-FGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYY----- 98
           P+P   +   +    M+A FG   +G+ +  +    GQ     +F   + +  Y      
Sbjct: 10  PRPKPKFTGSLLFATMVACFGSIQYGYHVAELNA-PGQVLSCTKFVSPHPDRPYSDTWFG 68

Query: 99  ---------LSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQ 149
                    LS+ + GL    F +G   G +  G++ D YGRK               + 
Sbjct: 69  RHGFQQCIPLSEEQMGLATSIFCIGGLVGSLYAGKVADRYGRK-RYSFSNCVIGVIGSLI 127

Query: 150 ISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGY 209
           +   N++    IGR++ G+  G   V++P  I+EI+PK LRG   S+ Q+ I  GI +  
Sbjct: 128 LFRANSYASLLIGRLIVGISCGSCIVVTPLFINEISPKELRGSLGSMNQVCINIGILL-- 185

Query: 210 CTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLA--- 266
            T   +  Y +S +WR  +  G   ALI  L +  + ESP +L  +G  + A+  L+   
Sbjct: 186 -TQLLALRYADSYRWRWLMLAGAGLALIQFLLLFAIEESPLWLASRGDLDGAENVLSILR 244

Query: 267 -------------------KSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAEL---- 303
                               S   T       RE          E AI  AS +++    
Sbjct: 245 GGDRRRSRGEVEEWLQTRGSSRPGTSSPDSTGRESPASQQSSLPESAIDAASQSDVSVSN 304

Query: 304 ------FSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGV 357
                 +S     +  ++MG      QQ  G     +YG  +        + + +  + +
Sbjct: 305 YFSDPRYSKSRWAVTAILMG------QQFVGIGSIIFYGVKLISGQLPQYAVLVNFAISI 358

Query: 358 VNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNV 417
           +N   T  +   V+ +GR+  L++ + +++    VF S G+              S   +
Sbjct: 359 LNVVVTLGASVLVDHWGRKPLLVFSAGAISIA-SVFVSAGIVM------------SNAAM 405

Query: 418 MIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITS 477
           ++    +F+  FA+   PI F+V+AE  P      A +   A NWI N  +G+  P +  
Sbjct: 406 LVTSTFMFVAVFAMGLGPIPFLVIAELSPPEASGIAQSYGTACNWIGNSIVGYGFPIMNE 465

Query: 478 AINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPWKSD 527
               Y   V               V ETKG       + YE   L WK D
Sbjct: 466 FFGGYAFLVFAAYAAGFALYVHFRVPETKG------KQDYE---LVWKED 506

>Kwal_27.12815
          Length = 198

 Score =  102 bits (253), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/188 (31%), Positives = 99/188 (52%), Gaps = 12/188 (6%)

Query: 355 LGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSA 414
           + VVN   T   +  VE  GRR  LLWG+  M    ++ A++G           P S SA
Sbjct: 1   MNVVNVIMTIPGIALVEIAGRRNLLLWGAVGMCVSELIVAAVGTA--------LPDSFSA 52

Query: 415 GNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPF 474
              +I F+C FI  FA +W P+A+VVV E +P R++ +++A+  A+NW++NFAI + TP+
Sbjct: 53  NKTLIAFSCTFIASFAATWGPLAWVVVGEIFPLRVRAKSVAVCAASNWLFNFAIVYATPY 112

Query: 475 ITSA----INFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPWKSDTWI 530
           +  +    +     F+               + ETKGL+LE+ ++++E  +   +S  +I
Sbjct: 113 LVDSEHANLQSKLFFIWGGCTFLCFLFVYFFIYETKGLTLEQIDQLFETCSSARQSKGFI 172

Query: 531 PSSRRGAD 538
           P+ R   D
Sbjct: 173 PTERLETD 180

>AFL034W [3159] [Homologous to ScYBR241C - SH; ScYGL104C - SH]
           complement(371827..373251) [1425 bp, 474 aa]
          Length = 474

 Score =  107 bits (267), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 105/421 (24%), Positives = 180/421 (42%), Gaps = 23/421 (5%)

Query: 98  YLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWI 157
           +L D + GL+   F++G   G +  G   D YGR+                 + + N++ 
Sbjct: 75  HLDDSQYGLVTSIFSVGGLLGSLCTGSQADRYGRRAAAIGSSVLAAAGSAAMVFA-NSYA 133

Query: 158 QYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKS 217
           Q  +GR+V+G+G GG  V++  +++E+AP  L+G   +L Q  I  GI V   T   + +
Sbjct: 134 QLLLGRLVAGVGCGGGIVVTSLMLNEMAPAELKGALGALNQTCINLGILV---TQLLAFA 190

Query: 218 YTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPI 277
           + NS+QWR+   +  A A+     ++ V ESPR+L   G  + A+R+L        DD  
Sbjct: 191 WANSVQWRLLFAVSAAVAVAHCGLLLGVEESPRWLAANGHEQRAERAL---RWLRADDAA 247

Query: 278 VLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGT 337
              E        E E A   +S     +       R ++ +++   QQ  G N   +YG 
Sbjct: 248 AAHELREWRRAREHEAAAQCSSLRRYIADARYAHVRCVVAVLLMG-QQFCGINSIVFYGV 306

Query: 338 TIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMG 397
            +        S   +  +  VN   T  +   V+R GRR  L   +A+MA    + A+ G
Sbjct: 307 KLINGALPGLSIAVNFGISAVNLVVTLTAAALVDRVGRRPLLQCSAAAMAVASTLMAA-G 365

Query: 398 VTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIA 457
           +               +  V++V    +I  FA+ + PI F+++AE         A +  
Sbjct: 366 IL------------LESAAVLVVCTFAYITFFALGFGPIPFLIIAELSSPGTAAVAQSYG 413

Query: 458 VAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMY 517
           +A NW+  F +GF  P +   I  Y   +               V ET+G    ++ E++
Sbjct: 414 LALNWVATFFVGFGFPVLNQLIGGYVFMLFGAFAAFMALYVRNRVPETRG--KHDYREVW 471

Query: 518 E 518
           +
Sbjct: 472 Q 472

>Sklu_2080.4 YBR241C, Contig c2080 4658-6229
          Length = 523

 Score =  107 bits (266), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 107/462 (23%), Positives = 191/462 (41%), Gaps = 62/462 (13%)

Query: 99  LSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQ 158
           L D + GL+   F+LG   G +  G L D YGRK  +            + +  +N++  
Sbjct: 80  LDDQQIGLVTSIFSLGGLAGSLYAGNLADKYGRK-RVSFFNSTLGILGSLLLFRSNSYGS 138

Query: 159 YFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSY 218
              GR  +G+  G   V++P LI+EI+P   +G   S+ Q+ I  GI V   T   +  +
Sbjct: 139 LLFGRFTAGVSCGSSIVITPLLINEISPHEWKGALGSMNQVSINIGILV---TQLLALRW 195

Query: 219 TNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAK---------------- 262
            +S +WR  L  G   AL+  L + ++ ESP++L+ +G+ ++A+                
Sbjct: 196 ADSFRWRWLLFFGAILALLNFLLLFVIDESPKWLLSRGEVDQAESILHGLRGGHRQHSRD 255

Query: 263 -------------RSLAKSNKTTVD----------DPIVLREFDVINAGVEAERAIGN-- 297
                        RS  ++   T D           P         N+ +  E++     
Sbjct: 256 EINEWLTLRGDRSRSQQQTPSQTRDSLRTIKPSHVSPPTYDPLPSANSTISTEQSSEEEM 315

Query: 298 ASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGV 357
           + W  + S K    +R I  I++   QQ  G N   +YG  +   +  D + + +  + +
Sbjct: 316 SLWQYITSPKYTKSRRAITAILMG--QQFCGINSIIFYGVKVISDLLPDQAILANFGISI 373

Query: 358 VNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNV 417
           +N   TF +   V+ +GR+  L+  + SM+    +  S G+              S   +
Sbjct: 374 LNVVVTFGASPLVDHWGRKPLLITSATSMSLASSLI-SYGIL------------TSNAVL 420

Query: 418 MIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITS 477
           ++ F  ++I  FAV   PI F+V+ E  P     +A +     NW+  F IG+  P + S
Sbjct: 421 LVAFTFVYIGVFAVGLGPIPFLVIPELSPVEAVGKAQSYGTTCNWLATFIIGYGFPILNS 480

Query: 478 AINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEE 519
            +     F+               + ETKG   +++ E++ E
Sbjct: 481 WLGGAVFFLFSSFAILFAIYVYYEIPETKG--RKDYYEVWGE 520

>YJR160C (MPH3) [3050] chr10 complement(737923..739731) Protein with
           maltose permease activity, member of hexose transporter
           family of the major facilitator superfamily (MFS),
           identical to Mph2p [1809 bp, 602 aa]
          Length = 602

 Score =  105 bits (261), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 105/447 (23%), Positives = 200/447 (44%), Gaps = 26/447 (5%)

Query: 24  KQIKSVEDVSLKVK-TNENE-GAP--KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFV 79
           K I  + D +   K  +E+E G P    ++ Y       L+++    + G+D   +G F 
Sbjct: 63  KVITEIFDATEDAKEADESERGMPLATALNTYPKAAAWSLLVSTTLIMEGYDTAILGAFY 122

Query: 80  GQTDFKRRFGELNDE-GEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXX 138
               F+R+FG  ND+ GE+ +S      + + +  G   G  + G   D  G +  L   
Sbjct: 123 ALPIFQRKFGSQNDKTGEWEISASWQIGLTLCYMAGEIVGLQLTGPSVDLVGNRYTLIIA 182

Query: 139 XXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQ 198
                    I +   N+     +G+ + G+  G    L+ +  SEI P  LR    +   
Sbjct: 183 LFFLAAFTFI-LYFCNSLGMIAVGQALCGMPWGCFQCLTVSYASEICPLALRYYLTTYSN 241

Query: 199 LM-ITGGIFVGYCTNYGSKSYTNS-IQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKG 256
           L  + G +F         K Y +S + +++P  L +   + + LG+   PESP +L++KG
Sbjct: 242 LCWLFGQLFAAGIMKNSQKKYADSELGYKLPFALQWILPVPLALGIFFAPESPWWLVKKG 301

Query: 257 KFEEAKRSLAK--SNKTTVDDPIVLREFDVINAGVEAERAIGN--ASWAELFSTKGKVLQ 312
           +F+EA+RSL +  S K    + +V  E D I   ++ E+ + +   S+++ F  + K+ +
Sbjct: 302 RFDEARRSLRRTLSGKGPEKEILVTLEVDKIKVTIDKEKRLTSKEGSYSDCF--EDKINR 359

Query: 313 RVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDD--SYVTSIVLGVVNFSSTFISLWSV 370
           R      +    Q T  +    Y T  ++  G+    S+  SI+   +   +TF+S W+ 
Sbjct: 360 RRTRITCLCWAGQATCGSILIGYSTYFYEKAGVSTEMSFTFSIIQYCLGICATFLSWWAS 419

Query: 371 ERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFA 430
           + FGR     +G A     F +   +G +  + + M       +G++++  A    F + 
Sbjct: 420 KYFGRYDLYAFGLAFQTIVFFIIGGLGCSSTHGSKM------GSGSLLMAVA----FFYN 469

Query: 431 VSWAPIAFVVVAESYPQRIKQRAMAIA 457
           +  AP+ F +V+E    R++ + + +A
Sbjct: 470 LGIAPVVFCLVSEMPSSRLRTKTIILA 496

>YDL247W (MPH2) [630] chr4 (5985..7814) Protein with maltose
           permease activity, member of hexose transporter family
           of the major facilitator superfamily (MFS), identical to
           Mph3p [1830 bp, 609 aa]
          Length = 609

 Score =  104 bits (260), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 118/517 (22%), Positives = 221/517 (42%), Gaps = 36/517 (6%)

Query: 24  KQIKSVEDVSLKVK-TNENE-GAP--KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFV 79
           K I  + D +   K  +E+E G P    ++ Y       L+++    + G+D   +G F 
Sbjct: 63  KVITEIFDATEDAKEADESERGMPLATALNTYPKAAAWSLLVSTTLIMEGYDTAILGAFY 122

Query: 80  GQTDFKRRFGELNDE-GEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXX 138
               F+R+FG  ND+ GE+ +S      + + +  G   G  + G   D  G +  L   
Sbjct: 123 ALPIFQRKFGSQNDKTGEWEISASWQIGLTLCYMAGEIVGLQLTGPSVDLVGNRYTLIIA 182

Query: 139 XXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQ 198
                    I +   N+     +G+ + G+  G    L+ +  SEI P  LR    +   
Sbjct: 183 LFFLAAFTFI-LYFCNSLGMIAVGQALCGMPWGCFQCLTVSYASEICPLALRYYLTTYSN 241

Query: 199 LM-ITGGIFVGYCTNYGSKSYTNS-IQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKG 256
           L  + G +F         K Y +S + +++P  L +   + + LG+   PESP +L++KG
Sbjct: 242 LCWLFGQLFAAGIMKNSQKKYADSELGYKLPFALQWILPVPLALGIFFAPESPWWLVKKG 301

Query: 257 KFEEAKRSLAK--SNKTTVDDPIVLREFDVINAGVEAERAIGN--ASWAELFSTKGKVLQ 312
           +F+EA+RSL +  S K    + +V  E D I   ++ E+ + +   S+++ F  + K+ +
Sbjct: 302 RFDEARRSLRRTLSGKGPEKEILVTLEVDKIKVTIDKEKRLTSKEGSYSDCF--EDKINR 359

Query: 313 RVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDD--SYVTSIVLGVVNFSSTFISLWSV 370
           R      +    Q T  +    Y T  ++  G+    S+  SI+   +   +TF+S W+ 
Sbjct: 360 RRTRITCLCWAGQATCGSILIGYSTYFYEKAGVSTEMSFTFSIIQYCLGICATFLSWWAS 419

Query: 371 ERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFA 430
           + FGR     +G A     F +   +G +  + + M       +G++++  A    F + 
Sbjct: 420 KYFGRYDLYAFGLAFQTIVFFIIGGLGCSSTHGSKM------GSGSLLMAVA----FFYN 469

Query: 431 VSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAIN-------FYY 483
           +  AP+ F +V+E    R++ + + +A      +N     C+  I   +N          
Sbjct: 470 LGIAPVVFCLVSEMPSSRLRTKTIILARNT---YNVVSIICSVLILYQLNSKKWNWGAKS 526

Query: 484 GFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEG 520
           GF                + ET G +  E NE+++ G
Sbjct: 527 GFFWGVLCFCTLIWAVVDLPETAGKTFVEINELFKLG 563

>CAGL0C01771g 187030..188487 similar to sp|P38142 Saccharomyces
           cerevisiae YBR241c or sp|P53142 Saccharomyces cerevisiae
           YGL104c, start by similarity
          Length = 485

 Score =  102 bits (255), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 95/373 (25%), Positives = 166/373 (44%), Gaps = 23/373 (6%)

Query: 105 GLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRI 164
           G++    ++G   G  I G+L   YG+K  +            + ++  N +     GR+
Sbjct: 87  GVVTSVLSVGGLIGSYIAGQLAAKYGKK-KISQGTAFVYFIGSLMLTMANGYWTMIFGRL 145

Query: 165 VSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQW 224
           + G+  G   V+ P  I+EI P   +G   ++ QL I  GI     T   +  +TNS  W
Sbjct: 146 LVGMASGISIVVIPVYINEITPAEYKGAMGTMNQLSINIGILF---TQTIALVFTNSYYW 202

Query: 225 RMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTT---VDDPIVLRE 281
           R  L +G A AL+  +    + ESP++L+++G   EA+  + K +  T     D I   +
Sbjct: 203 RWILLIGTAIALVNFVAWSTIDESPKWLLKRGLTSEAEMVVYKLHGGTYQDAKDQIQTWQ 262

Query: 282 FDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQ 341
            D +N+  E     G       F T+ +  +   +  M+   QQ  G N   +YG  +  
Sbjct: 263 TD-MNSHHEHADFAGREPTLWEFVTREEYKKPRNVIFMILCAQQFCGINSIIFYGVKVIS 321

Query: 342 AVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMA-CCFVVFASMGVTK 400
               + + + +  + V+N   TF++   ++  GR+  LL  SA MA   F++  S+G++K
Sbjct: 322 NSLPNSAVLVNFGISVLNVLMTFVASVIIDSLGRKPLLLSSSALMAGTSFLI--SIGISK 379

Query: 401 LYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAA 460
             P  +          V+ VFA  +I  FA+   PI  ++++E        +A +     
Sbjct: 380 DVPILL----------VIAVFA--YIASFAIGVGPIPLMIISELTTHEAAAKAQSFGTIC 427

Query: 461 NWIWNFAIGFCTP 473
           NW+  F +GF  P
Sbjct: 428 NWLATFLVGFLFP 440

>KLLA0D00253g <12780..14534 gi|5441459|emb|CAB46745.1 Kluyveromyces
           lactis maltose permease, hypothetical start
          Length = 584

 Score =  103 bits (256), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 107/488 (21%), Positives = 202/488 (41%), Gaps = 33/488 (6%)

Query: 48  ISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYL--SDVRTG 105
           +  Y   +   L+++ G  + G+D   I        F+  FGE N   + +   S  + G
Sbjct: 70  LRKYPKAVGWSLVVSTGLIMEGYDTAFINNLFALPIFRTTFGEYNQANDIWEIPSKWQIG 129

Query: 106 LIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIV 165
           L +     G   G  I G   D YG ++ L            I +   N+     IG+I+
Sbjct: 130 LGMCV-ACGEIIGLQITGIFADRYGYRLVLIAGLVLLIAFNFI-LYFANSLTMIAIGQIL 187

Query: 166 SGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQL--MITGGIFVGYCTNYGSKSYTNSIQ 223
           SG+  G    L  +  SE+ P  LR    +   L  +I   I  G           + + 
Sbjct: 188 SGIPWGSFQTLCVSYASEVCPLVLRYYLTTYINLCWLIGQVIAAGVLKACQEHLANDELG 247

Query: 224 WRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAK------SNKTTVDDPI 277
           WR+P  L + W + +++G+ + PESP +L+ KG+ ++AKRS+ +      S K  + D +
Sbjct: 248 WRLPFALQWIWPVPLIVGIYLAPESPWWLVRKGRIDQAKRSVTRILTLPTSEKDKLTDIM 307

Query: 278 VLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGT 337
           + +    +   VE E  + + S + +   KG   +R  +  +   +Q LTG +    Y T
Sbjct: 308 ITK----MRMTVEKENRLASESSSYMDCFKGIDARRTRITCLTWVMQNLTG-SALMGYST 362

Query: 338 TIFQAVGMDDS--YVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFAS 395
             ++  G+D S  +  SI+  V+    T  S +   R GR   L WG         +   
Sbjct: 363 YFYEKAGLDTSAAFTFSIIQYVIGIVGTLTSWFLSSRAGRFTILFWGVFFQTIVMFITGG 422

Query: 396 MGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMA 455
           +G +        +  S  AG++++++     F +  +  P+ + VV+E    R++ + + 
Sbjct: 423 LGFSS------SEGASWGAGSMLLIYN----FFYNSTLGPVVYCVVSEIPSDRLRTKTVV 472

Query: 456 IAVAANWIWNFAIGFCTPFITSAINFYY----GFVXXXXXXXXXXXXXXXVCETKGLSLE 511
           +A  +  +        TP++ ++  + +    G                 + ETKG +  
Sbjct: 473 LARNSYNLIAIVNSILTPYMLNSDQWNWGAKTGLFWGGLAAISLVWAYFDLPETKGRTFA 532

Query: 512 EFNEMYEE 519
           E +E++ +
Sbjct: 533 ELDELFHQ 540

>KLLA0B00264g 12844..14574 gi|5441459|emb|CAB46745.1 Kluyveromyces
           lactis maltose permease, start by similarity
          Length = 576

 Score =  102 bits (255), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 107/488 (21%), Positives = 202/488 (41%), Gaps = 33/488 (6%)

Query: 48  ISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYL--SDVRTG 105
           +  Y   +   L+++ G  + G+D   I        F+  FGE N   + +   S  + G
Sbjct: 62  LRKYPKAVGWSLVVSTGLIMEGYDTAFINNLFALPIFRTTFGEYNQANDIWEIPSKWQIG 121

Query: 106 LIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIV 165
           L +     G   G  I G   D YG ++ L            I +   N+     IG+I+
Sbjct: 122 LGMCV-ACGEIIGLQITGIFADRYGYRLVLIAGLVLLIAFNFI-LYFANSLTMIAIGQIL 179

Query: 166 SGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQL--MITGGIFVGYCTNYGSKSYTNSIQ 223
           SG+  G    L  +  SE+ P  LR    +   L  +I   I  G           + + 
Sbjct: 180 SGIPWGSFQTLCVSYASEVCPLVLRYYLTTYINLCWLIGQVIAAGVLKACQEHLANDELG 239

Query: 224 WRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAK------SNKTTVDDPI 277
           WR+P  L + W + +++G+ + PESP +L+ KG+ ++AKRS+ +      S K  + D +
Sbjct: 240 WRLPFALQWIWPVPLIVGIYLAPESPWWLVRKGRIDQAKRSVTRILTLPTSEKDKLTDIM 299

Query: 278 VLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGT 337
           + +    +   VE E  + + S + +   KG   +R  +  +   +Q LTG +    Y T
Sbjct: 300 ITK----MRMTVEKENRLASESSSYMDCFKGIDARRTRITCLTWVMQNLTG-SALMGYST 354

Query: 338 TIFQAVGMDDS--YVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFAS 395
             ++  G+D S  +  SI+  V+    T  S +   R GR   L WG         +   
Sbjct: 355 YFYEKAGLDTSAAFTFSIIQYVIGIVGTLTSWFLSSRAGRFTILFWGVFFQTIVMFITGG 414

Query: 396 MGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMA 455
           +G +        +  S  AG++++++     F +  +  P+ + VV+E    R++ + + 
Sbjct: 415 LGFSS------SEGASWGAGSMLLIYN----FFYNSTLGPVVYCVVSEIPSDRLRTKTVV 464

Query: 456 IAVAANWIWNFAIGFCTPFITSAINFYY----GFVXXXXXXXXXXXXXXXVCETKGLSLE 511
           +A  +  +        TP++ ++  + +    G                 + ETKG +  
Sbjct: 465 LARNSYNLIAIVNSILTPYMLNSDQWNWGAKTGLFWGGLAAISLVWAYFDLPETKGRTFA 524

Query: 512 EFNEMYEE 519
           E +E++ +
Sbjct: 525 ELDELFHQ 532

>Kwal_33.12950
          Length = 566

 Score =  102 bits (254), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 120/488 (24%), Positives = 206/488 (42%), Gaps = 47/488 (9%)

Query: 48  ISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVR-TGL 106
           +S +  +  LC  +A     FG D   IGG V           L  + ++ ++DV   GL
Sbjct: 96  LSKHMILAALCTSLA--ALNFGMDESAIGGAV-----------LQYQNQFNITDVNIQGL 142

Query: 107 IVVTFNLGCA-FGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIV 165
            V    L  A  G  +   L  + GR+  +            IQ    N +      R++
Sbjct: 143 TVAAPYLAAACIGSPLTVYLDKYTGRRWIVFWSCLIGFAGSLIQ-GFANGFGCLLFARLL 201

Query: 166 SGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWR 225
            G+G+G  +   P   +E +P + RG  + L+Q  I  G+ +G   N    +   S+ WR
Sbjct: 202 LGVGMGLNSATVPIYTAECSPANSRGALLMLWQTFIALGVCLGSVFNRAFVNINGSLSWR 261

Query: 226 MPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVI 285
           + +G      +I    +   PESPR+L+     + AK++L    K   +D    R+F ++
Sbjct: 262 LMIGSSAVAPVITAALIFFPPESPRWLVVH---KRAKQALISLTKLRPNDLSGARDFYIL 318

Query: 286 NAGVEAERAIGN--ASWAE---LFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIF 340
              ++ E  + N  + W +   LFS K      ++  I +   QQ  G N    Y TTI 
Sbjct: 319 IDSLKFEAELNNNLSPWNQFVSLFSNKRNRFALIVSLIGILG-QQYGGVNILVSYTTTIL 377

Query: 341 QAVGMD--DSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGV 398
              G+D   +   SI +G   F +T +S   ++RFGRRK LL+     A C  +F   GV
Sbjct: 378 TKAGVDPVTAIAGSIGIGGGCFLATLLSAQLIDRFGRRKMLLYTLPVEALC--LFWLGGV 435

Query: 399 TKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAV 458
                  ++   +KS     +    +++  +     P++F +VAE+    ++    +  +
Sbjct: 436 -------LNVTNAKSRLGAGLASMYVYVLFYGTGIGPVSFTLVAETSSISVRMAHSSTCM 488

Query: 459 AANWIWNFAIGFCTPFITSAIN------FYYGFVXXXXXXXXXXXXXXXVCETKGLSLEE 512
             NWI +F +    P + S ++      FY GF                + ETK  +LE+
Sbjct: 489 FVNWILDFCLSMTWPKMDSTMSTSGGLYFYGGF-----NIVVWTLAFLCIPETKQFTLEQ 543

Query: 513 FNEMYEEG 520
            +E+++ G
Sbjct: 544 LDEIFKVG 551

>KLLA0E08987g 804915..806615 gi|22293246|emb|CAC79614.1
           Kluyveromyces lactis hexose transporter, start by
           similarity
          Length = 566

 Score =  101 bits (251), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 128/529 (24%), Positives = 213/529 (40%), Gaps = 54/529 (10%)

Query: 22  DPKQIKSVEDVSLKVKTNENEGAPKPISAY-------------------FTVICLCLMIA 62
           D     S + +  ++K  E+E A  P++                     + VI L    +
Sbjct: 41  DDNYFFSEDQILTQIKVYEDEIANTPVTKTLRQRMRRMEFCEVNFSNKTYMVIMLGFFAS 100

Query: 63  FGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIIL 122
           F G + G D  TI G       K      +DE           LI     LG   G I+L
Sbjct: 101 FAGILSGVDQSTISG--ASYGMKASLKLTSDEDS---------LISSLMPLGAVGGSILL 149

Query: 123 GRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLIS 182
             L +++GRK+ L            +  ++ +    Y  GR + G+GVG         I+
Sbjct: 150 TPLSEYFGRKVALVISCIFYTIGGILCAAAQDVHTMY-AGRFLIGVGVGIEGGGVGVYIA 208

Query: 183 EIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGM 242
           E  P  +RG  +SLYQ  I  G  VGY    G   +     WR  LG    ++ I+ +G+
Sbjct: 209 ESVPSTVRGSLVSLYQFNIALGELVGYVI--GVIFFDVKGGWRYMLGSSLVFSTILFVGL 266

Query: 243 MMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIG--NASW 300
             +PESPR+LI KG   EA +   +   T+  D    REF  +    E +R +    + +
Sbjct: 267 FFLPESPRWLIHKGYDVEAYKVWRRLRDTS--DLGNKREFLEMKHAAEQDRQLKEQESRF 324

Query: 301 AELFS--TKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMD--DSYVTSIVLG 356
             +F      +  + ++  IM+ SL QLTG N   YY +T+   +G     +   S+V G
Sbjct: 325 KSMFDLILIPRNRRALLYSIMMVSLGQLTGINAIMYYMSTLMGQIGFSPKQAVAMSMVGG 384

Query: 357 VVNFSSTFISLWSVERFGRRKCLLWGSASMACCF-VVFASMGVTKLYPNGMDQPTSKSAG 415
                 T  ++  +++FGRR    W    +     +V   +G        +D  T+ +A 
Sbjct: 385 AALLIGTIPAILYMDKFGRRP---WSMTIIGFSVGLVLVGVGYQ------IDLNTNLAAA 435

Query: 416 NVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFI 475
             + +   +    F  ++A + +VV +ES+    +   M I  A  ++W F + +    +
Sbjct: 436 EGVYLTGQILYNIFFGTYATLTWVVPSESFSLATRSIGMTICSAFLYLWAFTVTYNFNKM 495

Query: 476 TSAINF---YYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGT 521
             A  +     GF                + ETK  +LEE ++++E  T
Sbjct: 496 KDAFTYTGLTLGFYGGIAIVIGIPYQLLFMPETKDKTLEEIDDIFEMPT 544

>Kwal_55.21289
          Length = 537

 Score = 99.4 bits (246), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 114/504 (22%), Positives = 204/504 (40%), Gaps = 74/504 (14%)

Query: 62  AFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGII 121
           + GG +FG+D G I G +       + G+L   G   L D +  +I     +G   G ++
Sbjct: 52  SIGGLLFGYDTGVIAGVL----LGLKPGDL---GLDILQDHQKEVITGVTGIGSVMGSMV 104

Query: 122 LGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLI 181
             +L +  GR++ L            +  +   ++     GR++ G+ +G  A   P  +
Sbjct: 105 AFKLANCLGRRLTLGLCSVVFTLAAALM-ALALSFRALVAGRLIVGVAIGIAAQCVPLYL 163

Query: 182 SEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLG 241
           SEI+P   RG  ++     ITGG  +     +      NS  WR   G     +L+++  
Sbjct: 164 SEISPSSRRGTILAFNTSAITGGQLLASLIAWAIIDKPNS--WRYLFGASAIPSLLLLFT 221

Query: 242 MMMVPESPRYLIEKGKFEEAKRSL----AKSNKTTVDDPIV--------LREFDVINAGV 289
           +  +PESPR+L+   + + A+ ++     ++++  ++D +         LR++   N  +
Sbjct: 222 LKFIPESPRWLLLTEQPQRAREAIETMYPEASELEINDKLTKMGRDLTKLRKYQDENQPL 281

Query: 290 EAERAIGNASWAELFSTKGKVLQR---------------------------VIMGIMVQS 322
            + R   +  +    S+    L R                           +++G ++  
Sbjct: 282 LSRRPEASRRYNSGSSSDNIALARDFTHSIRSNNRRGLKIKHKLEPRTRRALLVGCLLMF 341

Query: 323 LQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWG 382
            QQ TG N F YY   I   +G+ D  + +I +  VNF+ T +++  V+ +GRR  LL+ 
Sbjct: 342 FQQATGFNAFIYYSPVILLRIGVSDPLLPAIGIAFVNFAFTGVAMKVVDHYGRRTALLYT 401

Query: 383 SASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVA 442
              M    +V  S G+   Y N     +S   G++++  A       +V W  + F+   
Sbjct: 402 VWIMTVGLIV-GSAGLQ--YNN-----SSLFLGSLLVFIAGYAAGIGSVPWMSVEFL--- 450

Query: 443 ESYPQRIKQRAMAIAVAA--NWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXX 500
                 + QR+   +  A  NW  NFA+        S I    G                
Sbjct: 451 -----PLNQRSFGASCIACTNWFTNFAVSIS---FLSMIRIIGGEASMLIFAAMSALGWL 502

Query: 501 XV----CETKGLSLEEFNEMYEEG 520
            V     E KGLSLEE  +++E G
Sbjct: 503 FVYFWYPEVKGLSLEEIGQVFETG 526

>Scas_597.5
          Length = 489

 Score = 98.6 bits (244), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 93/397 (23%), Positives = 177/397 (44%), Gaps = 30/397 (7%)

Query: 99  LSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQ 158
           ++D + G I  +F++G   G  + G+L + YGRK               I   S N+ + 
Sbjct: 79  MTDQQLGAITASFSIGGLVGSFVAGKLAEKYGRKYVSVVNCLIAFLGSFIMFFS-NSVLP 137

Query: 159 YFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSY 218
             +GR + G+  G   V++   I+++AP   RG   ++ QL I  GI +           
Sbjct: 138 MILGRTIVGIAAGVSVVVTSLFINDVAPVDWRGSLGTMNQLSINLGILLTQFAGLKFVRN 197

Query: 219 TNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIV 278
            +  +WR  + +G   A++ ++  + V ESPR+L+ +G    A+++L      +  D  V
Sbjct: 198 EDDGKWRWVMFIGMVLAILNLVLWIRVAESPRWLLAQGDVIGAEKALFLLRIGSYQD--V 255

Query: 279 LREFDV--------INAGVEAERAIGNASWAELFS-TKGKVLQRVIMGIMVQSLQQLTGC 329
            +E            N   EA ++  + S  E F  ++ K  +  I  I+V   QQ  G 
Sbjct: 256 KQEVQTWKNENNNSSNNDTEANQSTRDISLKEYFKESQFKKARTAITAILVG--QQFCGI 313

Query: 330 NYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACC 389
           N   +YG  +   +    + + ++ + ++N   TF+S   +++FGR+  L+  ++ MA  
Sbjct: 314 NSIIFYGVKVISQLLPQHAVLINLGISLLNVIFTFVSSTIIDKFGRKPLLITSTSIMAFS 373

Query: 390 FVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRI 449
             + +   V K +P             +++    L+I  FA+   PI F+++ E   +  
Sbjct: 374 SFIISISIVGK-FP------------IILVSSTYLYIVAFALGVGPIPFLIIGELSNKDD 420

Query: 450 KQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFV 486
           K  A +     NWI  F +G+    ++   N++ G+V
Sbjct: 421 KAVAQSYGTVCNWIATFVVGYTFAVLS---NWFSGYV 454

>KLLA0B14861g complement(1305927..1307690)
           gi|125935|sp|P07921|LACP_KLULA Kluyveromyces lactis
           Lactose permease, start by similarity
          Length = 587

 Score = 99.4 bits (246), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 115/488 (23%), Positives = 203/488 (41%), Gaps = 46/488 (9%)

Query: 51  YFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVR----TGL 106
           Y+ +  LC +      + G+D   +G    +  + +          YY  D+     TGL
Sbjct: 69  YYKLYGLCFITYLCATMQGYDGALMGSIYTEDAYLK----------YYHLDINSSSGTGL 118

Query: 107 IVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNN-------WIQY 159
           +   FN+G   G   +  L D+ GRK  +            I   +T         W   
Sbjct: 119 VFSIFNVGQICGAFFVP-LMDWKGRKPAILIGCLGVVIGAIISSLTTTKSALIGGRWFVA 177

Query: 160 FIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGS-KSY 218
           F   I +          +PT  +E+AP HLRG    LY  + + G  V   + YG+ K++
Sbjct: 178 FFATIANAA--------APTYCAEVAPAHLRGKVAGLYNTLWSVGSIVAAFSTYGTNKNF 229

Query: 219 TNSIQ-WRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSN-KTTVDDP 276
            NS + +++PL L   +  ++ +   ++PESPR+L+  G+ EEA+  + K +       P
Sbjct: 230 PNSSKAFKIPLYLQMMFPGLVCIFGWLIPESPRWLVGVGREEEAREFIIKYHLNGDRTHP 289

Query: 277 IVLREF-DVINA--GVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFF 333
           ++  E  ++I +  G +    +       LF T+     R ++ I++    Q +G N   
Sbjct: 290 LLDMEMAEIIESFHGTDLSNPLEMLDVRSLFRTRSD-RYRAMLVILMAWFGQFSGNNVCS 348

Query: 334 YYGTTIFQAVGMDDSYVTSIVLGV---VNFSSTFISLWSVERFGRRKCLLWGSASMACCF 390
           YY  T+ + VGM    +  ++ GV   V + S+    + +++ GRR+  L GS S A   
Sbjct: 349 YYLPTMLRNVGMKSVSLNVLMNGVYSIVTWISSICGAFFIDKIGRREGFL-GSISGAALA 407

Query: 391 VVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIK 450
           +   S+   +      ++   KSA N  +VF  LF   F+ ++ P+  +   E      +
Sbjct: 408 LTGLSICTAR-----YEKTKKKSASNGALVFIYLFGGIFSFAFTPMQSMYSTEVSTNLTR 462

Query: 451 QRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSL 510
            +A  +    + +  F   F TP     I +++                    ETKG SL
Sbjct: 463 SKAQLLNFVVSGVAQFVNQFATPKAMKNIKYWFYVFYVFFDIFEFIVIYFFFVETKGRSL 522

Query: 511 EEFNEMYE 518
           EE   ++E
Sbjct: 523 EELEVVFE 530

>KLLA0E01782g 171319..173037 weakly similar to ca|CA5798|IPF4181
           Candida albicans putative permease (by homology),
           hypothetical start
          Length = 572

 Score = 97.8 bits (242), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 94/371 (25%), Positives = 160/371 (43%), Gaps = 29/371 (7%)

Query: 162 GRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNS 221
            R+  G+G+G  +   P   +E AP   RG  + L+Q  I  G+ +G   N        +
Sbjct: 204 ARLYLGIGMGLCSSTVPIYTAECAPAVSRGAILMLWQTFIALGVCLGSVFNRAFVEIEGN 263

Query: 222 IQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLRE 281
           + WR+ +G       I  L + + PESPR+LI  G   E+  SL +   T V      R+
Sbjct: 264 LSWRLMIGSSCVAPFITALVVYIPPESPRWLIGNGFVRESLESLIRLRNTEVSGS---RD 320

Query: 282 FDVINAGVEAERAI-GNASW-AELFSTKGKVLQRVIMGIMVQSL--QQLTGCNYFFYYGT 337
           F ++   ++ E  +    SW  E+ S    +  R  + +    +  QQ  G N    Y  
Sbjct: 321 FYILYESLKYEHKLAAKLSWHQEIKSLFSNIRNRFALWVSFLGILGQQYGGVNILVSYTA 380

Query: 338 TIFQAVGMD--DSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWG-SASMACCFVVFA 394
           TI    G+D   +   SI +G   F +TF+S   ++RFGRR  LL       AC F +  
Sbjct: 381 TILTNAGIDPVTAIAGSIGIGGGCFLATFLSSQLIDRFGRRTMLLLTLPVEGACLFWLGG 440

Query: 395 SMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAM 454
            + + +      DQ    +    M V    F+  + +   PI+F +VAE+    ++    
Sbjct: 441 ILNIKE------DQARLAAGLAAMYV----FVLFYGIGIGPISFTLVAETPSITVRMAHS 490

Query: 455 AIAVAANWIWNFAIGFCTPFITSAIN-----FYYGFVXXXXXXXXXXXXXXXVCETKGLS 509
           A A++ NW+ +F +    P +  ++      ++YG                 + ETK  +
Sbjct: 491 AFAMSINWLLDFCLTMTWPKMADSMGTSGGLYFYG----AFNFLIWVLAYFTIPETKRFT 546

Query: 510 LEEFNEMYEEG 520
           LE+ +E+++ G
Sbjct: 547 LEQLDEVFKHG 557

>YGL104C (VPS73) [1880] chr7 complement(308714..310174) Putative
           hexose transporter, class B vacuolar sorting protein
           involved in Prc1p vacuolar trafficking pathway, member
           of the hexose transporter family of the major
           facilitator superfamily (MFS) [1461 bp, 486 aa]
          Length = 486

 Score = 97.1 bits (240), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 94/396 (23%), Positives = 169/396 (42%), Gaps = 34/396 (8%)

Query: 99  LSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQ 158
           L+D + G++   F +G   G      L + YGRK               I I ++N++  
Sbjct: 86  LNDEQIGIVTSVFCIGGILGSYFATSLANIYGRKFSSLINCTLNIVGSLI-IFNSNSYRG 144

Query: 159 YFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSY 218
             IGRI+ G+  G + V+ P  I E+AP    G+  S+ Q+ I  G+ +   T   +   
Sbjct: 145 LIIGRILVGISCGSLIVIIPLFIKEVAPSGWEGLLGSMTQICIRLGVLL---TQGIALPL 201

Query: 219 TNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDP-- 276
           T+S +WR  L   F  A++      +V ESP++L+  G+  +AK SL K    T D+   
Sbjct: 202 TDSYRWRWILFGSFLIAVLNFFMWFIVDESPKWLLAHGRVTDAKLSLCKLRGVTFDEAAQ 261

Query: 277 ------IVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCN 330
                 + +   D +          G+ S  +    +  V  R ++ +++   QQ  G N
Sbjct: 262 EIQDWQLQIESGDPLIEPTTTNSISGSNSLWKYLRDRTNVKSRHVITVLLFG-QQFCGIN 320

Query: 331 YFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMAC-C 389
               YGT I   +    +   +  + +VN   T +    +    R+  L+  +  ++   
Sbjct: 321 SIVLYGTKIISQLYPQHAIRINFFISMVNVLVTILVSLLIHSLPRKPLLMTSTVLVSVTA 380

Query: 390 FVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAE-SYPQR 448
           F++  +M   K+              N++IVF+ +++  F +   P+ F+++ E S PQ 
Sbjct: 381 FIMGIAMNHNKM--------------NLLIVFSFIYMGVFTMGLNPLPFIIMREVSKPQD 426

Query: 449 --IKQRAMAIAVAANWIWNFAIGFCTPFITSAINFY 482
             + QR   I    NW+  F I +  P I   ++ Y
Sbjct: 427 MVLAQRYGTI---CNWVGTFIIAYTFPIIHDVLSGY 459

>YBR298C (MAL31) [475] chr2 complement(802587..804431) Maltose
           permease, a high affinity maltose/H[+] symporter, member
           of the hexose transporter family of the major
           facilitator superfamily (MFS) [1845 bp, 614 aa]
          Length = 614

 Score = 97.1 bits (240), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 93/399 (23%), Positives = 174/399 (43%), Gaps = 19/399 (4%)

Query: 69  GWDIGTIGGFVGQTDFKRRFGELN-DEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGD 127
           G+D   +G F     F++++G LN + G+Y +S      + + +  G   G  + G   D
Sbjct: 114 GYDTAILGAFYALPVFQKKYGSLNSNTGDYEISVSWQIGLCLCYMAGEIVGLQMTGPSVD 173

Query: 128 FYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPK 187
           + G +  L            I +    +     +G+ + G+  G    L+ +  SEI P 
Sbjct: 174 YMGNRYTLIMALFFLAAFIFI-LYFCKSLGMIAVGQALCGMPWGCFQCLTVSYASEICPL 232

Query: 188 HLRGMCISLYQLMIT-GGIFVGYCTNYGSKSYTNS-IQWRMPLGLGFAWALIMVLGMMMV 245
            LR    +   L    G +F           Y NS + +++P  L + W L + +G+   
Sbjct: 233 ALRYYLTTYSNLCWAFGQLFAAGIMKNSQNKYANSELGYKLPFALQWIWPLPLAVGIFFA 292

Query: 246 PESPRYLIEKGKFEEAKRSLAK--SNKTTVDDPIVLREFDVINAGVEAERAIGNASWAEL 303
           PESP +L++KG+ ++A+RSL +  S K    + +V  E D I   +E E+ + +      
Sbjct: 293 PESPWWLVKKGRIDQARRSLERTLSGKGPEKELLVSMELDKIKTTIEKEQKMSDEGTYWD 352

Query: 304 FSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGM--DDSYVTSIVLGVVNFS 361
               G   +R  +  +    Q   G +    Y T  ++  G+  D ++  SI+   +  +
Sbjct: 353 CVKDGINRRRTRIACLCWIGQCSCGAS-LIGYSTYFYEKAGVSTDTAFTFSIIQYCLGIA 411

Query: 362 STFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVF 421
           +TFIS W+ +  GR     +G A  A  F +   +G +  +   M       +G +++V 
Sbjct: 412 ATFISWWASKYCGRFDLYAFGLAFQAIMFFIIGGLGCSDTHGAKM------GSGALLMVV 465

Query: 422 ACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAA 460
           A    F + +  AP+ F +V+E    R++ + + +A  A
Sbjct: 466 A----FFYNLGIAPVVFCLVSEIPSSRLRTKTIILARNA 500

>CAGL0K12716g complement(1260169..1261623) similar to sp|P43562
           Saccharomyces cerevisiae YFL040w, hypothetical start
          Length = 484

 Score = 92.8 bits (229), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 93/423 (21%), Positives = 178/423 (42%), Gaps = 25/423 (5%)

Query: 65  GFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGR 124
           G++ G D+ ++G F+   +F   FG          + +  GL++    LG   G I    
Sbjct: 18  GYLMGMDLSSLGVFLNGDEFLSYFGTP--------TPIEQGLLMGANPLGGLIGSIFYVS 69

Query: 125 LGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEI 184
           L     R                I I     W+   + R + G+ +G +++     I+E+
Sbjct: 70  LAKNCARLYSFRLSTIIWLIGCFIGIFVLEIWM-IAVARFLKGITIGMLSIHITNYINEV 128

Query: 185 APKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMM 244
            P ++RG  ++  Q+  T  IF  +    G  ++ +   +R+  GL F  A+ +++    
Sbjct: 129 FPSNIRGRTLAFVQVGYTFSIFSMHYYCVGLNTFKSHYAFRLAWGLEFIPAVAVIIATFW 188

Query: 245 VPESPRYLIEKGKFEEAKR---SLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWA 301
           +PESP YL+     + +++      K +  + +DP  +   D I+   E E         
Sbjct: 189 IPESPVYLLRNTIPQISQKVDVMKVKHDSDSENDPADIS--DNIDDIFEFECTSRILCIR 246

Query: 302 ELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDS--YVTSIVLGVVN 359
           E+   K +   R++MG ++Q L Q TG N   YY T I +  G+ +    + S V   +N
Sbjct: 247 EILKLKTR--NRLLMGTILQVLVQFTGINVILYYITYICEMAGLKEETKLLVSAVPYFIN 304

Query: 360 FSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVT---KLYPNGMDQP----TSK 412
              +   L  ++   R+   + GSA ++   +  A +  T   ++ P   ++       K
Sbjct: 305 AVLSCFPLLYLDVVPRKLMTVIGSALLSTIMIAIAILMSTTGHEIEPIKGNKSLIWIVPK 364

Query: 413 SAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCT 472
             G  ++    LF+  +A+S A + ++   E  P   + + + I +A  W+ NF I    
Sbjct: 365 VPGLFILCLCFLFVGIYALSIACVPWIYTCELLPVSARAKGLPICMAIGWLMNFCITMTG 424

Query: 473 PFI 475
           P +
Sbjct: 425 PLL 427

>Scas_105.1
          Length = 56

 Score = 82.8 bits (203), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/55 (61%), Positives = 40/55 (72%)

Query: 504 ETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIFSK 558
           ETKGLSLEE N M+EEG LPWKS  W+P SRRGADYD  A   DD+  F+++  K
Sbjct: 2   ETKGLSLEEVNTMWEEGVLPWKSSEWVPPSRRGADYDAAAMATDDKPLFKRMLGK 56

>Kwal_27.10664
          Length = 653

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 91/379 (24%), Positives = 162/379 (42%), Gaps = 34/379 (8%)

Query: 156 WIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNY-- 213
           W   F  R + GLG+G  +      ++E + K LRG+    +Q     GI  GY  +   
Sbjct: 231 WHYLFAMRFLLGLGIGPKSATVSVYLAECSTKKLRGIICMNWQTFTAFGIMWGYVFSLIF 290

Query: 214 ---GSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNK 270
              GS + +  + WR+ L      A+ ++  +   PESPR+L+ KG++ EA  S  +   
Sbjct: 291 YRVGSGAVSGGLNWRLTLASAMIPAIFVLFQIPYCPESPRWLMGKGRYLEAYESTVQIRP 350

Query: 271 TTVDDPIVLREFDVINAGVEAERAIGNASW---AELFSTKGKVLQRVIMGIMVQSLQQLT 327
             +   +  R+    +  +  E ++    +    E+F+ + +     I   +   +QQ  
Sbjct: 351 HRI---LACRDLFYQHVLLMEEESLEKPYFKRLGEVFTVR-RNRNAFIAAFICAFMQQFC 406

Query: 328 GCNYFFYYGTTIFQAVGMDD--SYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSAS 385
             N   YY + IF   G  +  S   S+  G+VNF     + + ++RFGRR  LL    +
Sbjct: 407 AINVIAYYSSAIFLQSGFSEISSLCASLGFGLVNFFFAIPAFFMIDRFGRRFLLLSTFPA 466

Query: 386 MACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESY 445
           MA    +    G     P+   +    S G  + +F+ ++ F   V    + FVV  E +
Sbjct: 467 MAVFLFI---TGFAFWIPDQQTRIGIVSMG--IYIFSAIYSFGCGV----VPFVVAGEVF 517

Query: 446 PQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAIN------FYYGFVXXXXXXXXXXXXX 499
           P  ++    ++     W +NF +    P + SA++      FY G+              
Sbjct: 518 PLYVRAIGASLFTIILWGFNFILSLTWPRMLSALHPQGAFGFYAGW-----NVVGWFLVY 572

Query: 500 XXVCETKGLSLEEFNEMYE 518
             + ETK L+LEE +E+++
Sbjct: 573 FLLPETKQLTLEELDEVFD 591

>YFL040W (YFL040W) [1643] chr6 (51350..52972) Putative hexose
           transporter, member of the hexose transport family of
           the major facilitator superfamily (MFS) [1623 bp, 540
           aa]
          Length = 540

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 107/501 (21%), Positives = 207/501 (41%), Gaps = 48/501 (9%)

Query: 48  ISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLI 107
           I+  + V  +  ++   GFI G ++ ++  F+    F   F         Y + ++ GL+
Sbjct: 19  ITKTYEVTKITAILTLVGFIMGLEVPSLATFLTNKTFNEYFK--------YPTPLQQGLL 70

Query: 108 VVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNW--IQYFIGRIV 165
           + +  LG   G  I   + D + R   +            + + +   W  +   I R++
Sbjct: 71  MGSTPLGGIMGCFICCIMNDRFSR---IYQFQSGIIIWNIVTLLNFCIWDILGLLICRMI 127

Query: 166 SGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWR 225
            G+ +G  ++L  +  +E+ P+  RG  +S  QL +T GI V +        + +   +R
Sbjct: 128 KGMILGNFSILVASYANEVIPRGKRGSTMSYIQLCLTIGILVMHYLCIALSLWDSHFAFR 187

Query: 226 MPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEA---KRSLAKS-NKTTVDDPIVLRE 281
           +   +G    L+  +    +PES  +L+  GK  EA   + +LAK  N++   D +   E
Sbjct: 188 IAWCIGIIPGLLFWMASYALPESYHWLVLHGKMSEAQEIQHNLAKKFNESQPRDAV--PE 245

Query: 282 FDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQ 341
              I    +    + +  +++    +G   + +I+G+ +Q L Q +G N    Y T I +
Sbjct: 246 MSKIELAGDFWIGVNDLDFSKKLP-RGS-FKPLILGMTLQLLVQFSGINIILGYITYICE 303

Query: 342 AVGMDDS--YVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVT 399
            VG++ +    TS +   +N   + + +  ++   R+   L G   ++   +   ++ V 
Sbjct: 304 IVGLEGNVKLFTSSIPYFINMVLSLLPITFIDYTSRKLITLLGGFPISGLLITIGALFVK 363

Query: 400 KLYPNGMDQPTSKSAGNVMIVFA--------------CLFIF-CFAVSWAPIAFVVVAES 444
                   Q T    GN  +V++              C  I   FA+S + I +V   E 
Sbjct: 364 ------YGQDTKPIDGNRSLVWSIGENPFVGGWILTLCFLIVGIFAMSLSSIPWVYTNEM 417

Query: 445 YPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCE 504
            P R+K +  AI V   W+ NF + F  P +   +      +                 E
Sbjct: 418 LPSRVKVKGFAICVTFGWLGNFILTFLCPVMIERLKGTTFIIFGSLTFLISLSVLIWFPE 477

Query: 505 TKGLSLEEFNEMYE----EGT 521
           TKG+S+E+ ++ +E    EGT
Sbjct: 478 TKGMSIEDIDKFFEFESKEGT 498

>KLLA0D05379g complement(464200..465690) weakly similar to sp|P43562
           Saccharomyces cerevisiae YFL040w, start by similarity
          Length = 496

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 104/484 (21%), Positives = 203/484 (41%), Gaps = 39/484 (8%)

Query: 65  GFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGR 124
           GF+ G D  ++  F+G + FK  F +         + ++TG++     +G   G ++ G 
Sbjct: 18  GFMLGMDTSSLSLFLGTSYFKEYFKQP--------TALQTGMMTGANQIGGFVGCLMSGS 69

Query: 125 LGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEI 184
           L +  G K  L                    +    + R V G+ VG ++VL+   + E+
Sbjct: 70  LIELIGCKWCLCACSVIWTMGSVGSFFVLEVYTMA-LSRFVKGIAVGILSVLASFYLMEV 128

Query: 185 APKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMM 244
              ++RG   +L Q+ +T  I   Y  +         + +++  GL    +L++++    
Sbjct: 129 FSSNIRGQATALMQMALTISILSIYFLSMLLDKIQGPLAFKITWGLEVIPSLLLLMLFQA 188

Query: 245 VPESPRYLIEKG-KFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAEL 303
           +PESPR+L + G   ++  RSLA      V+    LRE  V     + + +         
Sbjct: 189 LPESPRWLYKHGYSNKDIDRSLAILRVKDVEK---LREKFVSETKQKPKLS--------- 236

Query: 304 FSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLG--VVNFS 361
           +  K    + + +GI+VQ L Q++G N   YY   I + VG DD   + +  G  +VN  
Sbjct: 237 YIIKKGYWKHMSLGIIVQILIQISGINVVMYYTIYICEMVGFDDDVSSKLTAGPYIVNTI 296

Query: 362 STFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNV---- 417
            T + ++ +++F R+  + W S        VF  +G   L    +     +  G+V    
Sbjct: 297 FTLVPVFLLDKFNRKVFIGWAS--------VF--LGGIMLLIGFLIGERERHVGDVVLRN 346

Query: 418 MIVFACLFIFCFAVSWAPIA-FVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFIT 476
           ++V  C        S    A F+   E  P+ IK  A+++ ++ +W   FA+    P++ 
Sbjct: 347 IVVALCFLFVSVFSSSLSCAGFIYTNEILPESIKSVALSVCISTSWFTGFALALMAPYLM 406

Query: 477 SAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRG 536
             + ++   +                 ET+ LS  + + ++++  L  + +     S + 
Sbjct: 407 QIVEWWTFVMLGTSTIALAFIIIMWFPETRDLSPHDIDNLFKQDALSAEVEYEKIESDQS 466

Query: 537 ADYD 540
           AD++
Sbjct: 467 ADFE 470

>Scas_716.72
          Length = 544

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 106/505 (20%), Positives = 209/505 (41%), Gaps = 53/505 (10%)

Query: 52  FTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELND--EGEYYLSDVRTGLIVV 109
           + ++ + +++ F  FI G +I ++  F+    F + F   +   +G    S    GL+  
Sbjct: 9   YHLVVIGVILLFPSFIMGMEITSLAVFLNSDHFIKYFNHPSPFLQGILMSSSTLGGLV-- 66

Query: 110 TFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLG 169
               GC      + ++G   G +I              +Q     +     I RI+ G+ 
Sbjct: 67  ----GCISYSATVVKVGRITGFQIATLLWFIGGVVATLVQ-----HISMIIIARIIKGVT 117

Query: 170 VGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIF-VGYCTNYGSKSYTNSIQWRMPL 228
           +G  +VL P  I EI P   RG  I++ QL  T  I  V Y + + +  + N   +RM  
Sbjct: 118 MGWFSVLIPAYIGEIYPSQWRGRMIAMTQLSYTIAILLVHYLSIWFNHVWKNHWSFRMVW 177

Query: 229 GLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKR----------------------SLA 266
           GL    +L+   G + +PE+P++L   G++ +A++                       + 
Sbjct: 178 GLEIIPSLLFFWGSVWLPETPQWLTLHGEYTKAQKIQNNLAIKFNSRFGSTSNHSSKDIV 237

Query: 267 KSNKTTVDDPIVLREFDVINAGVEAERAIGNAS----WAELFSTKGKVL-QRVIMGIMVQ 321
            SN+   ++    R    I   ++     G+ S    + ELF   GK   ++  +G+ +Q
Sbjct: 238 TSNEDAAEEDDQQRAKMEIMDKLDLANLYGDGSNDLKYKELF---GKSYWKQTAIGVTLQ 294

Query: 322 SLQQLTGCNYFFYYGTTIFQAVGMD--DSYVTSIVLGVVNFSSTFISLWSVERFGRRKCL 379
            L Q +G N   +Y T I + +G++   +Y  S +   +N   + I +  ++   R+K  
Sbjct: 295 LLVQFSGINILMFYITYICEMLGLNGNTNYFASSIPYFINMILSLIPICFIDSVNRKKMT 354

Query: 380 LWGSASMACCFVVFASMGVT---KLYP-NGMDQP---TSKSAGNVMIVFACLFIFCFAVS 432
           L GS  ++   V   ++      K+ P NG +        S+G  ++    LF+  F+++
Sbjct: 355 LAGSFPVSIIMVAIGTIMALNGRKVAPVNGNESIIWFVDDSSGGWILALCFLFVGVFSLT 414

Query: 433 WAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVXXXXXX 492
            +    +   E +P + K + +A ++  +W  NF +    P +   + +    +      
Sbjct: 415 LSCFPLLYTNEIFPTKAKPKGLAFSMFISWTSNFTLTLLAPLMLEYLKWGTFILLGGLTF 474

Query: 493 XXXXXXXXXVCETKGLSLEEFNEMY 517
                      +T GLS++E N ++
Sbjct: 475 VLSVCIAIFFPDTSGLSVQEINHLF 499

>Kwal_27.12811
          Length = 181

 Score = 83.6 bits (205), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 86/172 (50%), Gaps = 6/172 (3%)

Query: 59  LMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFG 118
           L +AFG  +FG++ GTI G +     K++F      G +   +  T LI    + G   G
Sbjct: 16  LFVAFGDILFGYNTGTISGMLAMDYVKQQF---TSRGHFTADE--TSLITEILSAGTFCG 70

Query: 119 GIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSP 178
            I+     D  G ++GL            +Q+++T   +    GR+++G GVG ++ + P
Sbjct: 71  AILAPLASDTIGHRLGLILSTIIFTFGVILQVAATGQDL-LIAGRVIAGAGVGVLSAIVP 129

Query: 179 TLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGL 230
              SE +PK +RG  +S YQ  IT G+ +  C N G+ +  +S  +R+PL L
Sbjct: 130 LYQSEASPKWIRGAVVSCYQWAITIGLLLAACVNQGTHARQDSGSYRIPLAL 181

>KLLA0E06743g complement(612941..614944) similar to
           ca|CA5798|IPF4181 Candida albicans putative permease (by
           homology), start by similarity
          Length = 667

 Score = 87.0 bits (214), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 93/411 (22%), Positives = 169/411 (41%), Gaps = 33/411 (8%)

Query: 125 LGDFYGRKIGLXXXXXXXXXXXXIQI---SSTNNWIQYFIGRIVSGLGVGGIAVLSPTLI 181
           L + +GRK  +            +Q    + T  W   F  R + G G+G  +  +   +
Sbjct: 212 LNNMFGRKKVIFITCAISAITCFLQAFGPAGTPGWHYLFAMRFLLGFGIGPKSATTSVYL 271

Query: 182 SEIAPKHLRGMCISLYQLMITGGIFVGYCTNY-----GSKSYTNSIQWRMPLGLGFAWAL 236
           +E + K LRG+    +Q     GI  GY  +      G       + WR+ L      A+
Sbjct: 272 AECSTKKLRGIICMNWQTFTAFGIMWGYVFSLIFYRVGRAGIAGGLNWRLMLASAMIPAI 331

Query: 237 IMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIG 296
           ++++ +   PESPR+L+ KG+++EA  S  +     +   +  R+    +  +  E ++ 
Sbjct: 332 LVLVQIPFCPESPRWLMGKGRYKEAYESTLQIRNHKI---LACRDLFYQHVLLMEENSLE 388

Query: 297 NASWA---ELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDD--SYVT 351
            + W    E+F+ + +    +I   +   +QQ    N   YY + IF   G  +  S   
Sbjct: 389 MSYWTRLREIFTVR-RNRNALICAFICAFMQQFCAINVIAYYSSAIFLQSGFTEISSLCA 447

Query: 352 SIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTS 411
           S+  G++NF     + + ++RFGRR  LL         F   A   +   +   +D  T 
Sbjct: 448 SLGFGLINFFFAIPAFFMIDRFGRRFLLL-------NTFPWLAVFLLITGFSFWIDD-TE 499

Query: 412 KSAGNV---MIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAI 468
           K  G V   + VF+ ++ F   V    + FV+  E +P  ++    ++     W +NF +
Sbjct: 500 KRIGVVSMGIYVFSAIYSFGCGV----VPFVIAGEVFPLYVRAIGASLFTIVLWGFNFIL 555

Query: 469 GFCTPFITSAINFYYGF-VXXXXXXXXXXXXXXXVCETKGLSLEEFNEMYE 518
               P +  A      F                 + ETK L+LEE +E+++
Sbjct: 556 SLTWPSMLRAFEPQGAFGFYAAWNVIGWFLVYFFMPETKQLTLEELDEVFD 606

>YIL171W (HXT12) [2507] chr9 (19515..19844) Member of the hexose
          transporter family of the major facilitator superfamily
          (MFS) [330 bp, 109 aa]
          Length = 109

 Score = 77.4 bits (189), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 34/45 (75%), Positives = 37/45 (82%)

Query: 46 KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGE 90
          KP+SAY TV  LCLMIAFGGFIFGWD GTI GFV  +DF RRFG+
Sbjct: 53 KPLSAYTTVAILCLMIAFGGFIFGWDTGTISGFVNLSDFIRRFGQ 97

>YGR289C (MAL11) [2234] chr7 complement(1073968..1075818) Maltose
           permease, a general alpha-glucoside permease, member of
           the hexose transporter family of the major facilitator
           superfamily (MFS) [1851 bp, 616 aa]
          Length = 616

 Score = 80.9 bits (198), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 83/332 (25%), Positives = 140/332 (42%), Gaps = 11/332 (3%)

Query: 69  GWDIGTIGGFVGQTDFKRRFGELNDEGEYYL-SDVRTGLIVVTFNLGCAFGGIILGRLGD 127
           G+D   +        F+R+FG LN EG Y + S  + GL +     G   G  I   + +
Sbjct: 121 GYDTALLSALYALPVFQRKFGTLNGEGSYEITSQWQIGLNMCVL-CGEMIGLQITTYMVE 179

Query: 128 FYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPK 187
           F G +  +            I +    +     +G+I+S +  G    L+ T  SE+ P 
Sbjct: 180 FMGNRYTMITALGLLTAYIFI-LYYCKSLAMIAVGQILSAIPWGCFQSLAVTYASEVCPL 238

Query: 188 HLRGMCISLYQLM-ITGGIFVGYCTNYGSKSYTNS-IQWRMPLGLGFAWALIMVLGMMMV 245
            LR    S   +  + G IF         ++  NS + +++P  L + W   +++G+   
Sbjct: 239 ALRYYMTSYSNICWLFGQIFASGIMKNSQENLGNSDLGYKLPFALQWIWPAPLMIGIFFA 298

Query: 246 PESPRYLIEKGKFEEAKRSLAK--SNKTTVDDPIVLREFDVINAGVEAERAIGNASWAEL 303
           PESP +L+ K +  EA++SL++  S K    D  V      I   +E ER + + S +  
Sbjct: 299 PESPWWLVRKDRVAEARKSLSRILSGKGAEKDIQVDLTLKQIELTIEKERLLASKSGSFF 358

Query: 304 FSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGM--DDSYVTSIVLGVVNFS 361
              KG   +R  +  +    Q  +G      Y T  F+  GM  D ++  S++   +  +
Sbjct: 359 NCFKGVNGRRTRLACLTWVAQNSSGA-VLLGYSTYFFERAGMATDKAFTFSLIQYCLGLA 417

Query: 362 STFISLWSVERFGRRKCLLWGSA-SMACCFVV 392
            T  S     R GR   L +G A  M C F++
Sbjct: 418 GTLCSWVISGRVGRWTILTYGLAFQMVCLFII 449

>AGL277W [4035] [Homologous to NOHBY] complement(185070..187085)
           [2016 bp, 671 aa]
          Length = 671

 Score = 77.8 bits (190), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 92/418 (22%), Positives = 168/418 (40%), Gaps = 45/418 (10%)

Query: 156 WIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNY-- 213
           W   F  R + G G+G  +      ++E APK LRG+    +Q     G+  GY  +   
Sbjct: 252 WRYLFAMRFLLGFGLGIKSATVNVYLAECAPKELRGIVCMNWQAFTAFGVMWGYVASLVF 311

Query: 214 ---GSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNK 270
              G       + WR+ L      A+ ++  +   PESPR+L+ KG++ EA  +L +  K
Sbjct: 312 YRVGDAGIGGGLNWRLMLASAALPAVFVLFQLPHCPESPRWLMGKGRYPEAYAALLQLRK 371

Query: 271 TTVDDPIVLREFDVINAGVEAERAIGNASWA---ELFSTKGKVLQRVIMGIMVQSLQQLT 327
             +   +  R+    +  +  E  +  + +    E+F+ + +     +   +   +QQ  
Sbjct: 372 HRL---LACRDLFYQHVLLVQESTLQLSYFTRLKEIFTVR-RNRNAFVAAFICAFMQQFC 427

Query: 328 GCNYFFYYGTTIFQAVGMDD--SYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSAS 385
             N   YY + IF   G  +  S  +S+  G++N      + + ++RFGRR  LL   ++
Sbjct: 428 AINVIAYYSSVIFLQAGFSEIASLCSSLGFGIINTVFAIPAYFMIDRFGRRFLLL---ST 484

Query: 386 MACCFVVFASMGVTKLYPNGMDQPTSKSAGNV---MIVFACLFIFCFAVSWAPIAFVVVA 442
           +    V     G      +     T  S G +   + +F+ ++ F   V    + FV   
Sbjct: 485 LPWLGVFLLVTGFAFWIKD-----TKASIGVISFGIYIFSAIYSFGMGV----VPFVYAG 535

Query: 443 ESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGF-VXXXXXXXXXXXXXXX 501
           E +P  ++    ++     W +NF +    P +  A+     F                 
Sbjct: 536 EVFPLYVRAIGSSLFAVVLWGFNFILALTWPSMLRAMKPQGAFGFYAAWNFIGYFLVYFF 595

Query: 502 VCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIFSKK 559
           + ETK L+LEE +E++            +P  +R ADY +     D Q   + +  KK
Sbjct: 596 LPETKQLTLEELDEVFS-----------VPLMKR-ADYYLSQMWPDFQ---ETVLRKK 638

>Sklu_2375.1 YGR289C, Contig c2375 1376-3217 reverse complement
          Length = 613

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 97/453 (21%), Positives = 188/453 (41%), Gaps = 40/453 (8%)

Query: 47  PISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELND-EGEYYLSDV-RT 104
           P +A+++V+    +I     + G+D   +        F ++FG  N   G Y +S   +T
Sbjct: 92  PKAAFWSVVLSSALI-----MEGYDTALLASLYALPAFAKKFGSFNAASGIYEISAAWQT 146

Query: 105 GLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRI 164
           GL +  F +G   G  + G   D  G +  L            +   + +  +   +G I
Sbjct: 147 GLSMCIF-VGEIIGLQLAGVAADRVGYRWTLITSLLALFCFIFVLFFAPSCAV-LAVGEI 204

Query: 165 VSGLGVGGIAVLSPTLISEIAPKHLR-------GMCISLYQLMITGGIFVGYCTNYGSKS 217
           + G+  G    L+ +  +E+ P  LR        +C  + Q+M +G +      N     
Sbjct: 205 LCGIPWGCFQTLTVSYATEVCPLVLRYYLTTYVNICWVIGQIMASGVL-----KNSQENL 259

Query: 218 YTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAK---SNKTTVD 274
             +++ +++P  L + W   + LG+   PESP +L++K + +EA+RSL +     + T  
Sbjct: 260 ADSALAYKLPFALQWIWPFPIALGIYFAPESPWWLVKKNRLKEAERSLKRLITGIEATEK 319

Query: 275 DPIVLREFDVINAGVEAERAI-GNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFF 333
           D +V      +    E E  +  N ++ + F  KG   +R  +  +V   Q   G     
Sbjct: 320 DIVVDAMIKKMKLTTEKEDMMTKNVTYWDCF--KGVDGRRTRIASLVWIAQNACGST-LM 376

Query: 334 YYGTTIFQAVGMDDSYV--TSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFV 391
            Y T  +Q  G+ DS+    SI+   + F  TF S +  +R+GR      G         
Sbjct: 377 GYSTYFYQKAGLSDSFAFNFSIIQYCLGFVGTFSSWFFSKRYGRFTIFTTGLGLQTLLLF 436

Query: 392 VFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQ 451
           V   +G +        +  S + G++M+     F+F + V   P+ + +  E    +++ 
Sbjct: 437 VIGGLGFSD------SKNASWAIGSLMMA----FVFVYDVGVGPVTYCIFPEEPSTKLRT 486

Query: 452 RAMAIAVAANWIWNFAIGFCTPFITSAINFYYG 484
           + + +A     I        TP++ ++  + +G
Sbjct: 487 KTVIVARNFYNIMGIINSIWTPYMLNSTEWNWG 519

>Scas_652.12
          Length = 478

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 96/469 (20%), Positives = 187/469 (39%), Gaps = 62/469 (13%)

Query: 71  DIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYG 130
           D+  +  ++G++ FK+    L+DE        + G+    F LG   G   +G + + YG
Sbjct: 47  DVPYVETWLGKSGFKQCI-PLDDE--------QIGITNAIFCLGGIVGSFFVGTICNMYG 97

Query: 131 RKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLR 190
           R+I +            + I S N++     GR+++G+  G   ++ P  I E+ P H +
Sbjct: 98  RRI-ISLFNCLLSLIGALIIFSGNSFSTLLWGRLLTGVACGATLIVGPLFIKEVTPPHWK 156

Query: 191 GMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPR 250
           G      Q+MI  GI +   T        +S +WR     G   AL+ ++  + + +SP+
Sbjct: 157 GFLNVTNQVMIKVGILL---TQLIGIVLNDSYRWRWIFFCGAIAALVNLVLWLEIDDSPK 213

Query: 251 YLIEKGK---------------FEEA-------KRSLAKSNKTTVDDPIVLREFDVINAG 288
           +L  +G                ++EA       +R + + N     +P  + E++V+   
Sbjct: 214 WLFSRGDTLGAEMALFNLRGGLYQEAQEEVQTWQREVEQQNSLANVEP--MGEYNVMMGP 271

Query: 289 VEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDS 348
               + I      EL+    +++  ++MG      QQ  G +   +YG  +   V    S
Sbjct: 272 SSFWQYIHK----ELYWRPRQIITILLMG------QQFCGISSIVFYGVKVIDQVDPKHS 321

Query: 349 YVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQ 408
              + ++ +     T I+   V    R+  LL  S+ +        ++G+          
Sbjct: 322 LEINFLIQLTTVFVTIITCIMVPVMNRKPLLL-ISSVLVVVSSFLLTIGI---------- 370

Query: 409 PTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAI 468
             +++ G ++ V   ++I  FA+   P+ ++++ E      ++ A       NW     I
Sbjct: 371 --NRNDGTLLAVAVFIYIIGFAIGLGPLPYLIMKEISTPPDQKMAQKYGTVCNWTATMII 428

Query: 469 GFCTPFITSAINFYYGFVXXXXXXXXXXXXXXXVCETKGLSLEEFNEMY 517
           G+  P +   +N Y  FV               V ET+  +   F EM+
Sbjct: 429 GYIFPLLFDIMNGYAYFVFTIVAILLTYYIFSSVPETR--NSRNFVEMW 475

>Kwal_27.11079
          Length = 613

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 104/497 (20%), Positives = 191/497 (38%), Gaps = 52/497 (10%)

Query: 47  PISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVR-TG 105
           P +A ++V+    +I     + G+D   +        F RRFG  N+    Y    R   
Sbjct: 97  PKAALWSVVLSSALI-----MEGYDTSLLSSLYALPAFARRFGSYNEVSGIYEVPARWQT 151

Query: 106 LIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIV 165
            + +  N+G   G    G   D  G +  L            I   +T   +    G I+
Sbjct: 152 ALSMCVNVGEIIGLQFAGIAADHLGYRRTLIASLLAVFAFIFILFFATGCPM-LAAGEIL 210

Query: 166 SGLGVGGIAVLSPTLISEIAPKHLR-------GMCISLYQLMITGGIFVGYCTNYGSKSY 218
            G+  G    L+    +E+ P  LR        +C  L Q+M  G +      N      
Sbjct: 211 CGIPWGCFQTLTVAYATEVCPLALRYYLTTFVNVCWILGQIMAAGVL-----KNSQENLA 265

Query: 219 TNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAK-------SNKT 271
            + + +R+P  L + W L + LG+ + PESP +L++K +  +A  SL++       + K 
Sbjct: 266 DSPLAYRIPFALQWVWPLPIALGIYLAPESPWWLVKKERMADAAHSLSRLISGLPPAEKA 325

Query: 272 TVDDPIVLREFDVINAGVEAERAI-GNASWAE-LFSTKGKVLQRVIMGIMVQSLQQLTGC 329
           TV   ++ R    I    + E  +  NAS+ + L  + G+   R  +  +    Q   G 
Sbjct: 326 TVIGTMLKR----IQLTTQKEDILTKNASYRDCLIGSDGR---RTRIASLTWVTQNACGV 378

Query: 330 NYFFYYGTTIFQAVGMDDSY--VTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMA 387
                Y T  +   G+ +SY    SI+        T +S +  + +GR +    G A   
Sbjct: 379 A-MMTYSTYFYTKAGLSESYAFTFSIIQYCFGLIGTILSWFISKHYGRYEIFARGLALQT 437

Query: 388 CCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQ 447
              ++  + G +           SK+A  V      +F+F + V   P+ + +V E    
Sbjct: 438 LLLIIIGASGFSD----------SKNAKWVAGTLLLVFVFVYDVGVGPVTYCLVPEIPSN 487

Query: 448 RIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYY----GFVXXXXXXXXXXXXXXXVC 503
           +++ + + +A     I        TP++ ++  + +    G                 + 
Sbjct: 488 KLRTKTVILARNCYNIMGIVNAIWTPYMLNSDQWNWGAKTGLFWGAISLVMLIWAYYELP 547

Query: 504 ETKGLSLEEFNEMYEEG 520
           ETKG +  E +E++ +G
Sbjct: 548 ETKGRTFGEIDELFSQG 564

>KLLA0C19481g 1747623..1748795 similar to ca|CA3241|IPF7493 Candida
           albicans putative permease (by homology), hypothetical
           start
          Length = 390

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 85/336 (25%), Positives = 141/336 (41%), Gaps = 23/336 (6%)

Query: 207 VGYCTNYGSK---SYTNSIQWRMPLGLGFAWA-LIMVLGMMMVPESPRYLIEKGKFEEAK 262
           + Y  NYG+    S T+ +QW  P  +    A LI+V   +   ESPR+L++ GK ++A 
Sbjct: 2   LAYFANYGTALHVSNTSRLQWVAPTSIKIVLAGLILVGSFIWCIESPRWLMKMGKDDKAI 61

Query: 263 RSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNAS-----WAELFSTKGKVLQRVIMG 317
            +LAK    +   P +  E   I   +  E+   + +       E+   K    +  ++ 
Sbjct: 62  INLAKLRNLSETHPFIAGEVADIRYQIIQEKETMSGTGYLDMVKEIIFVKSVRYRFFVIA 121

Query: 318 IMVQSLQQLTGCNYFFYYGTTIFQAVGMD--DSYVTSIVLGVVNFSSTFIS-LWSVERFG 374
            +VQ L Q +G N    Y   +   VG+   D    + VLGVV F S +IS  + ++  G
Sbjct: 122 CLVQILGQWSGANAITIYAPELLSLVGVKGVDKLKMTAVLGVVKFVSAYISAFFFIDFLG 181

Query: 375 RRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNV-MIVFACLFI--FCFAV 431
           R+K    G +      + FA            D   +KS  +      A LF+    + +
Sbjct: 182 RKKAAYIGISIQLLTLLYFALFLTIVPQATESDAILTKSQFHASQAAIAALFLSGTGWTM 241

Query: 432 SWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTP-FITSAINF--YYGFVXX 488
            +  I +++ AE +P +I+  A +  +  ++   F      P  + S  NF  +Y FV  
Sbjct: 242 GFNSIQYLLSAEVFPIKIRSFAQSCIMLLHFSNQFGNSKAVPKMLLSMNNFGAFYFFV-- 299

Query: 489 XXXXXXXXXXXXXVCETKGLSLEEFNEMYEEGTLPW 524
                        V E  G SLE   E++   +LPW
Sbjct: 300 GVLFISLLWVHFFVPEITGRSLESMEELF---SLPW 332

>CAGL0B02475g 236029..237771 highly similar to sp|P25297
           Saccharomyces cerevisiae YML123c PHO84, start by
           similarity
          Length = 580

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 90/405 (22%), Positives = 156/405 (38%), Gaps = 77/405 (19%)

Query: 106 LIVVTFNLGCAFGGIILGRLGDFYGRK----IGLXXXXXXXXXXXXIQISSTNNWIQYFI 161
           L+ V+ ++G   G +  G + D  GRK    + L            I  S   N+     
Sbjct: 107 LLKVSTSVGTVIGQLGFGTMADIVGRKKIYGLELIVMIATTILQTTIGRSPGINFPAVLT 166

Query: 162 -GRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQL-----MITGGI--FVGYCTNY 213
             RIV G+G+GG   LS  + SE A    RG  +           I GG+   +      
Sbjct: 167 FYRIVMGIGIGGDYPLSSIITSEFATTKWRGAIMGAVFANQAWGQIAGGLVALIVIRAYK 226

Query: 214 GSKSYTNS-------------IQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEE 260
           G   Y NS               WR+ +G G    +I +   + +PESPRY ++  +  +
Sbjct: 227 GDLIYANSGAECDYACQKACDQMWRILIGFGAVPGIIGLYFRLTIPESPRYALDVKEEVD 286

Query: 261 AKRSLAKSNKTTVDDPI--VLREFDVINAGVEAERAIGNASWAELFSTKGK-VLQRVIMG 317
              ++ K   T  D+ +  + R   V+  G+        ASW +  S  GK    ++++G
Sbjct: 287 LPSNIEKVRATADDEHLEDLERSSTVVEDGIVVPPP-KKASWKDFRSHFGKWKYGKILLG 345

Query: 318 IMVQSLQQLTGCNYFF----YYGTT-----IFQAVG----------MDDSYVTSIVLGVV 358
                    T  ++F     +YG +     I Q +G          +DDS V +++L   
Sbjct: 346 ---------TAGSWFVLDVAFYGLSLNTAIILQTIGYAGSKNVYHKLDDSAVGNLILICA 396

Query: 359 -NFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNV 417
            +    + ++++V+  GR+   + G   +   F V       K+  +G+           
Sbjct: 397 GSLPGYWATVFTVDTIGRKPIQMMGFIILTALFCVIG-FAYHKISDHGL----------- 444

Query: 418 MIVFACLFIFC-FAVSWAP--IAFVVVAESYPQRIKQRAMAIAVA 459
                 L++ C F  ++ P    F+V  E +P R +  A  I+ A
Sbjct: 445 ----LALYVICQFFQNFGPNVTTFIVPGEVFPTRYRSTAHGISAA 485

>YML123C (PHO84) [3849] chr13 complement(24038..25801) High-affinity
           inorganic phosphate/H+ symporter, member of the
           phosphate:H[+] symporter (PHS) family of the major
           facilitator superfamily (MFS) [1764 bp, 587 aa]
          Length = 587

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 91/410 (22%), Positives = 159/410 (38%), Gaps = 80/410 (19%)

Query: 106 LIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIG--- 162
           L+ V+ ++G   G    G L D  GRK               +Q +  ++    F+    
Sbjct: 106 LLKVSTSVGTVIGQFGFGTLADIVGRKRIYGMELIIMIVCTILQTTVAHSPAINFVAVLT 165

Query: 163 --RIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQL-----MITGGI--FVGYCTNY 213
             RIV G+G+GG   LS  + SE A    RG  +           I+GGI   +      
Sbjct: 166 FYRIVMGIGIGGDYPLSSIITSEFATTKWRGAIMGAVFANQAWGQISGGIIALILVAAYK 225

Query: 214 GSKSYTNS-------------IQWRMPLGLGFAWALIMVLGMMMVPESPRYLIE-KGKFE 259
           G   Y NS               WR+ +GLG    L  +   + +PESPRY ++   K E
Sbjct: 226 GELEYANSGAECDARCQKACDQMWRILIGLGTVLGLACLYFRLTIPESPRYQLDVNAKLE 285

Query: 260 EA----KRSLAKSNKTTVDDPIVLREFDVINAGVEA-ERAIGNASWAELFSTKGK-VLQR 313
            A    ++   K    T D+ + +   +  +  VE+ +     AS+ +     G+    +
Sbjct: 286 LAAAAQEQDGEKKIHDTSDEDMAINGLERASTAVESLDNHPPKASFKDFCRHFGQWKYGK 345

Query: 314 VIMGIMVQSLQQLTGCNYFF----YYGTT-----IFQAVG----------MDDSYVTSIV 354
           +++G         T  ++F     +YG +     I Q +G          + D+ V +++
Sbjct: 346 ILLG---------TAGSWFTLDVAFYGLSLNSAVILQTIGYAGSKNVYKKLYDTAVGNLI 396

Query: 355 LGVV-NFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKS 413
           L    +    ++S+++V+  GR+   L G   +   F V       KL  +G+       
Sbjct: 397 LICAGSLPGYWVSVFTVDIIGRKPIQLAGFIILTALFCVIG-FAYHKLGDHGL------- 448

Query: 414 AGNVMIVFACLFIFC-FAVSWAP--IAFVVVAESYPQRIKQRAMAIAVAA 460
                     L++ C F  ++ P    F+V  E +P R +  A  I+ A+
Sbjct: 449 --------LALYVICQFFQNFGPNTTTFIVPGECFPTRYRSTAHGISAAS 490

>Kwal_27.11385
          Length = 222

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 91/209 (43%), Gaps = 13/209 (6%)

Query: 319 MVQSLQQLTGCNYFFYYGTTIFQAVGMDD--SYVTSIVLGVVNFSSTFISLWSVERFGRR 376
           M+ SL QLTG N   YY +T+   +G     S   S+V G      T  ++  ++RFGRR
Sbjct: 1   MMVSLGQLTGINAIMYYMSTLMGRIGFSKKRSVAMSMVGGAALLIGTIPAILWMDRFGRR 60

Query: 377 KCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPI 436
               W + ++    +    +GV  L P   + P   +A  V +    L+   F  S++ +
Sbjct: 61  A---WAN-TIVLFSLGLVLVGVGYLIPLKSNLP---AAEGVYLTGQILYNMAFG-SYSAL 112

Query: 437 AFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINF---YYGFVXXXXXXX 493
            +V+ +ES+    +   M       ++W+F + +    +  A+ +     GF        
Sbjct: 113 TWVLPSESFSLATRSVGMTCCSTMLYLWSFTVTYNFDRMQKAMTYTGLTLGFYGGLAIVI 172

Query: 494 XXXXXXXXVCETKGLSLEEFNEMYEEGTL 522
                   + ETK  +LEE ++++ + T+
Sbjct: 173 GLPYQLLFMPETKNRTLEEIDDIFSKPTM 201

>YDL199C (YDL199C) [675] chr4 complement(101291..103354) Member of
           the hexose transporter family of the major facilitator
           superfamily (MFS) [2064 bp, 687 aa]
          Length = 687

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 84/433 (19%), Positives = 171/433 (39%), Gaps = 46/433 (10%)

Query: 69  GWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGI-ILGRLGD 127
           G D G I G V    F++ F        +Y      G IV   NLG     + +   + +
Sbjct: 135 GLDQGLISGNVMTLSFQKYF--------HYPLTSPLGNIVSIVNLGAFMASLFVYSGILE 186

Query: 128 FYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPK 187
              RK  L            +Q+ + N W    +GR + G+G+G    +      E    
Sbjct: 187 PCSRKKMLQISTMIYSLGAIVQVLALNQWC-LLLGRFLLGVGMGFAFSMVIIYQFEFPLP 245

Query: 188 HLRGMCISLYQ-----LMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIM-VLG 241
            +R   +   Q     +  + GI++     Y          WR PL    A  +I+ ++ 
Sbjct: 246 CIRKRTLISIQCVSSVIAYSFGIWINCAFRYLG------FAWRYPLSTHVALGIILNLMS 299

Query: 242 MMMVPESPRYLIEKGKFEEAKRSLAKS-NKTTVDDPIVLREFDVINAGVEAERAIGNASW 300
             ++ ESP +L+++    EA   ++   +    ++     +F V+   +  +  +   S+
Sbjct: 300 FYLILESPSWLLKQKNDVEALVLISNVFDDGNFEENQTQLKFRVLKRDILLKSHLQKNSY 359

Query: 301 AELFSTKG-KVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDS---YVT---SI 353
              +  K    + ++++G   Q L +  G + F YY   I Q +G  +    Y+T   ++
Sbjct: 360 PYAYILKDFSSIIKLLIGF--QLLTRTNGVDAFLYYSPLILQQMGRGERKSIYLTGLNAL 417

Query: 354 VLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKS 413
           +  +V  +  ++ L   +R  +   LL    S+  C ++F ++  T  +P        KS
Sbjct: 418 IYSIVILA--YVPLVLRKRKEKTNVLL---GSIVMCALLF-TISFTDWFP--------KS 463

Query: 414 AGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTP 473
               + +   +F+F   +SW  I +V+  E  P   +   + +     WI+ + +   TP
Sbjct: 464 TTRYISILFAVFLFTHFISWDSIGWVMTIELLPHLSQAPVILLVSNFYWIFKWFVSLITP 523

Query: 474 FITSAINFYYGFV 486
            +   +++ +  +
Sbjct: 524 ILIDRLSWKFYLI 536

>Scas_626.1
          Length = 570

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 69/176 (39%), Gaps = 29/176 (16%)

Query: 106 LIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIG--- 162
           L+ V+ ++G   G +  G + D  GRK               +Q ++  +    F+    
Sbjct: 92  LLKVSTSVGTVIGQVGFGTIADIVGRKKIYGLELIIMIVMSVLQTTTGESRAINFVAVLT 151

Query: 163 --RIVSGLGVGGIAVLSPTLISEIAPKHLRG----------------------MCISLYQ 198
             RIV G+G+GG   LS  + SE A    RG                      +C++ Y+
Sbjct: 152 FYRIVMGIGIGGDYPLSSIITSEFATTKWRGAIMGAVFANQAWGQIAAGIVALVCVAAYK 211

Query: 199 LMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIE 254
             + G      C     K+      WR+ +GLG    L  +   + +PESPRY ++
Sbjct: 212 DQLIGAETAEMCGPDCMKACDQ--MWRILVGLGAVPGLAGLYFRLTIPESPRYTLD 265

>Sklu_2304.5 , Contig c2304 8691-10388
          Length = 565

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 63/140 (45%), Gaps = 12/140 (8%)

Query: 107 IVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISS-TNNWIQYFIGRIV 165
           I   + L C+    + G+L D +GRKI L            I  S  TNN      GR V
Sbjct: 81  IATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICGSPWTNNVWVLSTGRFV 140

Query: 166 SGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWR 225
           +G+G GG A LS    S+I P   RG    +YQ    G + + +     S S   ++   
Sbjct: 141 AGIGGGGQATLSTITTSDIIPLRKRG----VYQ----GLVNICFSLGCASGSVLGAV--- 189

Query: 226 MPLGLGFAWALIMVLGMMMV 245
           +  G+G+ WA ++ + M +V
Sbjct: 190 LQQGIGWRWAFLVQVPMALV 209

>KLLA0F13684g complement(1267367..1269082) similar to sp|Q04301
           Saccharomyces cerevisiae YMR088c, start by similarity
          Length = 571

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 49/118 (41%), Gaps = 1/118 (0%)

Query: 75  IGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIG 134
           +G F+G  D       +N   E +    +   IV +F L       + G+L D  GRK  
Sbjct: 48  MGSFLGSLDSTIVANIMNKVAEEFEESDKKQWIVTSFLLTNTAFQPLYGKLSDLAGRKTA 107

Query: 135 LXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGM 192
           L                S  N +++ I R V G+G GGI+ LS   +S+I     RG+
Sbjct: 108 LMVAHSFFLVGCLFTALS-RNLVEFSIARAVCGMGAGGISALSSISVSDICTPKERGV 164

>Kwal_26.7984
          Length = 612

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 51/115 (44%), Gaps = 3/115 (2%)

Query: 90  ELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQ 149
            L +E    LSD+    +V    L  AFG II       +G++I L            I 
Sbjct: 104 SLAEEFNRSLSDI--SYLVGGMMLALAFGSIIASPSAVLFGKRI-LYLIGIIVFFFGSIG 160

Query: 150 ISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGG 204
            S ++++      RIVSGLGV  I  L    ++EI   H R   + +Y L++ GG
Sbjct: 161 CSVSHSYESLLASRIVSGLGVATIESLPSATVAEIYFAHERAYRLGVYTLLLLGG 215

>Scas_692.8
          Length = 625

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 72/174 (41%), Gaps = 25/174 (14%)

Query: 106 LIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIG--- 162
           L+ V+ ++G   G +  G + D  GRK               +Q ++ ++    F+    
Sbjct: 140 LLKVSTSVGTVIGQVGFGTMADVIGRKKIYGMELILMIITTILQCTTGSSPGINFVAVLT 199

Query: 163 --RIVSGLGVGGIAVLSPTLISEIAPKHLRGMCI-SLYQLMITGGIFVGYCTNYGSKSYT 219
             RI+ G+G+GG   LS  + SE +    RG  + +++     G I  G        +Y 
Sbjct: 200 FYRILMGIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQILGGIIALVLVAAYK 259

Query: 220 NSI-------------------QWRMPLGLGFAWALIMVLGMMMVPESPRYLIE 254
           +S+                    WR+ +GLG    +I +   + +PESPRY ++
Sbjct: 260 SSLIDANTGAECGYECMKACDQMWRILIGLGAVPGVIGLYFRLTIPESPRYSLD 313

>Sklu_1567.2 YPR198W, Contig c1567 1150-2859
          Length = 569

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 48/109 (44%), Gaps = 1/109 (0%)

Query: 91  LNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQI 150
           LN   + + +  + G ++  ++L  A   ++ GR    +G K  L            + I
Sbjct: 44  LNTIADKFNAYSKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGSLV-I 102

Query: 151 SSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQL 199
           + +N+      GR+++G G  GI  L   + + +  +H RG  ++L  L
Sbjct: 103 AVSNSMDMIIGGRVIAGCGASGIQTLVFAIATSLVDEHTRGTIVTLLSL 151

>Sklu_1959.3 , Contig c1959 3851-5446 reverse complement
          Length = 531

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 33/164 (20%), Positives = 57/164 (34%), Gaps = 8/164 (4%)

Query: 118 GGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLS 177
           G ++ G +GD YGRK+              I     +N+  + I R   G+ +GGI   S
Sbjct: 126 GAVLFGYIGDRYGRKVSFIINLFFMMVLEIITGFIKHNFKYFLIARAFFGVVLGGIFGNS 185

Query: 178 PTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALI 237
                +  P          +Q   T G  +           T   +WR           +
Sbjct: 186 AAQCFDDCPPEAHSFISGFFQQGYTLGYLLAVIFTRALADTTKD-RWRSCFWFAAGITFL 244

Query: 238 MVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLRE 281
           +++   ++PE+  +L       E +R  A+      DD    +E
Sbjct: 245 LIIFRALLPETNAFL-------ERQRIKAEKKLNNEDDDHTFKE 281

>Kwal_26.6669
          Length = 590

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 58/143 (40%), Gaps = 22/143 (15%)

Query: 90  ELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRK-IGLXXXXXXXXXXXXI 148
           ELND            L+  ++   CA    + G+  D +GRK + +             
Sbjct: 111 ELNDMPN-------VSLVATSYVFSCAIFQPLFGKTSDVFGRKPLLISSNLLFFAGCLTC 163

Query: 149 QISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMIT-----G 203
            +S T  W+   +GR+V+G+G GG+  +   +I++I P   R +      L        G
Sbjct: 164 GLSKTIWWL--ILGRLVTGIGGGGLTSMCTIIINDIVPLRNRAVYQGFGNLFYALGTACG 221

Query: 204 GIFVGYCTNYGSKSYTNSIQWRM 226
           G+  G  + YG+        WRM
Sbjct: 222 GLVGGLFSEYGNG-------WRM 237

>Sklu_2289.2 , Contig c2289 5004-6585
          Length = 528

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 97/225 (43%), Gaps = 39/225 (17%)

Query: 29  VED-VSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIG--TIGGFVGQTDFK 85
           VED  S + +++ + G P+P+S               GF    ++G  T+  F+   D  
Sbjct: 5   VEDRSSAQDESSGHVGDPQPLS---------------GFKLYANMGSLTLVLFLAALDIL 49

Query: 86  RRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXX 145
                +    E +    ++G IV  ++L  A   ++ GR    +G K+ L          
Sbjct: 50  IMSASIEVISEQFNDYSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETG 109

Query: 146 XXIQISSTNNWIQYFIG-RIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISL----YQLM 200
             I  S+ +N +   IG R+V+G+G  GI  L   + S +  +  RG+ IS+    Y + 
Sbjct: 110 SLI--SAVSNSMNVLIGGRVVAGIGGSGIQSLCFVIASTLTTERSRGVAISVLSCAYAVA 167

Query: 201 ITGGIFVGYCTNYGSKSYTNSIQWR------MPLGLGFAWALIMV 239
                F+G        ++T  + WR      +P+G G A+A++++
Sbjct: 168 AVASPFMG-------SAFTTHVTWRWCFYINLPIG-GLAFAVLVL 204

>Kwal_56.23754
          Length = 589

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 41/90 (45%), Gaps = 5/90 (5%)

Query: 123 GRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLIS 182
           G+L D  GRK  L            I   ST+ W    +GR VSG+G  G+  L+  +IS
Sbjct: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIW-WVVVGRFVSGIGGCGLTCLASMVIS 196

Query: 183 EIAPKHLR----GMCISLYQLMITGGIFVG 208
           ++ P   R    G+C  ++ L    G  VG
Sbjct: 197 DLVPLRERAVYQGLCNFIFGLGTASGGLVG 226

>AGR076C [4386] [Homologous to ScYDR119W - SH] (871570..873630)
           [2061 bp, 686 aa]
          Length = 686

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 45/110 (40%), Gaps = 5/110 (4%)

Query: 103 RTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIG 162
           R   I   + L  A    + G+L D +GR+  L            I   S N W+   +G
Sbjct: 176 RISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLG 234

Query: 163 RIVSGLGVGGIAVLSPTLISEIAPKHLR----GMCISLYQLMITGGIFVG 208
           R V+G+G GG+  +     ++I P   R    G+C   + L    G  VG
Sbjct: 235 RFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFGLGTACGGLVG 284

>Kwal_23.4814
          Length = 529

 Score = 33.5 bits (75), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 32/176 (18%), Positives = 74/176 (42%), Gaps = 23/176 (13%)

Query: 94  EGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISST 153
           EG++++S     + +V + L       ++G L D +GR+  +            I I+ +
Sbjct: 48  EGQFHISTELVNVSIVLYFLFQGLSPTLMGGLADSFGRR-PVVLWSVALYMAACIGIACS 106

Query: 154 NNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISL----------YQLMITG 203
             + Q  + R +   G+  +  ++  ++ ++  +  RG  + L          +  +I G
Sbjct: 107 KTYAQILVLRCLQSAGISPVIAVNSGIMGDVTTREQRGGYVGLTAGFQVIGSAFGALIGG 166

Query: 204 GIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFE 259
           GI         S     ++ W + +  GF+    +V+  +M+PE+ R ++  G  +
Sbjct: 167 GIV--------STWSWRAVFWFLAIASGFS----LVVTFIMLPETKRSIVGNGSIQ 210

>Sklu_2394.9 YHR048W, Contig c2394 13885-15486
          Length = 533

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 85/200 (42%), Gaps = 9/200 (4%)

Query: 96  EYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNN 155
            +++S   + L +  +  G  FG + L  L + YGRKI              + + S   
Sbjct: 120 HFHISHEVSVLGISLYIFGLGFGPLFLSPLSEMYGRKITFVMSLSMSIVWQVLTVWSP-T 178

Query: 156 WIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGS 215
            +  F GR ++G        ++  +IS+I  +   G+ +++Y      G  +G   +   
Sbjct: 179 IVGMFFGRFLAGFFGSSFLSVAGGVISDIFTRQEIGIPMTVYTTSPFLGPALGPVVS--G 236

Query: 216 KSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDD 275
             Y  S +W   + L  A  + +VL    VPE+ + ++  GK   AKR   ++       
Sbjct: 237 ALYGVSYKWTF-IALLIASGVCLVLIAFTVPETYQPVLLIGK---AKRMRQETGDHGYFA 292

Query: 276 P--IVLREFDVINAGVEAER 293
           P  IV RE ++ +A + + R
Sbjct: 293 PLEIVRRETNITSAVLLSTR 312

>Scas_660.3
          Length = 568

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 46/118 (38%), Gaps = 1/118 (0%)

Query: 75  IGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIG 134
           +G F+   D       +N   E +    +   I  +F L       + G+L D  GRK  
Sbjct: 48  LGSFLSSLDSTIVANIMNKVAEEFEESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFA 107

Query: 135 LXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGM 192
           +            +   +  N  Q+ I R + G+G GG+  +S   +S+I     RG+
Sbjct: 108 VLTSHFFFGLGCFLTCFA-QNITQFSIARAICGIGAGGVNAMSSITVSDICSTRERGI 164

>KLLA0F10043g complement(928691..930277) weakly similar to sp|P36035
           Saccharomyces cerevisiae YKL217w JEN1 carboxylic acid
           transporter protein singleton, start by similarity
          Length = 528

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 60/146 (41%), Gaps = 9/146 (6%)

Query: 118 GGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISS--TNNWIQYFIGRIVSGLGVGGIAV 175
           G +I G LGD YGRK               IQI +   N++  +   R + G+ +G +  
Sbjct: 130 GALIFGYLGDRYGRKYSF---VLTMALIIVIQIGTGFVNSFSAFLGCRAIFGIIMGSVFG 186

Query: 176 LSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQ-WRMPLGLGFAW 234
           ++     E AP   + +   ++Q     G  +G    +      NS   WR         
Sbjct: 187 VASATALENAPNKAKSILSGIFQEGYAFGYLLGVV--FQRAIVDNSPHGWRAIFWFSAGP 244

Query: 235 ALIMVLGMMMVPESPRYLIEKGKFEE 260
            ++ +   +M+PES  Y +E+ + E+
Sbjct: 245 PVLFIAWRLMLPESQHY-VERVRLEK 269

>YMR088C (YMR088C) [4046] chr13 complement(443413..445101) Member of
           the multidrug-resistance 14-spanner (DHA14) family of
           the major facilitator superfamily (MFS-MDR) [1689 bp,
           562 aa]
          Length = 562

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 46/118 (38%), Gaps = 1/118 (0%)

Query: 75  IGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIG 134
           +G F+   D       +N   E +    +   I  +F L       + G+L D  GRK  
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPLYGKLSDITGRKSA 103

Query: 135 LXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGM 192
           L            +   +  N  ++ I R + G+G GG+  +S   +S+I     RG+
Sbjct: 104 LLTAQFFFGLGCLLTCFA-RNVTEFSIARAICGIGAGGLNAISSIAVSDICTARERGV 160

>CAGL0J01375g 127843..129537 similar to sp|Q04301 Saccharomyces
           cerevisiae YMR088c, start by similarity
          Length = 564

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 123 GRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLIS 182
           G+L D  GRK  +            +   + N+  Q+ I R + G+G GGI  +S   +S
Sbjct: 93  GKLSDLTGRKFAVLTAHFFFGLGCLLTCFA-NSVTQFAIARAICGVGGGGINAMSSITVS 151

Query: 183 EIAPKHLRGM 192
           +I  +  RG+
Sbjct: 152 DICTQRERGI 161

>KLLA0C19459g 1746987..1747436 some similarities with
           ca|CA3241|IPF7493 Candida albicans putative permease (by
           homology), hypothetical start
          Length = 149

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 6/94 (6%)

Query: 40  ENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGE--Y 97
           +NE  P+  +  +T+    L+    G   G+D G + G V Q  F+ +FG L D+ +   
Sbjct: 50  DNESPPEVYN--WTLYMSILIFGILGAARGYDEGNVSGSVAQVSFQNQFG-LADKTKSAS 106

Query: 98  YLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGR 131
           YL+++++  I     LG   G +I     + +GR
Sbjct: 107 YLANLKSN-ITSMVQLGSIGGTLIAMYTVEKFGR 139

>KLLA0D10615g 903967..905322 similar to sp|P47159 Saccharomyces
           cerevisiae YJR124c singleton, hypothetical start
          Length = 451

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 6/63 (9%)

Query: 337 TTIFQAVGMDDS----YVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVV 392
           T  F  +G+ D     +++  ++G V  S  ++  W  + +GRR  L +GSA MA   +V
Sbjct: 36  TLFFSEIGISDDEMGWFMSLTLVGDVCIS--YVLTWYADSWGRRLVLTYGSAMMALSGIV 93

Query: 393 FAS 395
           FA+
Sbjct: 94  FAT 96

>Scas_694.19
          Length = 581

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 33/168 (19%), Positives = 70/168 (41%), Gaps = 19/168 (11%)

Query: 94  EGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISST 153
           E ++ L + +  + VV + L       I G L D +GR+  +            I ++  
Sbjct: 118 EKQFGLDENKVNVTVVVYLLFQGIAPTISGGLADVFGRR-PVILIGMLIYVVASIGLACA 176

Query: 154 NNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNY 213
            ++      RI+  +G+     +S  ++ +   KH RG  +       +G + +G C  +
Sbjct: 177 PSYGVIVFLRIIQSIGISPTIAISSGVVGDFTLKHERGTFVG----ATSGLVLLGQC--F 230

Query: 214 GSKSYT--------NSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLI 253
           GS             +I W + +G G ++    ++  +++PE+ R L+
Sbjct: 231 GSLIGAVLAAAWNWRAIFWFLTIGCGTSF----IIAFLLLPETKRTLV 274

>KLLA0C16852g 1471656..1473029 similar to sp|P25297 Saccharomyces
           cerevisiae YML123c PHO84 high-affinity inorganic
           phosphate/H+ symporter, start by similarity
          Length = 457

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 6/45 (13%)

Query: 224 WRMPLGLGFAWALIMVLGMMMVPESPRYLIE------KGKFEEAK 262
           WR+ +GLG     I +   + +PESPRY ++      KG  + AK
Sbjct: 124 WRILIGLGCLPGCIALYFRLTIPESPRYTLDVDMDFNKGAADAAK 168

>YOR378W (YOR378W) [5152] chr15 (1049507..1051054) Member of the
           multidrug-resistance 14-spanner (DHA14) family of the
           major facilitator superfamily (MFS-MDR) [1548 bp, 515
           aa]
          Length = 515

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 61/151 (40%), Gaps = 14/151 (9%)

Query: 120 IILGRLGDFYG-RKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSP 178
           +I GRLGD +G +K  +               S  +N I +   R   G+G    A L P
Sbjct: 98  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQIFFDCCRAFQGMGP---AFLLP 154

Query: 179 TLISEIA----PKHLRGMCISLYQLMITGGIFVG--YCTNYGSKSYTNSIQWRMPLGLGF 232
             I+ +     P   + M  SL+     GG F+G  + +  G  ++     W M    G 
Sbjct: 155 NAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQLAWWPWAYWIM----GI 210

Query: 233 AWALIMVLGMMMVPESPRYLIEKGKFEEAKR 263
           A  ++ V G  ++P +P    +   F+  +R
Sbjct: 211 ACFVLAVAGYFVIPHTPMPSRDASSFKLLER 241

>YKR105C (YKR105C) [3356] chr11 complement(658352..660100) Member of
           the multidrug-resistance 14-spanner (DHA14) family of
           the major facilitator superfamily (MFS-MDR) [1749 bp,
           582 aa]
          Length = 582

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 87/218 (39%), Gaps = 33/218 (15%)

Query: 30  EDVSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFG 89
            D SL  + + +  +P  +S Y  +  L L++    FI   DI  +G  +       +FG
Sbjct: 18  SDASLNARGSND--SPMGLSLYLCLASLTLVL----FITALDILIVGTIIDVV--AEQFG 69

Query: 90  ELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQ 149
             +          +TG +V  ++L  A   +I GR     G +  L            I 
Sbjct: 70  NYS----------KTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSLIA 119

Query: 150 -ISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVG 208
            ++S+ N + +  GR+V+G+G  G+  L   +   +  +  R + IS+          VG
Sbjct: 120 ALASSMNMLIF--GRVVAGVGGSGLQTLCFVIGCTMVGERSRPLVISILSCAFAVAAIVG 177

Query: 209 YCTNYGSKSYTNSIQWR------MPLGLGFAWALIMVL 240
                   ++T  + WR      +P+G     A+IM L
Sbjct: 178 PIIG---GAFTTHVTWRWCFYINLPIG---GLAIIMFL 209

>ABR173C [766] [Homologous to ScYJR124C - SH] (727042..728352) [1311
           bp, 436 aa]
          Length = 436

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 363 TFISLWSVERFGRRKCLLWGSASMACCFVVFASM 396
           +++  W  +R+GRRK L+ G   MA    VF++M
Sbjct: 64  SYVLTWYADRWGRRKVLVVGGVLMAASGAVFSTM 97

>AFR322C [3514] [Homologous to ScYGR138C (TPO2) - SH; ScYPR156C
           (TPO3) - SH] (1017695..1019473) [1779 bp, 592 aa]
          Length = 592

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 74/179 (41%), Gaps = 8/179 (4%)

Query: 101 DVRTGLIVVTFNL---GCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWI 157
           DV T + +++ +L   G   G ++   L D YGR+I              I  +   N  
Sbjct: 183 DVSTEVAILSCSLVVLGYGVGQLVWAPLSDLYGRRI-TYFTSLFLYVVFNIPCAVAPNIQ 241

Query: 158 QYFIGRIVSG-LGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSK 216
              + R + G L   G+ ++  +L +++ P  LRG+ I+ +     GG       N    
Sbjct: 242 TLLVCRFICGVLSSSGLCLVGGSL-ADMFPADLRGLTIAFFAFAPYGGPVFAPLINGFIA 300

Query: 217 SYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDD 275
             T  +     + +  A A+ +++   +VPE+   +I K + E+ ++     N  T  +
Sbjct: 301 VRTERLDLIFWVNMALAGAVWLLVA--LVPETYAPIILKRRAEKLRKLTGNQNIMTEQE 357

>Scas_713.30
          Length = 630

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 69/160 (43%), Gaps = 21/160 (13%)

Query: 91  LNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQI 150
           + D  + + +  +TG I   ++L  A   ++ GR+    G K  +            I  
Sbjct: 102 IEDVAKKFGAYSKTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSLI-- 159

Query: 151 SSTNNWIQYFIG-RIVSGLGVGGIAVLSPTLISEIAPKHLRGMCI----SLYQLMITGGI 205
           S   N +   IG R+++G+G  GI  L+  + S +  +  RG+ I    S + +    G 
Sbjct: 160 SGVANSMNMLIGGRVIAGVGGSGIQSLAFVIGSNLVDERRRGLIIACMSSAFAVASVIGP 219

Query: 206 FVGYCTNYGSKSYTNSIQWR------MPLGLGFAWALIMV 239
           F+G        ++T    WR      +P+G G A+AL +V
Sbjct: 220 FLG-------GAFTTHATWRWCFYINLPVG-GVAFALFVV 251

>Scas_721.15
          Length = 530

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 53/266 (19%), Positives = 96/266 (36%), Gaps = 29/266 (10%)

Query: 22  DPKQIKSVEDVSLKVKTNENEGAPKPISAYFT--VICLCLMIAFGGFIFGWDIGTIGGFV 79
            P +I + ED   K ++N+   A  P + + T  +  +  +I F GF+     G + G +
Sbjct: 34  KPDEILNFEDED-KQESNQEVTAVIPYTLFSTGQIYVIMFIITFIGFL-----GPLSGNI 87

Query: 80  GQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXX 139
                         + ++ +S       V  F    A G +  G   D  GRK+      
Sbjct: 88  YIPALPTL------QKDFNVSSTVINATVSVFMAVFAVGPLFWGLFADVGGRKVLYICSI 141

Query: 140 XXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQL 199
                   +  S   +    F+ RIV   G   +  L    +++I P   RG  I  + +
Sbjct: 142 LLMVIVNILLASIPAHISSLFVLRIVQAFGSSSVITLGAGTVTDITPPKQRGRAIGYFMI 201

Query: 200 -----MITGGIFVGYCTNYGSKSYTNSIQWRMPLGL-GFAWALIMVLGMMMVPESPRYLI 253
                 +   I  G     G+        WR   GL G    + ++L +  +PE+ R ++
Sbjct: 202 GPNMGPVLAPIIAGLILMKGN-------YWRWLFGLTGIMGGVGLLLIVAFLPETLRCIV 254

Query: 254 EKGK--FEEAKRSLAKSNKTTVDDPI 277
                 ++E +  L + +      PI
Sbjct: 255 GNADPGWDERRLKLRRDDDIEFSRPI 280

>Kwal_47.18976
          Length = 534

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 66/158 (41%), Gaps = 12/158 (7%)

Query: 118 GGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISS--TNNWIQYFIGRIVSGLGVGGIAV 175
           G II G LGD YGRK+              +QI +    ++  +   R + G+ +G I  
Sbjct: 122 GAIIFGYLGDRYGRKV---PYCISMVLIVVVQIGTGFVKSFPAFLGCRALFGIVMGSIFG 178

Query: 176 LSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNSIQ-WRMPLGLGFAW 234
           ++     E AP+  + +   ++Q     G  +G    +      NS   WR         
Sbjct: 179 VASATALEDAPQESKSILSGIFQEGYALGYLLGVV--FKRAIVDNSSHGWRAFFWFSAGP 236

Query: 235 ALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTT 272
            ++ ++  +++PES  Y     +  E KR LA+S + T
Sbjct: 237 PVLFIVWRLLLPESEAY---TRRTTEEKR-LAESEERT 270

>AFR442C [3634] [Homologous to ScYML123C (PHO84) - SH]
           (1234199..1235890) [1692 bp, 563 aa]
          Length = 563

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 6/60 (10%)

Query: 224 WRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFE------EAKRSLAKSNKTTVDDPI 277
           WR+ +G G    +I +   + +PESPRY ++    +      E  RS  + N   +  P+
Sbjct: 243 WRILVGFGCVPGMIALYFRLTIPESPRYTLDVQAADLARLANEPSRSDQEENLEKMVSPV 302

>ADR336C [2077] [Homologous to ScYNR055C (HOL1) - NSH]
           (1299396..1301102) [1707 bp, 568 aa]
          Length = 568

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 36/65 (55%), Gaps = 4/65 (6%)

Query: 312 QRVIMGIMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVE 371
           + V+ G++  S+   T    F ++ +   +AVG  +SY   I L VVNFS T ++ W + 
Sbjct: 489 EMVLEGMVCTSVINNTLSCIFTFFCSPFIEAVGTQNSY---IFLAVVNFSVTLLA-WPML 544

Query: 372 RFGRR 376
            +G++
Sbjct: 545 VYGKK 549

>KLLA0F17776g complement(1627198..1628859) similar to
           ca|CA1324|IPF6676 Candida albicans polytopic membrane
           protein involved in drug transport (by homology), start
           by similarity
          Length = 553

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 107 IVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISS-TNNWIQYFIGRIV 165
           I  ++ L C+    + G+L D +GRK  L            +  +  T +     IGR +
Sbjct: 72  IATSYLLSCSAFQPLYGKLSDVFGRKPLLIWSNLCFGFGCILCGAPFTKSLWMLCIGRFI 131

Query: 166 SGLGVGGIAVLSPTLISEIAPKHLRGM 192
           +G+G GG+  LS    S+I P   RG+
Sbjct: 132 AGVGGGGLNSLSTITTSDIIPLRQRGV 158

>Sklu_1110.1 YDR119W, Contig c1110 22-1995
          Length = 657

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 47/113 (41%), Gaps = 6/113 (5%)

Query: 107 IVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVS 166
           I   + L  A    + G++ D +GRK  L            I   S   W     GR ++
Sbjct: 169 IATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWC-LVAGRFIA 227

Query: 167 GLGVGGIAVLSPTLISEIAPKHLR----GMCISLYQL-MITGGIFVGYCTNYG 214
           G+G GG+  +S    S+I P   R    G+C   + L    GG+  G+ + +G
Sbjct: 228 GIGGGGLTSMSSITTSDIVPLRNRALYQGICNFFFGLGTACGGLVGGWFSEHG 280

>YBR180W (DTR1) [364] chr2 (589698..591416) Dityrosine transporter,
           functions in maturation of the spore wall, member of the
           multidrug-resistance 12-spanner (DHA12) family of the
           major facilitator superfamily (MFS-MDR) [1719 bp, 572
           aa]
          Length = 572

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 35/185 (18%), Positives = 63/185 (34%), Gaps = 13/185 (7%)

Query: 94  EGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISST 153
           + EY +S       V  F    + G +  G L DF GRK               +  +  
Sbjct: 138 QREYDVSATTINATVSVFMAVFSVGPLFWGALADFGGRKFLYMVSLSLMLIVNILLAAVP 197

Query: 154 NNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQL-----MITGGIFVG 208
            N    F+ RI        +  L    ++++ P   RG  I+ + +      I   I  G
Sbjct: 198 VNIAALFVLRIFQAFASSSVISLGAGTVTDVVPPKHRGKAIAYFMMGPNMGPIIAPIVAG 257

Query: 209 YCTNYGSKSYTNSIQWRMPLGL-GFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAK 267
                G+        WR   G       + ++L   ++PE+ R ++  G  +   +   +
Sbjct: 258 LILMKGN-------YWRWLFGFTSIMTGIALILVTALLPETLRCIVGNGDPKWGDKKDER 310

Query: 268 SNKTT 272
            N  +
Sbjct: 311 ENNES 315

>Kwal_33.15638
          Length = 535

 Score = 29.6 bits (65), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 77/210 (36%), Gaps = 21/210 (10%)

Query: 94  EGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISST 153
           +G +  S  RT  I +  NLG   G +      D  GRK               +  SS 
Sbjct: 98  DGVHPPSAGRTPFITLAQNLGLLGGSLFWSLSSDIIGRKWAFNITFLWTAVWAIVAGSSP 157

Query: 154 NNWIQYFIGRIVS--GLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFV---- 207
           N      +G  V+    GVGG   +   +  E  P     +   L      G IF     
Sbjct: 158 N---FAALGVFVAFWSFGVGGNLPVDSAIFIENLPSKYNYLLTVLSVFWAFGQIFANLLS 214

Query: 208 -GYCTNYGSKSYTNSIQ------WRMPLGL--GFAWALIMVLGMMMVPESPRYLIEKGKF 258
               TNY     T+ I+      WR  L    GF + L ++     V ESPR+ I +G  
Sbjct: 215 WALITNYSCD--TDVIRKGCNWGWRYFLFAMGGFTFLLFVIRFAFNVFESPRFHISRGDN 272

Query: 259 EEAKRSLAKSNKTT-VDDPIVLREFDVINA 287
           E A  +L K  K    +  I L + + I+A
Sbjct: 273 EAAVATLYKIAKINGKETTITLDDLNKIDA 302

>Kwal_33.14268
          Length = 569

 Score = 29.6 bits (65), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 224 WRMPLGLGFAWALIMVLGMMMVPESPRYLIE-KGKFEEAKRSLAK 267
           WR+ +GLG    +  +   + +PESPRY ++ + +  +A   ++K
Sbjct: 241 WRILVGLGCVPGVFALYFRLTIPESPRYTLDVENRVNKAAADVSK 285

>Kwal_27.12173
          Length = 567

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 31/84 (36%)

Query: 116 AFGGIILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAV 175
           A G +I     DF GRKI              +  +   N    F  R++       +  
Sbjct: 160 AVGPLIWASFADFGGRKILYMISLLLTVIVNVLLAAVPVNTGALFFLRVMQAFASSSVMA 219

Query: 176 LSPTLISEIAPKHLRGMCISLYQL 199
           L    +S+I P  +RG  I+ + L
Sbjct: 220 LGAGTVSDIRPPQVRGKAIAYFML 243

>Kwal_23.4824
          Length = 553

 Score = 29.6 bits (65), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 50/261 (19%), Positives = 103/261 (39%), Gaps = 51/261 (19%)

Query: 22  DPKQIKSVEDVSLKVKTNENEG---------------APKPISAYFTVI------CLCLM 60
           D  + K  +D   +V T+E +G               AP P  A +T++      C+  +
Sbjct: 32  DGNKHKYEQDAPSRVTTHEMKGSSSESIEGHDIAHDNAPLPQHAPYTLLSNAQKWCMVAL 91

Query: 61  IAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGI 120
           +   GF   W   ++G  +     K+       E ++ +S+    + VV + +       
Sbjct: 92  LTSAGF---WS--SLGSPIYYPALKQL------EKQFSVSEELVNITVVVYLIFQGVAPT 140

Query: 121 ILGRLGDFYGRKIGLXXXXXXXXXXXXIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTL 180
           I G L D YGR+  +            I ++ +N++      R +   G+  I  ++  +
Sbjct: 141 ISGGLADVYGRR-PVILIGMLIYVCASIGLACSNSYGVIVFLRCLQSAGISPIIAINSGV 199

Query: 181 ISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGS---KSYTNSIQWR-----MPLGLGF 232
           + +   K  RG  +      ++G   +G    +GS    + T +  WR     + +G G 
Sbjct: 200 VGDFTVKQERGTFVG----AVSGFTLMGQA--FGSLIGAALTAAFDWRAIFWFLTIGCG- 252

Query: 233 AWALIMVLGMMMVPESPRYLI 253
                M++  +++PE+ R ++
Sbjct: 253 ---TCMLVNFLLLPETKRSIV 270

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.140    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,379,186
Number of extensions: 643442
Number of successful extensions: 2540
Number of sequences better than 10.0: 207
Number of HSP's gapped: 2161
Number of HSP's successfully gapped: 214
Length of query: 559
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 452
Effective length of database: 12,891,983
Effective search space: 5827176316
Effective search space used: 5827176316
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)