Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_715.4953253227090.0
YER060W (FCY21)52851720120.0
Scas_715.47d53352519790.0
Scas_704.3654552919310.0
YER056C (FCY2)53352519200.0
CAGL0J02948g51551219020.0
YER060W-A (FCY22)53052218890.0
CAGL0L00671g54352518620.0
Sklu_1893.251351817330.0
Kwal_23.581951651516890.0
Scas_715.47d152351916450.0
KLLA0C08283g51951816020.0
Kwal_34.1573051851915550.0
CAGL0C00231g54051214790.0
ADL074W52452714630.0
Scas_715.54d2322276516e-82
KLLA0D05060g5235265763e-67
Kwal_47.172165425165703e-66
YGL186C (TPN1)5795824797e-53
CAGL0L06138g6314524333e-46
Scas_710.305844124086e-43
Scas_701.168682515e-26
Scas_690.1*636722762e-25
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_715.49
         (532 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_715.49                                                          1048   0.0  
YER060W (FCY21) [1490] chr5 (274565..276151) Protein with simila...   779   0.0  
Scas_715.47d                                                          766   0.0  
Scas_704.36                                                           748   0.0  
YER056C (FCY2) [1485] chr5 complement(266511..268112) Cytosine/p...   744   0.0  
CAGL0J02948g 282559..284106 highly similar to sp|P40039 Saccharo...   737   0.0  
YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine p...   732   0.0  
CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomy...   721   0.0  
Sklu_1893.2 YER056C, Contig c1893 1725-3266                           672   0.0  
Kwal_23.5819                                                          655   0.0  
Scas_715.47d1                                                         638   0.0  
KLLA0C08283g complement(725563..727122) similar to sp|P17064 Sac...   621   0.0  
Kwal_34.15730                                                         603   0.0  
CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces cer...   574   0.0  
ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH] complement(...   568   0.0  
Scas_715.54d                                                          255   6e-82
KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces c...   226   3e-67
Kwal_47.17216                                                         224   3e-66
YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of ...   189   7e-53
CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces c...   171   3e-46
Scas_710.30                                                           161   6e-43
Scas_701.1                                                            101   5e-26
Scas_690.1*                                                           110   2e-25

>Scas_715.49
          Length = 532

 Score = 1048 bits (2709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/532 (97%), Positives = 517/532 (97%)

Query: 1   MNFATDANKEIDVGSSYEMNDLERNSKDLKSPSKNLSSDYYVDIDSHASEEVLETKLNLF 60
           MNFATDANKEIDVGSSYEMNDLERNSKDLKSPSKNLSSDYYVDIDSHASEEVLETKLNLF
Sbjct: 1   MNFATDANKEIDVGSSYEMNDLERNSKDLKSPSKNLSSDYYVDIDSHASEEVLETKLNLF 60

Query: 61  NRIAAGLSAETKGIEPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGT 120
           NRIAAGLSAETKGIEPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGT
Sbjct: 61  NRIAAGLSAETKGIEPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGT 120

Query: 121 STLVIIFFNILGLLPVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIV 180
           STLVIIFFNILGLLPVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIV
Sbjct: 121 STLVIIFFNILGLLPVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIV 180

Query: 181 NTVASSQLLNMVNQGPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLV 240
           NTVASSQLLNMVNQGPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLV
Sbjct: 181 NTVASSQLLNMVNQGPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLV 240

Query: 241 IIARLAKSGNFSNGEWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKI 300
           IIARLAKSGNFSNGEWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKI
Sbjct: 241 IIARLAKSGNFSNGEWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKI 300

Query: 301 FFSLVAGLSFPLFFVMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEF 360
           FFSLVAGLSFPLFFVMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEF
Sbjct: 301 FFSLVAGLSFPLFFVMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEF 360

Query: 361 CCVVLSISIVANNVPNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDT 420
           CCVVLSISIVANNVPNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDT
Sbjct: 361 CCVVLSISIVANNVPNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDT 420

Query: 421 FMEYFMDXXXXXXXXXXXXXXXEHFIYRRSFEAYNVEDWDDNSKLPIGIAGCCAFGVGVI 480
           FMEYFMD               EHFIYRRSFEAYNVEDWDDNSKLPIGIAGCCAFGVGVI
Sbjct: 421 FMEYFMDSIAYYLAIYISIALSEHFIYRRSFEAYNVEDWDDNSKLPIGIAGCCAFGVGVI 480

Query: 481 GVALGMCQTYWTGQIGRLIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532
           GVALGMCQTYWTGQIGRLIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR
Sbjct: 481 GVALGMCQTYWTGQIGRLIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532

>YER060W (FCY21) [1490] chr5 (274565..276151) Protein with
           similarity to Fcy2p, member of the purine/cytosine
           family of secondary active transporters [1587 bp, 528
           aa]
          Length = 528

 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/517 (71%), Positives = 426/517 (82%), Gaps = 4/517 (0%)

Query: 16  SYEMNDLERNSKDLKSPSKNLSSDYYVDIDSHASEEVLETKLNLFNRIAAGLSAETKGIE 75
            YE+ DLE  + D K+PS N   ++Y D++SH +EE++E KL+  NRIAAGLSAETKGIE
Sbjct: 16  KYELKDLESRAHDAKTPSTN---EFYDDVESHGTEELVEAKLSFLNRIAAGLSAETKGIE 72

Query: 76  PITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIFFNILGLLP 135
           PIT++EK D S+LNAASMWFSANMV+ AYAIG LGP+VF LNFG S  VIIFFN+LGL+ 
Sbjct: 73  PITEDEKTDDSILNAASMWFSANMVLPAYAIGALGPMVFDLNFGQSVFVIIFFNLLGLVS 132

Query: 136 VAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQLLNMVNQG 195
           VAFFS+FGA+LGLRQM+LSR+L+GN  ARIFS IN +AC+GWGIVNTVASSQ+LNMVN G
Sbjct: 133 VAFFSVFGAELGLRQMILSRYLVGNIAARIFSFINFIACIGWGIVNTVASSQVLNMVNPG 192

Query: 196 PHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARLAKSGNFSNGE 255
            H+CPLWAGCIVIIGAT+++TFFGY VIH++EKW WVPNFA FLVIIARLA+S  F  GE
Sbjct: 193 -HQCPLWAGCIVIIGATVIVTFFGYGVIHAYEKWAWVPNFAVFLVIIARLARSKKFVLGE 251

Query: 256 WTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFSLVAGLSFPLFFV 315
           WTSGPTTAGNVLSFGS V+GFA GWTTYAADYTVYMPR TNK+KIFFSLV GL+ PL+F 
Sbjct: 252 WTSGPTTAGNVLSFGSTVYGFAAGWTTYAADYTVYMPRKTNKYKIFFSLVVGLATPLYFT 311

Query: 316 MILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCVVLSISIVANNVP 375
           MILGAA AM A+ +P W  YY EN +GGLT+A+LVPNS+HGFG+FCCV+LS+S +ANNVP
Sbjct: 312 MILGAAVAMAAIGDPAWKTYYDENSIGGLTFAVLVPNSVHGFGQFCCVLLSLSTIANNVP 371

Query: 376 NMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFMEYFMDXXXXXXXX 435
           NMYTIALSVQA W PLAK+PRV WT+ GN A LGIAIPACY+F TFM YFMD        
Sbjct: 372 NMYTIALSVQATWEPLAKVPRVIWTLLGNAAALGIAIPACYYFSTFMNYFMDSIGYYLAI 431

Query: 436 XXXXXXXEHFIYRRSFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMCQTYWTGQI 495
                  EHFIYRRSF AYNV+DWD   +LPIGIAG  A  VG  GVALGMCQTYW G+I
Sbjct: 432 YIAIACSEHFIYRRSFSAYNVDDWDSWERLPIGIAGTAALIVGAFGVALGMCQTYWVGEI 491

Query: 496 GRLIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532
            RLIG+YGGD+GFELG  W+FIVYN+ RP ELKYFGR
Sbjct: 492 SRLIGDYGGDIGFELGLSWAFIVYNIARPFELKYFGR 528

>Scas_715.47d
          Length = 533

 Score =  766 bits (1979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/525 (70%), Positives = 427/525 (81%), Gaps = 10/525 (1%)

Query: 17  YEMNDLERNSKDLKSPSKNLSSDYYVDIDSHASEEVLE---------TKLNLFNRIAAGL 67
           YE+ DLE +  +  S   NL +D  +D+    S E            +K + FNR+A+ L
Sbjct: 10  YEIQDLEMD-LERNSEFSNLPNDKKIDLGPTFSNEPASFIEITEETGSKFSFFNRLASQL 68

Query: 68  SAETKGIEPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIF 127
           +AETKGIE ITDEEK D S+L+A SMWFSANMVI+AY +GG+GPLV+GLNFGT  L IIF
Sbjct: 69  NAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFGTCVLTIIF 128

Query: 128 FNILGLLPVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQ 187
           F+ILGLLPVAFFSIFGAK GLRQMVLSRFLIGNSTARI +VIN ++ VGWG+VN+VASSQ
Sbjct: 129 FSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGVVNSVASSQ 188

Query: 188 LLNMVNQGPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARLAK 247
           LLNMVNQG H CPLWAGC++IIGATIL+TFFGY  IH++E+W WVPNFA FLVIIARL  
Sbjct: 189 LLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFLVIIARLHM 248

Query: 248 SGNFSNGEWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFSLVAG 307
           SGNFS GEWTSGPTTAGNVLSFG A+FGFATGWT YAADYTVYMPR+TNKFKIFFSLV G
Sbjct: 249 SGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFKIFFSLVGG 308

Query: 308 LSFPLFFVMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCVVLSI 367
           LSFPLFF +ILGAASAMGAVNNP W +YY  NGMGG+TYAILVP+SLHGFGEFCCV+L++
Sbjct: 309 LSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGEFCCVLLAL 368

Query: 368 SIVANNVPNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFMEYFMD 427
           S +ANN+PNMY+I L+VQAIW PLAK+PR  WT+AGN ATL I+IPACY+FD FME FM+
Sbjct: 369 STIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFDGFMEDFMN 428

Query: 428 XXXXXXXXXXXXXXXEHFIYRRSFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMC 487
                          EHFI+RR F+ YNVEDWDDNSKLP+GIAGC A  VG  GVALGM 
Sbjct: 429 SIGYYLAIYSATALAEHFIFRRGFKGYNVEDWDDNSKLPMGIAGCAALFVGAFGVALGMS 488

Query: 488 QTYWTGQIGRLIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532
           QTYW G+I R IGEYGGD+GFELGAGW+F+VY ++RPLE+KY GR
Sbjct: 489 QTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPLEIKYIGR 533

>Scas_704.36
          Length = 545

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/529 (68%), Positives = 428/529 (80%), Gaps = 4/529 (0%)

Query: 6   DANKEIDVGSSYEMNDL--ERNSKDLKSPSKNLSSDYYVDIDSHASEEVLETKLNLFNRI 63
           + N +++  + YEMN    + +S D+K        D Y  I       + ETKL+ FNR 
Sbjct: 19  ERNTDLERETGYEMNSFGEKASSADIKVIPGVPDYDEYESIQ-EPETYMEETKLSFFNRF 77

Query: 64  AAGLSAETKGIEPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTL 123
            A L+AETKG+EP+TDEEK D S++NAASMWFSAN+VIA+YA+GGLGP+VF LNFGTS L
Sbjct: 78  VASLNAETKGVEPVTDEEKTDDSIINAASMWFSANLVIASYALGGLGPIVFNLNFGTSVL 137

Query: 124 VIIFFNILGLLPVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTV 183
           VIIFFNILGLL +AFFS+FGA+ GLRQM+LSR+L+GN TARIF++IN +ACVGWG+VNTV
Sbjct: 138 VIIFFNILGLLSIAFFSVFGAEFGLRQMILSRYLLGNITARIFAIINIIACVGWGVVNTV 197

Query: 184 ASSQLLNMVNQGPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIA 243
           ASSQLLNMVN  P+ CPLWAGC++I+G T+L+TFFGY VIH++EKW WVPNFA FLVIIA
Sbjct: 198 ASSQLLNMVNT-PNNCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPNFAVFLVIIA 256

Query: 244 RLAKSGNFSNGEWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFS 303
           RL  SG F+ GEWTSGPTTAGNVLSFG AVFGFA GWTTYAADYTVYMPR+TNK+ IFFS
Sbjct: 257 RLKMSGAFTGGEWTSGPTTAGNVLSFGGAVFGFAAGWTTYAADYTVYMPRSTNKYTIFFS 316

Query: 304 LVAGLSFPLFFVMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCV 363
           L AGLS PLFF MILGAASAMGAVNNPDW NYY  NGMGG+TYAILVP+SLHGFG+FCCV
Sbjct: 317 LTAGLSLPLFFTMILGAASAMGAVNNPDWMNYYKSNGMGGVTYAILVPDSLHGFGQFCCV 376

Query: 364 VLSISIVANNVPNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFME 423
           +L++S VANN+PNMYTIALSVQA++ P +K+PRV WTMAGN  TLGI+I ACY+F  FME
Sbjct: 377 LLAMSTVANNIPNMYTIALSVQALYQPFSKVPRVAWTMAGNAFTLGISIAACYYFQGFME 436

Query: 424 YFMDXXXXXXXXXXXXXXXEHFIYRRSFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVA 483
            FM+               EHFIYR+ F+ YNVEDW+  SKLPIGIAG  A  VG  GVA
Sbjct: 437 NFMNSIGYYLAIYIAISLSEHFIYRKGFQGYNVEDWNTWSKLPIGIAGTSALIVGAFGVA 496

Query: 484 LGMCQTYWTGQIGRLIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532
           LGM Q+YW G+IG+LIG++GGD+GFELGA W+FIVYN++RPLE+KY GR
Sbjct: 497 LGMSQSYWVGEIGKLIGDHGGDIGFELGASWAFIVYNVLRPLEIKYTGR 545

>YER056C (FCY2) [1485] chr5 complement(266511..268112)
           Cytosine/purine permease, member of the purine/cytosine
           permease family of membrane transporters [1602 bp, 533
           aa]
          Length = 533

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/525 (67%), Positives = 428/525 (81%), Gaps = 9/525 (1%)

Query: 17  YEMNDLERNS----KDLKSPSKNLSSDYYVDIDSHASEEVLE----TKLNLFNRIAAGLS 68
           YE+ DLE+ S      L++  K  +S+ +        + ++E    TKL+ F++  A L+
Sbjct: 9   YEIQDLEKRSPVIGSSLENEKKVAASETFTATSEDDQQYIVESSEATKLSWFHKFFASLN 68

Query: 69  AETKGIEPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIFF 128
           AETKG+EP+T++EK D S+LNAASMWFSANMVIA+YA+G LGP+VFGLNFG S LVIIFF
Sbjct: 69  AETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVIIFF 128

Query: 129 NILGLLPVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQL 188
           NI+GL+ VAFFS+FGA+LGLRQM+LSR+L+GN TARIFS+IN +ACVGWGIVNT  S+QL
Sbjct: 129 NIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSAQL 188

Query: 189 LNMVNQGP-HKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARLAK 247
           LNMVN+G  H CP+WAGC++IIG T+L+TFFGY VIH++EKW WVPNFA FLVIIA+L++
Sbjct: 189 LNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIAQLSR 248

Query: 248 SGNFSNGEWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFSLVAG 307
           SG F  GEW  G TTAG+VLSFGS++FGFA GWTTYAADYTVYMP++TNK+KIFFSLVAG
Sbjct: 249 SGKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFSLVAG 308

Query: 308 LSFPLFFVMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCVVLSI 367
           L+FPLFF MILGAASAM A+N+P W  YY +N MGG+ YAILVPNSL+GFG+FCCV+L++
Sbjct: 309 LAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLAL 368

Query: 368 SIVANNVPNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFMEYFMD 427
           S +ANN+PNMYT+ALS QA+WAPLAKIPRV WTMAGN ATLGI+IPA Y+FD FME FMD
Sbjct: 369 STIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMD 428

Query: 428 XXXXXXXXXXXXXXXEHFIYRRSFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMC 487
                          EHF YRRSF AYN++DWD+   LPIGIAG  A  VG  GVALGMC
Sbjct: 429 SIGYYLAIYIAISCSEHFFYRRSFSAYNIDDWDNWEHLPIGIAGTAALIVGAFGVALGMC 488

Query: 488 QTYWTGQIGRLIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532
           QTYW G+IGRLIG+YGGD+GFELGA W+FI+YN++RPLELKYFGR
Sbjct: 489 QTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILRPLELKYFGR 533

>CAGL0J02948g 282559..284106 highly similar to sp|P40039
           Saccharomyces cerevisiae YER060w or sp|P17064
           Saccharomyces cerevisiae YER056c FCY2, hypothetical
           start
          Length = 515

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/512 (69%), Positives = 415/512 (81%), Gaps = 3/512 (0%)

Query: 24  RNSKDLKSPSKNL--SSDYYVDIDSHASEEVLETKLNLFNRIAAGLSAETKGIEPITDEE 81
            + KDL      +  S++ +V+ D +    VLETKL+L NR+AA +SAETKGIEPITD+E
Sbjct: 4   EDKKDLYDMEMQVESSANSHVETDGYNDATVLETKLSLLNRLAAMISAETKGIEPITDDE 63

Query: 82  KNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIFFNILGLLPVAFFSI 141
           KND SL+NAASMWFSANMV+ A AIGGLGPLVFGLNFG S L I+FFNILGL  VAFFS+
Sbjct: 64  KNDDSLINAASMWFSANMVLPALAIGGLGPLVFGLNFGVSVLTIVFFNILGLFAVAFFSV 123

Query: 142 FGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQLLNMVNQGPHKCPL 201
           FGAK GLRQMVLSR+L+GN TARIF++INSVACVGWGIVNTVA+SQLLN +N G H+ PL
Sbjct: 124 FGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGSHQLPL 183

Query: 202 WAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARLAKSGNFSNGEWTSGPT 261
           W GC+VIIGATIL++FFGY+VIH++EK+ WVPNFA FLV+IARL  SG F NG W SGPT
Sbjct: 184 WGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNGAWGSGPT 243

Query: 262 TAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFSLVAGLSFPLFFVMILGAA 321
           TAG+VLSFGSAVFGFA+GWTTYAADYTVYMPRNTN +KIFF+LVAGL+FPLFF MILG+A
Sbjct: 244 TAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFFTMILGSA 303

Query: 322 SAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCVVLSISIVANNVPNMYTIA 381
            A  AV+   W  +Y++NGMGGLT+AILVP+SLHGFG+FCCVVL++S +ANNVPNMYTIA
Sbjct: 304 CAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNVPNMYTIA 363

Query: 382 LSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFMEYFMDXXXXXXXXXXXXXX 441
           LS Q++W P AKIPRV WTM GN A LGI+IPACY+F TFM+YFMD              
Sbjct: 364 LSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDSIAYYLSIYISIAL 423

Query: 442 XEHFIYRR-SFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMCQTYWTGQIGRLIG 500
            EH IYR  SF  YNVEDW++  KLPIGIAG  +  VG  GVALGM Q+YW G+I R IG
Sbjct: 424 CEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIARHIG 483

Query: 501 EYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532
           EYGGD+  ELGAGW+FI YN+ RPLELKYFGR
Sbjct: 484 EYGGDIAIELGAGWAFIAYNICRPLELKYFGR 515

>YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine
           permease with similarity to Fcy2p, member of the
           purine/cytosine subfamily of the nucleobase:cation
           symporter-1 (NCS1) family [1593 bp, 530 aa]
          Length = 530

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/522 (66%), Positives = 418/522 (80%), Gaps = 6/522 (1%)

Query: 12  DVGSSYEMNDLERNSKDLKSPSKNLSSDYYVDIDSHASEEVLETKLNLFNRIAAGLSAET 71
           D GS  E+ DLE  + D KS + ++   YY  ++ H + E ++ K + FNRIAA L+AET
Sbjct: 14  DAGS--ELRDLESGALDTKSSAADV---YYEGVELHRTNEFIDNKPSFFNRIAAALNAET 68

Query: 72  KGIEPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIFFNIL 131
           KGIEP+T++EKND S+LNAA++WFSANMVI AY++G LGPLVFGLNFG S LVIIFFNIL
Sbjct: 69  KGIEPVTEDEKNDDSILNAATIWFSANMVIVAYSVGALGPLVFGLNFGQSVLVIIFFNIL 128

Query: 132 GLLPVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQLLNM 191
           GL+PVA FS+FG +LGLRQM+LSR+L GN TAR FS++N +ACVGW ++N   S+QLLNM
Sbjct: 129 GLIPVALFSLFGVELGLRQMILSRYLAGNITARFFSLVNVIACVGWCVLNISVSAQLLNM 188

Query: 192 VNQGP-HKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARLAKSGN 250
           VN+G  H CP+WAGC++I G T+L+TFFGY V+H++EKW WVPNFA FLVIIA+L++SG 
Sbjct: 189 VNEGSGHNCPIWAGCLIIAGGTVLVTFFGYSVVHAYEKWSWVPNFAAFLVIIAQLSRSGK 248

Query: 251 FSNGEWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFSLVAGLSF 310
           F  GEW  G TTAG VLSFGS+VFG A GW TYAADYTVYMP+ T+K+KIFFS+VAGL+F
Sbjct: 249 FKGGEWVGGATTAGGVLSFGSSVFGSAAGWATYAADYTVYMPKTTSKYKIFFSVVAGLAF 308

Query: 311 PLFFVMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCVVLSISIV 370
           PLFF MILGAA  M A+N+P W +YY +N MGG+ YAILVPNSL+GFG+FCCV+L++S V
Sbjct: 309 PLFFTMILGAACGMAALNDPTWKSYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLALSTV 368

Query: 371 ANNVPNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFMEYFMDXXX 430
           ANNVP MYT+ALS QA+WAPLAKIPRV WTMAGN ATLGI+IPA Y+FD FME FMD   
Sbjct: 369 ANNVPGMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMDSIG 428

Query: 431 XXXXXXXXXXXXEHFIYRRSFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMCQTY 490
                       EHFIYRRSF AYN++DWD+   LPIGIAG  A   G  GVALGMCQTY
Sbjct: 429 YYLAIYIAIACSEHFIYRRSFSAYNIDDWDNWEHLPIGIAGTAALIAGAFGVALGMCQTY 488

Query: 491 WTGQIGRLIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532
           W G+I RLIGEYGGD+GFELG  W+FI+YN+VRPLELKYFGR
Sbjct: 489 WVGEISRLIGEYGGDIGFELGGSWAFIIYNIVRPLELKYFGR 530

>CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomyces
           cerevisiae YER056c FCY2 purine-cytosine permease or
           sp|P40039 Saccharomyces cerevisiae YER060w FCY21,
           hypothetical start
          Length = 543

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/525 (64%), Positives = 425/525 (80%), Gaps = 7/525 (1%)

Query: 15  SSYEMNDLERNS-KDLKSPSKNLSS---DYYVDI-DSHASEEVLETKLNL--FNRIAAGL 67
           + YE+N++E+   +D+K+ + N +    DY  D  +S  +  V ETKL L   +R+A  +
Sbjct: 19  NDYELNEVEKQPVEDVKTTNVNTNDFEYDYGDDFTNSSEAATVEETKLKLGFISRLALKM 78

Query: 68  SAETKGIEPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIF 127
           +AETKG+EP+TDEEK D S+LNAASMWFSAN+V+A+YA+G LGP+VF LNFGTS L I+F
Sbjct: 79  NAETKGVEPVTDEEKTDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTSVLTIVF 138

Query: 128 FNILGLLPVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQ 187
           FN++GL+ VAFFS+FGA+ GLRQM+LSRFL+GN TAR+F+ IN VACVGWG+VNTV ++Q
Sbjct: 139 FNMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVNTVVAAQ 198

Query: 188 LLNMVNQGPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARLAK 247
           LL++VNQG H+ PLW GC+VI+G T+++TFFGY +IH++E+W WVPNFA FLVIIARL K
Sbjct: 199 LLHIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVIIARLHK 258

Query: 248 SGNFSNGEWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFSLVAG 307
           SG FSNG WTSG TTAG VLSFGSA++GFA GWTTYAADYTVYMPR  NKFKIFF L AG
Sbjct: 259 SGQFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYMPRTMNKFKIFFFLCAG 318

Query: 308 LSFPLFFVMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCVVLSI 367
           L+FPL F MILGAASAMGAVNNP+W   Y ++ MGGLTYAILVPNSLHGFGEFCCV+L++
Sbjct: 319 LAFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVPNSLHGFGEFCCVLLAM 378

Query: 368 SIVANNVPNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFMEYFMD 427
           S +ANN+PNMYTIALSVQA++ P +++PRV WT+AGN A +GI+IPA Y+F+ F+E FMD
Sbjct: 379 STIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGISIPASYYFEGFLENFMD 438

Query: 428 XXXXXXXXXXXXXXXEHFIYRRSFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMC 487
                          EHFIYRR F+ YN+EDW++  +LPIGIAGC A  VG  GVALGM 
Sbjct: 439 SIGYYLAIYIAISLSEHFIYRRGFKGYNIEDWNNWDRLPIGIAGCSALFVGAFGVALGMS 498

Query: 488 QTYWTGQIGRLIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532
           QTYWTG+I R IG++GGD+GFELG  W+FIV+N+VRPLE+KYFGR
Sbjct: 499 QTYWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRPLEIKYFGR 543

>Sklu_1893.2 YER056C, Contig c1893 1725-3266
          Length = 513

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/518 (62%), Positives = 397/518 (76%), Gaps = 10/518 (1%)

Query: 15  SSYEMNDLERNSKDLKSPSKNLSSDYYVDIDSHASEEVLETKLNLFNRIAAGLSAETKGI 74
             Y + D+E+     ++P +   +D      +   E    T ++  +R AA L AETKGI
Sbjct: 6   EEYAIQDMEK-----QNPLELTETD-----STPVVESTEYTTVSFIDRWAAKLKAETKGI 55

Query: 75  EPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIFFNILGLL 134
           EPITDEEK+D S+LNAASMWFSANMVIAAYA+G LG  VFGLNF  S L IIFF+ LGL+
Sbjct: 56  EPITDEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGLI 115

Query: 135 PVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQLLNMVNQ 194
           PVAFFS+FGA+LG+RQMVLSRFL+GN TARIF++IN +ACVGWG VNT+AS+ LL+M+N 
Sbjct: 116 PVAFFSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLHMINP 175

Query: 195 GPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARLAKSGNFSNG 254
           G  +CP WA C++I+ +TI++TFFGYRVIH++EKW WVPNFA FLVIIARL  SGNFS G
Sbjct: 176 GGAQCPPWAACLIIVFSTIIVTFFGYRVIHAYEKWSWVPNFAVFLVIIARLKISGNFSTG 235

Query: 255 EWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFSLVAGLSFPLFF 314
           EWTSG TTAG VLSFG ++FGFA+GWTTYAADYTVYMPR+TNK+KIFF+LV GL+FPL F
Sbjct: 236 EWTSGATTAGGVLSFGGSIFGFASGWTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLCF 295

Query: 315 VMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCVVLSISIVANNV 374
            +ILGAAS  G   N  W  YY ++ +GGL YAILV +SLHGFGEFCCV+L++S VANN+
Sbjct: 296 SLILGAASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANNI 355

Query: 375 PNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFMEYFMDXXXXXXX 434
           PNMY+IAL  Q++W PLAK+PRVFWT+AGN  TL IAIPA Y F++FM  FM+       
Sbjct: 356 PNMYSIALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEAIAYYLA 415

Query: 435 XXXXXXXXEHFIYRRSFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMCQTYWTGQ 494
                   EHF YR+ F+ YNV+DW+   +LPIG AGC A  +G  GVA GM QTYW GQ
Sbjct: 416 IYIAISLSEHFFYRKGFKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVAFGMSQTYWEGQ 475

Query: 495 IGRLIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532
           I R IGEYGGD+GFELG G+SFI YN++RPLE+KY GR
Sbjct: 476 IARHIGEYGGDIGFELGMGFSFITYNILRPLEIKYTGR 513

>Kwal_23.5819
          Length = 516

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/515 (61%), Positives = 400/515 (77%), Gaps = 3/515 (0%)

Query: 21  DLERNSKDLKSPSKNLSSDYYV-DIDSHASEEVLE-TKLNLFNRIAAGLSAETKGIEPIT 78
            L++   +++   K L+S + + D DS    E  E TKL++ +RIAA L AETKGIEP+T
Sbjct: 2   SLQKEEYEIQDVEKRLNSRFEISDDDSQPVVESTEYTKLSIVDRIAASLRAETKGIEPVT 61

Query: 79  DEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIFFNILGLLPVAF 138
           +EEK+D S+ NAASMWFSANMVIAA+++G LGP+V+GLNF    L ++ F+ LG++PVA+
Sbjct: 62  EEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIPVAY 121

Query: 139 FSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQLLNMVNQGPHK 198
           +S+FGA+LGLRQMVLSRFL+GN TARIF++IN +ACVGWG VNT+AS+QLL+M+N G  +
Sbjct: 122 YSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPGGAR 181

Query: 199 CPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARLAKSGNFSNGEWTS 258
           CP WAGC++I+ +TIL+TFFGYRVIH++EKW W+PNFA FLVIIARL   G+FS+GEW S
Sbjct: 182 CPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKIDGSFSSGEWIS 241

Query: 259 GPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFSLVAGLSFPLFFVMIL 318
           G   A  VLSFG  +FGFA+GWTTYAADYTVYMPR TNK K+FF+++ GL FPL F +IL
Sbjct: 242 GTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFSIIL 301

Query: 319 GAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCVVLSISIVANNVPNMY 378
           GAA+AM + NN ++A  +   G+GGL YAILV NSLHGFG+FCCV+L++S VANN+PNMY
Sbjct: 302 GAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIPNMY 361

Query: 379 TIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFMEYFMDXXXXXXXXXXX 438
           +IAL  QA+W PLAKIPRVFWTMAGN  TL IAIPA Y F++FM  FMD           
Sbjct: 362 SIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSIYIG 421

Query: 439 XXXXEHFIYRR-SFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMCQTYWTGQIGR 497
               EH  +R+ +F  YNV+DW+   KLPIG AGCCA  VG +GVA+GM QTYWTGQI R
Sbjct: 422 ISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYAGCCALFVGAVGVAVGMEQTYWTGQIAR 481

Query: 498 LIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532
            IG+YG D+GFE+G  +S IVYN++RPLELKY GR
Sbjct: 482 KIGDYGADIGFEIGFCFSVIVYNILRPLELKYVGR 516

>Scas_715.47d1
          Length = 523

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/519 (58%), Positives = 382/519 (73%), Gaps = 2/519 (0%)

Query: 15  SSYEMNDLERNSKDLKSPSKNLSSDYYVDIDSHASEEVLETKLNLFNRIAAGLSAETKGI 74
           SS++  DLE+      + ++ +S+D   + D   +     + +    +IA  L+AET+GI
Sbjct: 6   SSFKTTDLEKQDPAFVA-NEAISNDTTGEDDFSKTVSSEASNIAFLQKIATRLNAETRGI 64

Query: 75  EPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIFFNILGLL 134
           EP+ D+EK DA++ N   +WFSAN VI+AYA+G LGP+VFGLNFG ++L I+FFNI+G++
Sbjct: 65  EPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVV 124

Query: 135 PVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQLLNMVNQ 194
           PVA+FS+FG +LGLRQMVLSR+L+GN   R FS IN +ACVGW ++N++ S+QLLNMVN 
Sbjct: 125 PVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNL 184

Query: 195 GPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARLAKSGNFSNG 254
             H+CP WAG +V++  TIL+TFFG +VI +FE+W WVPN A FLVIIARL KSG FS G
Sbjct: 185 HGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVIIARLHKSGQFSGG 244

Query: 255 EWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFSLVAGLSFPLFF 314
           +WTSGPTTAGNVLS G   +G+A  W TY+ADYTVYMPRNTNK K+FF L   L+ PL F
Sbjct: 245 KWTSGPTTAGNVLSLGCVAYGYAGAWATYSADYTVYMPRNTNKVKLFFGLCVALTVPLCF 304

Query: 315 VMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCVVLSISIVANNV 374
            MILGAA  MG VNN  WA YYS NG+GGLTY +LVPNS+HGFGEFCCV+L++S +ANN 
Sbjct: 305 TMILGAAVGMGGVNNATWAKYYSSNGIGGLTYEVLVPNSVHGFGEFCCVLLALSTIANNT 364

Query: 375 PNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFMEYFMDXXXXXXX 434
           PNMYT+  S QAIW PLA++PR F T+ GN A   +   ACY+FD+FME FMD       
Sbjct: 365 PNMYTLGFSFQAIWEPLARVPRAFCTLFGNAAVFVVGCCACYYFDSFMEKFMDTLAYYGA 424

Query: 435 XXXXXXXXEHFIYRR-SFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMCQTYWTG 493
                   EH I+R+ SF+AY+V+DW   SKLPIGIAG   F V   GVALGMCQ+YW G
Sbjct: 425 IYISLGMAEHLIFRKCSFKAYDVKDWKTFSKLPIGIAGGVGFFVAAFGVALGMCQSYWVG 484

Query: 494 QIGRLIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532
           +IGR IG+ GGD+GFE+GA W FI Y LVRPLELKYFGR
Sbjct: 485 EIGRRIGKDGGDVGFEMGAAWGFIAYVLVRPLELKYFGR 523

>KLLA0C08283g complement(725563..727122) similar to sp|P17064
           Saccharomyces cerevisiae YER056c FCY2 purine-cytosine
           permease, start by similarity
          Length = 519

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/518 (60%), Positives = 382/518 (73%), Gaps = 6/518 (1%)

Query: 15  SSYEMNDLERNSKDLKSPSKNLSSDYYVDIDSHASEEVLETKLNLFNRIAAGLSAETKGI 74
             Y ++D+E      K        D  ++ +    E    TKL+  + +A+ L AETKGI
Sbjct: 8   EEYVLHDVE------KQELSKTQFDEVLEEEPVIVETTEVTKLSWVDHLASKLHAETKGI 61

Query: 75  EPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIFFNILGLL 134
           EPITD+EK+D  +LNAASMW SAN+VIAA+++G +G  VFGLNFG + LVI+FF+ LGLL
Sbjct: 62  EPITDDEKDDDDILNAASMWLSANLVIAAFSLGCIGTSVFGLNFGEAVLVIVFFSFLGLL 121

Query: 135 PVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQLLNMVNQ 194
           PVAFFS+FGA+LGLRQ+VLSRFL+GN TARIF  IN +ACVGWG VNT+AS+ LL++VN 
Sbjct: 122 PVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACVGWGAVNTIASASLLHIVNP 181

Query: 195 GPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARLAKSGNFSNG 254
               CP WAGC++II  TI++TFFGYRVIH++EKW WVPNFA FLVIIARLAK+G F+ G
Sbjct: 182 SGPDCPPWAGCLIIIFGTIIVTFFGYRVIHAYEKWSWVPNFAVFLVIIARLAKAGTFTAG 241

Query: 255 EWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFSLVAGLSFPLFF 314
            W SG TTAG VLSFGS+VFGFATGWTTYA+DYTVYMPR TNK K+F ++V GL+FPL F
Sbjct: 242 SWGSGSTTAGGVLSFGSSVFGFATGWTTYASDYTVYMPRTTNKKKVFAAIVLGLAFPLCF 301

Query: 315 VMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCVVLSISIVANNV 374
            MILGAA+  G   N  WA  Y +  +GGL YAIL+ +SL GFG FCCVVL++S ++NN+
Sbjct: 302 SMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLWGFGSFCCVVLALSTISNNI 361

Query: 375 PNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFMEYFMDXXXXXXX 434
           PNMY+IAL  QA++ PLAK+PRV WT+ GN  TL IAIPA Y F+TFM  FMD       
Sbjct: 362 PNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFETFMTTFMDSIGYYLA 421

Query: 435 XXXXXXXXEHFIYRRSFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMCQTYWTGQ 494
                   EHFIYR  F+ YNV+DWD   KLPIG AG  A  +G  GVA GM Q YW GQ
Sbjct: 422 IYSAIALSEHFIYRGGFKGYNVDDWDRWDKLPIGYAGTFALFIGAFGVAFGMNQIYWQGQ 481

Query: 495 IGRLIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532
           IGRLIGE GGD+GFELGAG++FI YN+ RPLE KY GR
Sbjct: 482 IGRLIGENGGDIGFELGAGFAFITYNIFRPLEKKYVGR 519

>Kwal_34.15730
          Length = 518

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/519 (57%), Positives = 383/519 (73%), Gaps = 5/519 (0%)

Query: 15  SSYEMNDLERNSKDLKSPSKNLSSDYYVDIDSHASEEVLETKLNLFNRIAAGLSAETKGI 74
             YE+ DLE N        +N S+D      S A E++    + + NR+A  L AETKGI
Sbjct: 4   DKYEVQDLELNVYS----QENTSADDATRGSSQAPEKLNGGGMAVLNRLAKKLRAETKGI 59

Query: 75  EPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIFFNILGLL 134
           EP+T++EK+D+S+ NAA +WFSANMVIAA+++G LGPLVF LNF    + I+ F  +G+L
Sbjct: 60  EPVTEDEKDDSSIWNAAFVWFSANMVIAAFSVGMLGPLVFSLNFWGCVVSIVIFTFIGVL 119

Query: 135 PVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQLLNMVNQ 194
           PV  +S+FG +L LRQMVLSRFL+GN TARIF++IN +AC+GWG+VNTV S+QLL+M+N 
Sbjct: 120 PVCLYSVFGVQLSLRQMVLSRFLLGNVTARIFALINVIACIGWGVVNTVTSAQLLHMINP 179

Query: 195 GPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARLAKSGNFSNG 254
              +CP WAGC++I+ +TI +TFFGYRVIH+F K+ W+PNF  F+VIIARL   G+FS G
Sbjct: 180 TGGRCPPWAGCLIIVFSTIFVTFFGYRVIHTFGKYSWIPNFIVFIVIIARLKIDGSFSVG 239

Query: 255 EWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFSLVAGLSFPLFF 314
           +W SG TTAG++LS G  VFGFATGWTTYAAD+TVYMPR  N+ ++FF+++ GL FPL F
Sbjct: 240 KWESGSTTAGSILSLGGIVFGFATGWTTYAADFTVYMPRTVNRAEVFFAVMLGLVFPLCF 299

Query: 315 VMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCVVLSISIVANNV 374
            +ILGAA+   A+NNP +  +Y  +  GGL YAILVP SLHGFG+FCCV+L++S VAN V
Sbjct: 300 TIILGAAAGCAALNNPVYHEFYESDHAGGLVYAILVPRSLHGFGQFCCVLLAMSTVANMV 359

Query: 375 PNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFMEYFMDXXXXXXX 434
           PNMY+IAL  QA+W PLAK+PRVFWT+AGN  TL IAIPA Y F+ FM  FMD       
Sbjct: 360 PNMYSIALGTQALWEPLAKVPRVFWTLAGNLITLAIAIPAYYRFEAFMTNFMDSIAYYLS 419

Query: 435 XXXXXXXXEHFIYRR-SFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMCQTYWTG 493
                   EHFI+R+  F  Y+  +W+D  +LP+G AGC A  VG IGVALGM QTYWTG
Sbjct: 420 IYIGVSLSEHFIFRQNKFSNYDTSEWNDWHRLPLGYAGCAALFVGAIGVALGMHQTYWTG 479

Query: 494 QIGRLIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532
           +IGRLIGE+GGD+GFELG  +S IVY  +RPLE+K+ GR
Sbjct: 480 EIGRLIGEFGGDIGFELGLAFSMIVYTALRPLEIKFVGR 518

>CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces
           cerevisiae YER060w or sp|P17064 Saccharomyces cerevisiae
           YER056c, hypothetical start
          Length = 540

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/512 (54%), Positives = 361/512 (70%), Gaps = 5/512 (0%)

Query: 21  DLERNSKDLKSPSKNLSSDYYVDIDSHASEEVLETKLNLFNRIAAGLSAETKGIEPITDE 80
           DLE      K     L +      ++   E   ++   ++  +   L+AETKG+EPI + 
Sbjct: 34  DLELKDITFKEKFNELDNK---STETDKDETCFKSPFIIW--LKRTLNAETKGVEPINEN 88

Query: 81  EKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIFFNILGLLPVAFFS 140
           EKND ++  ++ +WFSAN+V+AAY +G LGP V+ LNF  S L I+FFNILGL+ V+FFS
Sbjct: 89  EKNDTNIFGSSFVWFSANLVLAAYGVGSLGPTVYHLNFAISVLTIVFFNILGLVSVSFFS 148

Query: 141 IFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQLLNMVNQGPHKCP 200
           +FGA+LGLRQM++SR+L+GN TARIF+ +N + CVGW ++N   +++L  ++  G +  P
Sbjct: 149 VFGAELGLRQMIISRYLVGNVTARIFAALNCIGCVGWDVLNIYLAAKLFAIIKTGGNHLP 208

Query: 201 LWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARLAKSGNFSNGEWTSGP 260
           LW GCIVI+G+T+ I   GY+ IH +EKW W+PN A FL+II+R+  S  FSNG WTSG 
Sbjct: 209 LWGGCIVIVGSTVFIAALGYKFIHIYEKWSWIPNLAVFLIIISRIKISREFSNGPWTSGS 268

Query: 261 TTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFSLVAGLSFPLFFVMILGA 320
           TTAGNVLSFGSA+FG A GW TY+ADYTVYMPR TNKF+IFF    GL+F L F MI+GA
Sbjct: 269 TTAGNVLSFGSAIFGSAAGWVTYSADYTVYMPRRTNKFRIFFFNSIGLAFSLIFTMIVGA 328

Query: 321 ASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCVVLSISIVANNVPNMYTI 380
           A+ + AVNN  W   Y+E  +GG+TYA+LVPNSLHGFG+FCCV+L++S VANNVP+MYTI
Sbjct: 329 AAGICAVNNSKWMELYNEFQIGGVTYALLVPNSLHGFGKFCCVILAMSTVANNVPSMYTI 388

Query: 381 ALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFMEYFMDXXXXXXXXXXXXX 440
           ALSVQA+W PL  +PR  WT+  N   LGI+IPACYFF +FM+ FM              
Sbjct: 389 ALSVQALWEPLTSVPRAIWTIFANIVVLGISIPACYFFQSFMQNFMGSIGYFYALYIGIS 448

Query: 441 XXEHFIYRRSFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMCQTYWTGQIGRLIG 500
             EH ++RR F  YNV D  +  KLPIG AGC A  VG  GVALGM QTYW G+I R IG
Sbjct: 449 LAEHCVFRRKFGNYNVNDHSNWEKLPIGFAGCIALIVGSFGVALGMAQTYWVGEIARKIG 508

Query: 501 EYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532
            YGGD+GFELG  W+F+ Y ++RP+E+KY+GR
Sbjct: 509 TYGGDIGFELGMSWAFLTYIIIRPIEIKYYGR 540

>ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH]
           complement(551981..553555) [1575 bp, 524 aa]
          Length = 524

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/527 (53%), Positives = 370/527 (70%), Gaps = 11/527 (2%)

Query: 9   KEIDVGSSYEMNDLERNSKDLKSPSKNLSSDYYVDIDSHASEEVLETK---LNLFNRIAA 65
           ++    SS  +   + +  DL+     LS     D +   + +V ET+   L+  NR AA
Sbjct: 6   EQYGTRSSMSLTKDDGSYGDLEKKKGFLS-----DAEEPVTPQVDETEYTTLSWVNRWAA 60

Query: 66  GLSAETKGIEPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVI 125
            L+AETKG+ P+T++E +D+SLLNAASMWFSAN+VIAA+A+G L   VF LN   + L  
Sbjct: 61  RLNAETKGVSPVTEDECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLAT 120

Query: 126 IFFNILGLLPVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVAS 185
           + F+ +G+L VAFFS+FGA+ GLRQM+LSR+L+GN+TARIF +IN +ACVGW  VNT+AS
Sbjct: 121 VVFSFMGVLAVAFFSVFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIAS 180

Query: 186 SQLLNMVNQGPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARL 245
           + LL+M+N    +CP WA  ++I+ +T+ ITFFGYRVIH++EKW WVPN   FL+IIARL
Sbjct: 181 TTLLHMINPTGARCPPWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARL 240

Query: 246 AKSGNFSNGEWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFSLV 305
           A +GNF+ G    G  TAG+ LS+GS VFGFA+GWTTYAADYTVYMP+N+NK++IFF ++
Sbjct: 241 AIAGNFTAGSSLGGKATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMI 300

Query: 306 AGLSFPLFFVMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCVVL 365
           AGL+ PL F +ILGAA+      NP W  YY ++ +GGL +AIL  N+L GFG+FCCVVL
Sbjct: 301 AGLATPLLFTLILGAAAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVL 360

Query: 366 SISIVANNVPNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFMEYF 425
           ++S VANN+PNMY+IALS QA+W+  A++PRVFWT+ GN  +L IAI A Y F+TFM  F
Sbjct: 361 AMSTVANNIPNMYSIALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSF 420

Query: 426 MDXXXXXXXXXXXXXXXEHFIYRRSFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALG 485
           MD               EHF++R+ F  Y+V  WD    LP G AGC A  VG +GVA+G
Sbjct: 421 MDSIGYYLSIYIVICVTEHFVFRKGFRGYDVSHWDRPDLLPAGYAGCAALCVGAVGVAMG 480

Query: 486 MCQTYWTGQIGRLIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532
           M   Y+TG I +L    GGD+GF L AG+SFIVY   RPLELKY GR
Sbjct: 481 MSHEYYTGPIAKLA---GGDIGFLLAAGFSFIVYICCRPLELKYTGR 524

>Scas_715.54d
          Length = 232

 Score =  255 bits (651), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 167/227 (73%), Gaps = 1/227 (0%)

Query: 15  SSYEMNDLERNSKDLKSPSKNLSSDYYVDIDSHASEEVLETKLNLFNRIAAGLSAETKGI 74
           SS++  DLE+      + ++ +S+D   + D   +     + +    +IA  L+AET+GI
Sbjct: 7   SSFKTTDLEKQDPAFVA-NEAISNDTTSEDDFSKTVSSEASNIAFLQKIATRLNAETRGI 65

Query: 75  EPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIFFNILGLL 134
           EP+ D+EK DA++ N   +WFSAN VI+AYA+G LGP+VFGLNFG ++L I+FFNI+G++
Sbjct: 66  EPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVV 125

Query: 135 PVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQLLNMVNQ 194
           PVA+FS+FG +LGLRQMVLSR+L+GN   R FS IN +ACVGW ++N++ S+QLLNMVN 
Sbjct: 126 PVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNL 185

Query: 195 GPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVI 241
             H+CP WAG +V++  TIL+TFFG +VI +FE+W WVPN A FLVI
Sbjct: 186 HGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232

>KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, hypothetical start
          Length = 523

 Score =  226 bits (576), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 163/526 (30%), Positives = 247/526 (46%), Gaps = 47/526 (8%)

Query: 49  SEEVLETKLNLFNRIAA----------GLSAETKGIEPITDEEKNDA-SLLNAASMWFSA 97
             EV  T+ ++F R A+           L  E +GI+ I   E+  A    + A +W SA
Sbjct: 3   KSEVEVTERSIFVRSASSIRQFSDKLDALGVEARGIQRIQPYERGTAKQFWHVAGLWLSA 62

Query: 98  NMVIAAYAIGGLGPLVFGLNFGTSTLVIIFFNILGLLPVAFFSIFGAKLGLRQMVLSRFL 157
              +++ +   LGP+VF L F    +  +    +G    A+ S+ G + G RQ+V +R+L
Sbjct: 63  AGGLSSMSSYFLGPMVFQLTFNQCLVSGLISMWIGCGVAAYCSVMGPQSGCRQIVTARYL 122

Query: 158 IGNSTARIFSVINSVACVGWGIVNTVASSQLLNMVNQGPHKCPLWAGCIVIIGATILITF 217
            G    +  ++   V  +GW IVN V   Q+L  V+ G  K PLW G I++   ++L++ 
Sbjct: 123 FGWWFVKFIALAAIVGVMGWSIVNCVVGGQMLASVSDG--KVPLWVGIIIVTVVSLLVSI 180

Query: 218 FGYRVIHSFEKWIWVPNFACFLVIIA----RLAKSGNFSNGEWTSGPTTAGNVLSFGSAV 273
           FG + +   E    VP    FL++      +      FSN +  S  T  G  LSF S  
Sbjct: 181 FGIKQVLKVETLFAVPVLTSFLLLYISASDKFKYLYEFSNSDIDS-LTVKGCWLSFFSLC 239

Query: 274 FGFATGWTTYAADYTVYMPRNTNKFKIFFSLVAGLSFPLFFVMILGAASAMGAVNNPDWA 333
           +   + W +  ADY +  P +T + ++F     G + P  FV +LG   A  +++   W 
Sbjct: 240 YSITSTWGSITADYYILFPEDTPQIQVFLLTFFGTAVPTTFVGVLGLLLASCSLSYEPWQ 299

Query: 334 NYYSENGMGGLTYAILVPNSLHGFGEFCCVVLSISIVANNVPNMYTIALSVQAIWAPLAK 393
             Y E GMGGL  A    +  +GFG+F  VVL +S+++NN+ N Y+ A S+Q     LAK
Sbjct: 300 AAYDEYGMGGLMNAGF--SRWNGFGKFLVVVLILSLISNNIVNTYSAAFSIQLSSVMLAK 357

Query: 394 IPRVFWTMAGNFATLGIAIPACYFFDTFMEYFMDXXXXXXXXXXXXXXXEHFIYR----- 448
           +PR  W +      L  A+     F T +  F+                E+ I+R     
Sbjct: 358 VPRWIWAIGCTIFYLVCALVGRNSFSTILGNFLPMIGYWISMYFILLVEENVIFRNWFHH 417

Query: 449 ----------------------RSFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGM 486
                                 R    YN ++WD++  +  G+A   AF +GV GV LGM
Sbjct: 418 LYKLEFPNDIEVKPHHKLRKLPRHIHRYNWDEWDNSEVITRGLAASAAFCIGVAGVVLGM 477

Query: 487 CQTYWTGQIGRLIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532
           CQTY+ G +   IGEYGGDLG  LG G++ + Y  +R  ELK FGR
Sbjct: 478 CQTYYVGPLAAKIGEYGGDLGMWLGMGFAGVSYPPLRYCELKKFGR 523

>Kwal_47.17216
          Length = 542

 Score =  224 bits (570), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 155/516 (30%), Positives = 237/516 (45%), Gaps = 44/516 (8%)

Query: 56  KLNLFNRIAAGLSAETKGIEPITDEEK-NDASLLNAASMWFSANMVIAAYAIGGLGPLVF 114
           KL++ ++    L  E +GI+ I   E+      L+ A +W SA   +++ +   LGPL+F
Sbjct: 32  KLSVASKRLDALGVEIRGIQRIPAYERGTSKQFLSVAGLWLSAAGGLSSMSSYFLGPLLF 91

Query: 115 GLNFGTSTLVIIFFNILGLLPVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVAC 174
            L F  S +  +    +G    A+ S  G + G RQMV +R+L G    +  S+ + +  
Sbjct: 92  ELTFRQSLVSGLVSMAIGCAVAAYLSTMGPQSGCRQMVTARYLFGWYFVKFVSLASIIGV 151

Query: 175 VGWGIVNTVASSQLLNMVNQGPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPN 234
           +GW IVN V   Q+L  ++    K PLW G I++   + ++  FG + +   E ++ VP 
Sbjct: 152 MGWSIVNCVVGGQMLAAISNS--KIPLWVGIIIVTAVSFIVAIFGIKQVLRVETFLSVPV 209

Query: 235 FACFLVIIARLAKS----GNFSNGEWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVY 290
             CFL++    +        F N +     T  GN LSF S  +   + W +  ADY + 
Sbjct: 210 LTCFLLLYIAASDKYYLLDTFKNDD-IDPLTIKGNWLSFFSLCYSITSTWGSITADYYIL 268

Query: 291 MPRNTNKFKIFFSLVAGLSFPLFFVMILGAASAMGAVNNPDWANYYSENGMGGLTYAILV 350
            P +T  +K+F     G   P  FV +LG   A  A +   W   Y + GMGGL ++   
Sbjct: 269 FPEDTAHYKVFLLTFFGTLIPTTFVGVLGLILASCAASYEPWKAAYHKYGMGGLLFSGF- 327

Query: 351 PNSLHGFGEFCCVVLSISIVANNVPNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGI 410
               +GFG+FC VVL  S+++NN+ N Y+ A ++Q     +A++PR  W +A     L  
Sbjct: 328 -ERWNGFGKFCVVVLIFSLISNNIINTYSAAFNIQLSSVHMARVPRWLWAIACTIFYLVC 386

Query: 411 AIPACYFFDTFMEYFMDXXXXXXXXXXXXXXXEHFIYRRSF------------------- 451
           A+     F   +  F+                E+ I+R  F                   
Sbjct: 387 ALVGRNHFSEILGNFLPMIGYWISMYFIILLEENLIFRSHFRHLYTEEFPPHPVEEGESP 446

Query: 452 ---------------EAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMCQTYWTGQIG 496
                           AYN E W++   L  G A   AF VGV GVAL M Q YW G I 
Sbjct: 447 RALRDIKNKKVSSRKHAYNWEMWNNAEVLTHGYAATFAFLVGVGGVALSMAQAYWIGPIA 506

Query: 497 RLIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532
           R  G++GGDLG  +  G+S  VY  +R  EL+++GR
Sbjct: 507 RHFGDFGGDLGMWVSMGFSGTVYPALRYWELRHYGR 542

>YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of the
           purine/cytosine permease family of membrane transporters
           [1740 bp, 579 aa]
          Length = 579

 Score =  189 bits (479), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 165/582 (28%), Positives = 263/582 (45%), Gaps = 64/582 (10%)

Query: 6   DANKEIDVGSSYEMNDLERNSKDLKSPSKNLSSDYYVDIDSHASEEVLETKLNL---FNR 62
           D  K  +  + +  + +E   +   + S N++++      +++S  +L   +N     ++
Sbjct: 7   DTTKRKEDHTKHTTDVIEFYEEGTAASSLNIATE-----KANSSPSILRRIINRAAWLSK 61

Query: 63  IAAGLSAETKGIEPITDEEK--NDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGT 120
               +  E+ GI+ I+  E+  +    L+ A +W SA   +++ +   LGPL+FGL+F  
Sbjct: 62  KVDAMGVESTGIQRISPYERGTSKKQFLHVAGLWLSATGGLSSMSSFLLGPLLFGLSFRE 121

Query: 121 STLVIIFFNILGLLPVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIV 180
           S    +    +G L  A+ SI G + G RQMV +R+L G    ++ ++ + +  +GW +V
Sbjct: 122 SVASSLISVTIGCLIAAYCSIMGPQSGCRQMVTARYLFGWWFVKLVALASIIGVMGWSVV 181

Query: 181 NTVASSQLLNMVNQGPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLV 240
           N+V   ++L  ++    K PLW G +++   + L+  FG + +   E ++ VP    FL+
Sbjct: 182 NSVVGGEMLAAISN--DKVPLWVGIVIVTVCSFLVAIFGIKQVIKVETYLSVPVLTAFLL 239

Query: 241 IIARLAKSGNFSNGEWTSG----PTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTN 296
           +    +   +F N   + G     T  GN +SF S  +     W +  ADY +  P +T 
Sbjct: 240 LYISSSDKYSFVNAYVSKGNLDSSTRKGNWMSFFSLCYSITATWGSITADYYILFPEDTP 299

Query: 297 KFKIFFSLVAGLSFPLFFVMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHG 356
             +IF     G   P  FV ILG   A  A++   W+  Y  +GMGGL +A       +G
Sbjct: 300 YIQIFCLTFFGTFLPTCFVGILGLLLASVAMSYKPWSVEYDSHGMGGLLWAGF--QRWNG 357

Query: 357 FGEFCCVVLSISIVANNVPNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACY 416
           FG+FC VVL  S+V+NN+ N Y+ A S+Q      AKIPR FW++      L  A+    
Sbjct: 358 FGKFCVVVLVFSLVSNNIINTYSAAFSIQLSSVFCAKIPRWFWSIVCTIICLVCALIGRN 417

Query: 417 FFDTFMEYFMDXXXXXXXXXXXXXXXEHFIYRRSF------------------------- 451
            F T +  F+                E+ ++RR F                         
Sbjct: 418 HFSTILGNFLPMIGYWISMYFILLFEENLVFRRFFLHLYTKEFPTVTGEINGPELVGSSK 477

Query: 452 ---------------------EAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMCQTY 490
                                  YN + W+D   L  G A   AF VGV GV +GM Q Y
Sbjct: 478 EVEKDAVTNIHLLKRKHKVTKHRYNWDKWEDYEVLTHGYAATFAFIVGVAGVVVGMAQAY 537

Query: 491 WTGQIGRLIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532
           W G I    GEYGGD+   L   +S +VY   R LEL+ FGR
Sbjct: 538 WIGPIAAKFGEYGGDVAMWLSMAFSGVVYPPCRYLELRKFGR 579

>CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, start by similarity
          Length = 631

 Score =  171 bits (433), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 129/452 (28%), Positives = 208/452 (46%), Gaps = 36/452 (7%)

Query: 21  DLERNSKDLKSPSK--NLSSDYYVDIDSHASEEVLETKLNLFNRIAAGL----------S 68
           DLE+ S     P    N  +    D+D H      +  LN+F +  A L           
Sbjct: 35  DLEKRSTHKTDPDSRTNRRNKKLFDLDRH------DPNLNIFMKGLAYLLWLSDKLDSFG 88

Query: 69  AETKGIEPITDEEK-NDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIF 127
            ET GIE +   E+      L+ A +W SA   +++ +   LGPL+F L+F  +    + 
Sbjct: 89  VETSGIERVPPYERGTKKQFLHVAGLWLSATGGLSSMSSFLLGPLLFELSFQQALTSSMI 148

Query: 128 FNILGLLPVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQ 187
              +G L  A+ SI G + G RQMV +R+L G    +  ++   +  +GW + N+V   +
Sbjct: 149 SVTVGCLVAAYCSIMGPQSGCRQMVTARYLFGWWFVKFVALAAIIGVMGWSVTNSVVGGE 208

Query: 188 LLNMVNQGPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARLAK 247
           +L  ++    + PLW G +++   + ++  FG + +   E +I VP    FL++      
Sbjct: 209 MLAAISN--DRVPLWVGIVIVTVCSFVVAIFGIKQVLRIETYISVPVLTSFLLL---YIS 263

Query: 248 SGNFSNGEWTSGP------TTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIF 301
           SGN         P      T  GN +SF S  +   + W +  ADY +  P +T  +++F
Sbjct: 264 SGNRDYLVREYKPIDVPSKTIKGNWISFFSLCYSITSTWGSITADYYILFPEDTPHYQVF 323

Query: 302 FSLVAGLSFPLFFVMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFC 361
              +AG   P  FV ILG   A  A +   +   Y  +GMGGL +A    +  +GFG+F 
Sbjct: 324 LLTLAGTLIPTTFVGILGLTLASIAKSYQPYGEEYDTHGMGGLLWAGF--SRWNGFGKFL 381

Query: 362 CVVLSISIVANNVPNMYTIALSVQ--AIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFD 419
            VVL +S+++NN+ N Y+ A  +Q  A+WA  A++PR FW +      L  A+     F 
Sbjct: 382 VVVLILSLISNNIINTYSAAFGIQLSAVWA--ARVPRWFWCIVCTIVYLVCALVGRNHFA 439

Query: 420 TFMEYFMDXXXXXXXXXXXXXXXEHFIYRRSF 451
           T +  F+                E+ I+RR F
Sbjct: 440 TILGNFLPMIGYWISMYFILLFEENVIFRRYF 471

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 51/93 (54%), Gaps = 4/93 (4%)

Query: 444 HFIYRRSFEA---YNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMCQTYWTGQIGR-LI 499
           H + R+       YN ++WD+   L  G A   AF  GV GV +GM QTYW G I R L 
Sbjct: 539 HTLKRKHIHTKHRYNWDEWDNPDVLTHGYAATFAFLCGVAGVVVGMAQTYWVGPIARKLG 598

Query: 500 GEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532
           G YGGD+   L  G+S IVY  +R  EL  +GR
Sbjct: 599 GPYGGDIAMWLSMGFSGIVYPWLRYWELVRYGR 631

>Scas_710.30
          Length = 584

 Score =  161 bits (408), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 118/412 (28%), Positives = 199/412 (48%), Gaps = 9/412 (2%)

Query: 58  NLFNRIAAGLSAETKGIEPITDEEK--NDASLLNAASMWFSANMVIAAYAIGGLGPLVFG 115
           NL ++    L  E  GIE I+  E+       ++ A  W +A   +++ +   LGPL+FG
Sbjct: 34  NLLSKKLDSLGVEATGIERISPYERGSKRKQFIHVAGYWLAATGSLSSMSSFLLGPLLFG 93

Query: 116 LNFGTSTLVIIFFNILGLLPVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACV 175
           L F  S +  I    +G L  A+ SI G + G RQMV +R+L G    +  ++   +  +
Sbjct: 94  LTFNESMVSGIVSMAIGCLVAAYCSIMGPQSGCRQMVTARYLFGWWFVKFVALAAIIGVM 153

Query: 176 GWGIVNTVASSQLLNMVNQGPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNF 235
           GW +VN+V   ++L  ++    K PLW G +++   + L+  FG + +   E ++ +P +
Sbjct: 154 GWSVVNSVVGGEMLASISN--DKVPLWVGVLIVTLFSFLVAVFGIKQVLKVETYLSIPVW 211

Query: 236 ACFLVIIARLAKSGNFSNGEWTSGP---TTAGNVLSFGSAVFGFATGWTTYAADYTVYMP 292
             F+++    +   ++ +   +  P   T  GN LSF S  +     W +  ADY +  P
Sbjct: 212 LMFILLYISSSDKYHYIDDFKSPIPDRLTLKGNWLSFFSLCYSITATWGSITADYYILFP 271

Query: 293 RNTNKFKIFFSLVAGLSFPLFFVMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPN 352
            +T+KF++F     G   P  FV +LG   +  A     W + Y++ GMGGL +A     
Sbjct: 272 EDTSKFQVFMLTFLGTVVPTLFVGVLGLCLSTVAATYEPWNDDYNKYGMGGLLHAGF--K 329

Query: 353 SLHGFGEFCCVVLSISIVANNVPNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAI 412
             +GFG+FC VVL +S+++NN+ N Y+ A SVQ      AK+PR FW++      L  A+
Sbjct: 330 RWNGFGKFCVVVLLLSLISNNIINTYSAAFSVQLASVKAAKVPRWFWSIVCMIICLVCAL 389

Query: 413 PACYFFDTFMEYFMDXXXXXXXXXXXXXXXEHFIYRRSFEAYNVEDWDDNSK 464
                F T +  F+                E+ I+R  F     +++ +  K
Sbjct: 390 VGRNHFSTILGNFLPMIGYWISMYFILLLEENVIFREYFHHLYYKEFPEFDK 441

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 47/92 (51%), Gaps = 3/92 (3%)

Query: 444 HFIYRRSF---EAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMCQTYWTGQIGRLIG 500
           H + RR       YN   WDD   L  G A   AF  GV GV +GM Q YW G + R  G
Sbjct: 493 HLLKRRHLATSHKYNWNKWDDPEVLTHGYAATFAFLCGVAGVVVGMAQAYWIGPLARKFG 552

Query: 501 EYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532
           E GGD+   L   +S +VY  +R  EL+ +GR
Sbjct: 553 ETGGDIAMWLSMAFSGLVYPPLRYWELRRYGR 584

>Scas_701.1
          Length = 68

 Score =  101 bits (251), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 54/68 (79%)

Query: 465 LPIGIAGCCAFGVGVIGVALGMCQTYWTGQIGRLIGEYGGDLGFELGAGWSFIVYNLVRP 524
           LPIGIAG   F V   GVALGMCQ+YW G+IGR IG+ GGD+GFE+GA W FI Y LVRP
Sbjct: 1   LPIGIAGGVGFFVAAFGVALGMCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVRP 60

Query: 525 LELKYFGR 532
           LELKYFGR
Sbjct: 61  LELKYFGR 68

>Scas_690.1*
          Length = 636

 Score =  110 bits (276), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 55/72 (76%)

Query: 461 DNSKLPIGIAGCCAFGVGVIGVALGMCQTYWTGQIGRLIGEYGGDLGFELGAGWSFIVYN 520
           D   LPIGIAG   F V   GVALGMCQ+YW G+IGR IG+ GGD+GFE+GA W FI Y 
Sbjct: 565 DGHSLPIGIAGGVGFFVAAFGVALGMCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYV 624

Query: 521 LVRPLELKYFGR 532
           LVRPLELKYFGR
Sbjct: 625 LVRPLELKYFGR 636

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.140    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,619,862
Number of extensions: 690157
Number of successful extensions: 2547
Number of sequences better than 10.0: 36
Number of HSP's gapped: 2579
Number of HSP's successfully gapped: 40
Length of query: 532
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 426
Effective length of database: 12,926,601
Effective search space: 5506732026
Effective search space used: 5506732026
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)