Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_715.4844844822690.0
YER061C (CEM1)44244914300.0
CAGL0J02970g44845712231e-166
Kwal_23.582842445112091e-164
ADL072C43345411051e-148
KLLA0C08239g4294468951e-117
Kwal_23.48621731122730.65
CAGL0E06138g188398721.1
YPL231W (FAS2)1887122721.1
AFL138W1891124692.3
YOR221C (MCT1)384107664.3
Kwal_27.1178339766655.4
KLLA0C15983g189398665.5
CAGL0L12364g39885655.5
ADR165C39766646.5
Kwal_56.2424887798648.7
CAGL0G05445g354120638.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_715.48
         (448 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_715.48                                                           878   0.0  
YER061C (CEM1) [1492] chr5 complement(278296..279624) Beta-ketoa...   555   0.0  
CAGL0J02970g complement(284370..285716) similar to sp|P39525 Sac...   475   e-166
Kwal_23.5828                                                          470   e-164
ADL072C [1669] [Homologous to ScYER061C (CEM1) - SH] (554605..55...   430   e-148
KLLA0C08239g 723077..724366 similar to sp|P39525 Saccharomyces c...   349   e-117
Kwal_23.4862                                                           33   0.65 
CAGL0E06138g complement(611598..617249) highly similar to sp|P19...    32   1.1  
YPL231W (FAS2) [5218] chr16 (108652..114315) Fatty-acyl-CoA synt...    32   1.1  
AFL138W [3057] [Homologous to ScYPL231W (FAS2) - SH] complement(...    31   2.3  
YOR221C (MCT1) [5013] chr15 complement(756476..757536,757738..75...    30   4.3  
Kwal_27.11783                                                          30   5.4  
KLLA0C15983g 1389936..1395617 highly similar to sp|P19097 Saccha...    30   5.5  
CAGL0L12364g complement(1334642..1335838) highly similar to sp|P...    30   5.5  
ADR165C [1907] [Homologous to ScYPL028W (ERG10) - SH] (991934..9...    29   6.5  
Kwal_56.24248                                                          29   8.7  
CAGL0G05445g complement(514769..515833) similar to sp|P35197 Sac...    29   8.9  

>Scas_715.48
          Length = 448

 Score =  878 bits (2269), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/448 (95%), Positives = 428/448 (95%)

Query: 1   MSRRVVVTGLGCATPLGNTLRESWKNLLKSKSGIVPITSLENYESDYEPFAKHIPRTISV 60
           MSRRVVVTGLGCATPLGNTLRESWKNLLKSKSGIVPITSLENYESDYEPFAKHIPRTISV
Sbjct: 1   MSRRVVVTGLGCATPLGNTLRESWKNLLKSKSGIVPITSLENYESDYEPFAKHIPRTISV 60

Query: 61  GRIPTPTESDQQELDQLFTSQEERRYSKFIKLAIQSTYEALKSANLLTHKSSPSNPEIDI 120
           GRIPTPTESDQQELDQLFTSQEERRYSKFIKLAIQSTYEALKSANLLTHKSSPSNPEIDI
Sbjct: 61  GRIPTPTESDQQELDQLFTSQEERRYSKFIKLAIQSTYEALKSANLLTHKSSPSNPEIDI 120

Query: 121 THCNMEKFGCVXXXXXXXXXDIYSTTLQFQNGKKISPYFVPKILTNMAAGNVSIKFNLRG 180
           THCNMEKFGCV         DIYSTTLQFQNGKKISPYFVPKILTNMAAGNVSIKFNLRG
Sbjct: 121 THCNMEKFGCVIGSGIGSISDIYSTTLQFQNGKKISPYFVPKILTNMAAGNVSIKFNLRG 180

Query: 181 LSHSVSTACATGNNSIGDAYNFIRLGMQDICVAGASEASIHPLSLAGFLRAKSITTDGIS 240
           LSHSVSTACATGNNSIGDAYNFIRLGMQDICVAGASEASIHPLSLAGFLRAKSITTDGIS
Sbjct: 181 LSHSVSTACATGNNSIGDAYNFIRLGMQDICVAGASEASIHPLSLAGFLRAKSITTDGIS 240

Query: 241 RPFDLERSGFVLGEGAGMVVLESLEHAKKRNAKIFCEIKGYGLSSDAYHITSPPSDGNGA 300
           RPFDLERSGFVLGEGAGMVVLESLEHAKKRNAKIFCEIKGYGLSSDAYHITSPPSDGNGA
Sbjct: 241 RPFDLERSGFVLGEGAGMVVLESLEHAKKRNAKIFCEIKGYGLSSDAYHITSPPSDGNGA 300

Query: 301 RRAMDMAINSSSISRDEIDYVNAHATSTPVGDITEVKAIYSSFINENIFDKSNTRTKPLY 360
           RRAMDMAINSSSISRDEIDYVNAHATSTPVGDITEVKAIYSSFINENIFDKSNTRTKPLY
Sbjct: 301 RRAMDMAINSSSISRDEIDYVNAHATSTPVGDITEVKAIYSSFINENIFDKSNTRTKPLY 360

Query: 361 VSSNKGSIGHLLGAAGAVESIFTIMSLREKIIPHTLNLAHPIXXXXXXXXXXXMDEPASP 420
           VSSNKGSIGHLLGAAGAVESIFTIMSLREKIIPHTLNLAHPI           MDEPASP
Sbjct: 361 VSSNKGSIGHLLGAAGAVESIFTIMSLREKIIPHTLNLAHPIEEVSSELLELVMDEPASP 420

Query: 421 KQVNSALCNSFGFGGVNTALLFSKYNNC 448
           KQVNSALCNSFGFGGVNTALLFSKYNNC
Sbjct: 421 KQVNSALCNSFGFGGVNTALLFSKYNNC 448

>YER061C (CEM1) [1492] chr5 complement(278296..279624)
           Beta-ketoacyl-ACP synthase, mitochondrial
           (3-oxoacyl-[Acyl-carrier-protein] synthase) [1329 bp,
           442 aa]
          Length = 442

 Score =  555 bits (1430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/449 (62%), Positives = 343/449 (76%), Gaps = 14/449 (3%)

Query: 1   MSRRVVVTGLGCATPLGNTLRESWKNLLKSKSGIVPITSLENYESDYEPFAKHIPRTISV 60
           MSRRVV+TGLGC TPLG +L ESW NLL SK+G+ PITSL NY  DY+   K IP TI+V
Sbjct: 1   MSRRVVITGLGCVTPLGRSLSESWGNLLSSKNGLTPITSLPNYNEDYKLREKSIPSTITV 60

Query: 61  GRIPTPTESDQQELDQL-FTSQEERRYSKFIKLAIQSTYEALKSANLLTHKSSPSNPEID 119
           G+IP   +++   +++L FTSQ+ERR S FIKLA+++TYEAL +A LL    +P++  I+
Sbjct: 61  GKIPENFQNENSAINKLLFTSQDERRTSSFIKLALRTTYEALHNAGLL----NPNDITIN 116

Query: 120 ITHCNMEKFGCVXXXXXXXXXDIYSTTLQFQN-GKKISPYFVPKILTNMAAGNVSIKFNL 178
            + CN++ FGC+         DIY T+LQF N  K+I+PYFVPKILTNMAAGNVSIKFNL
Sbjct: 117 TSLCNLDHFGCLIGSGIGSIQDIYQTSLQFHNDNKRINPYFVPKILTNMAAGNVSIKFNL 176

Query: 179 RGLSHSVSTACATGNNSIGDAYNFIRLGMQDICVAGASEASIHPLSLAGFLRAKSITTDG 238
           RGLSHSVSTACATGNNSIGDA+NFIRLGMQDICVAGASE S+HPLSLAGF+RAKSITT+G
Sbjct: 177 RGLSHSVSTACATGNNSIGDAFNFIRLGMQDICVAGASETSLHPLSLAGFIRAKSITTNG 236

Query: 239 ISRPFDLERSGFVLGEGAGMVVLESLEHAKKRNAKIFCEIKGYGLSSDAYHITSPPSDGN 298
           ISRPFD +RSGFVLGEG GM+V+ESLEHA+KRNA I  E+ GYGLSSDA HITSPP+DGN
Sbjct: 237 ISRPFDTQRSGFVLGEGCGMIVMESLEHAQKRNANIISELVGYGLSSDACHITSPPADGN 296

Query: 299 GARRAMDMAINSSSISRDEIDYVNAHATSTPVGDITEVKAIYSSFINENIFDKSNTRTKP 358
           GA+RA++MA+  + +   ++DYVNAHATST +GD  E  A+ S+ +         +++KP
Sbjct: 297 GAKRAIEMALKMARLEPTDVDYVNAHATSTLLGDKAECLAVASALL------PGRSKSKP 350

Query: 359 LYVSSNKGSIGHLLGAAGAVESIFTIMSLREKIIPHTLNLAHPIXXXXXXXXXXXM--DE 416
           LY+SSNKG+IGHLLGA GAVESIFTI SL++  +PHTLNL + +              D+
Sbjct: 351 LYISSNKGAIGHLLGARGAVESIFTICSLKDDKMPHTLNLDNVLTLENNEADKLHFIRDK 410

Query: 417 PASPKQVNSALCNSFGFGGVNTALLFSKY 445
           P        ALCNSFGFGGVNT+LLF K+
Sbjct: 411 PIVGANPKYALCNSFGFGGVNTSLLFKKW 439

>CAGL0J02970g complement(284370..285716) similar to sp|P39525
           Saccharomyces cerevisiae YER061c CEM1, start by
           similarity
          Length = 448

 Score =  475 bits (1223), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 256/457 (56%), Positives = 325/457 (71%), Gaps = 21/457 (4%)

Query: 1   MSRRVVVTGLGCATPLGNTLRESWKNLLKSKS-GIVPITSLENYESDYEPFAKHIPRTIS 59
           MSRRVVVTGLGC TPLG +++ESW  LL+  S G+V +  L   + D+  +    P  + 
Sbjct: 1   MSRRVVVTGLGCVTPLGKSVKESWHRLLQRDSNGLVKLDQLT--KGDFAKWRGIFPPELR 58

Query: 60  VGRIPTPTESDQQELDQLFTSQEERRYSKFIKLAIQSTYEALKSANLLTHKSSPS-NPEI 118
           VG + +P ES +    QLFTSQ++RR S+FIKLA  ++YEAL S+ L+  ++  S +  I
Sbjct: 59  VGAV-SPIESFEVN-SQLFTSQDDRRMSRFIKLATIASYEALVSSGLVNKETKMSEDGRI 116

Query: 119 DITHCNM----EKFGCVXXXXXXXXXDIYSTTLQFQNGKK---ISPYFVPKILTNMAAGN 171
            I   N     +K GC+         DIY T++ F +  K   I+PYFVP+ILTNMAAGN
Sbjct: 117 PIDQHNQGIDPDKVGCLIGSGIGSIEDIYETSVTFDSNTKKNRINPYFVPRILTNMAAGN 176

Query: 172 VSIKFNLRGLSHSVSTACATGNNSIGDAYNFIRLGMQDICVAGASEASIHPLSLAGFLRA 231
           ++IKFNLRG +HSVSTACATGNN+IGD YN I+LGMQDIC+AGASEAS+HPLSLAGFLRA
Sbjct: 177 IAIKFNLRGPTHSVSTACATGNNAIGDGYNMIKLGMQDICLAGASEASVHPLSLAGFLRA 236

Query: 232 KSITTDGISRPFDLERSGFVLGEGAGMVVLESLEHAKKRNAKIFCEIKGYGLSSDAYHIT 291
           KS++ DGISRPFD ER+GFVLGEGAG+VVLESLE A++R A I  EI GYGLS DA+HIT
Sbjct: 237 KSLSPDGISRPFDEERNGFVLGEGAGIVVLESLESAERRGAPILAEIVGYGLSCDAHHIT 296

Query: 292 SPPSDGNGARRAMDMAINSS--SISRDEIDYVNAHATSTPVGDITEVKAIYSSFINENIF 349
           SPP+DG GA RA+ MA++ S  +++  +I+YVNAHATST +GD TE  AI ++ I +N+ 
Sbjct: 297 SPPNDGEGASRAIKMALDLSHGNVNARDIEYVNAHATSTKLGDNTECCAIQNTLI-DNV- 354

Query: 350 DKSNTRTKPLYVSSNKGSIGHLLGAAGAVESIFTIMSLREKIIPHTLNLAHPIXXXXXXX 409
                R KPLY+SSNKGSIGHLLGAAGA ESIFTI+SL  + IPHT NL + +       
Sbjct: 355 ----NRQKPLYISSNKGSIGHLLGAAGAAESIFTILSLYNRTIPHTYNLKNVLGNFESSS 410

Query: 410 XXXXMDEPASPKQVNSALCNSFGFGGVNTALLFSKYN 446
                 +P     +  ALCNSFGFGGVNT+LLF +++
Sbjct: 411 MRFVKSQPHKVADLEYALCNSFGFGGVNTSLLFRRWH 447

>Kwal_23.5828
          Length = 424

 Score =  470 bits (1209), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 250/451 (55%), Positives = 310/451 (68%), Gaps = 33/451 (7%)

Query: 1   MSRRVVVTGLGCATPLGNTLRESWKNLLKSKSGIVPITSLENYESDYEPFAKHIPRTISV 60
           M+ RVVVTGLG  TPLG T+ ESW+ LL  KSGI PI  L N +S    +  H P +++V
Sbjct: 1   MTSRVVVTGLGAITPLGRTVSESWRALLAGKSGIRPIRDLPNAKS----YEGHCPASVAV 56

Query: 61  GRIPTPTESDQQELDQLFTSQEERRYSKFIKLAIQSTYEALKSANLLTHKSSPSNPEIDI 120
             IP   + D Q    LFTSQ+ RR S+F + A+ +  EAL+ A++L   +   N     
Sbjct: 57  ADIP---DFDPQAYGDLFTSQDLRRMSQFTQFAMVAAQEALQDADILQMLAESKN----- 108

Query: 121 THCNMEKFGCVXXXXXXXXXDIYSTTLQFQNGKKISPYFVPKILTNMAAGNVSIKFNLRG 180
                ++ GCV         D+Y T + F+ GK+++P FVPKIL NMA GN+SIKF LRG
Sbjct: 109 -----DRVGCVIGSGIGSIQDMYDTIVDFERGKRVAPTFVPKILANMACGNISIKFQLRG 163

Query: 181 LSHSVSTACATGNNSIGDAYNFIRLGMQDICVAGASEASIHPLSLAGFLRAKSITTDGIS 240
           +SH VSTACATGNN+IGDAYNFIRLG  D+C+AGASEAS+HPLSLAGFLRAKSITT G+S
Sbjct: 164 VSHCVSTACATGNNAIGDAYNFIRLGYNDVCLAGASEASVHPLSLAGFLRAKSITTSGVS 223

Query: 241 RPFDLERSGFVLGEGAGMVVLESLEHAKKRNAKIFCEIKGYGLSSDAYHITSPPSDGNGA 300
           RPFD ER GFVLGEGAG+VVLESLEHA++R A+I+ EI+GYGL+SDA+HIT+P  +G GA
Sbjct: 224 RPFDKERDGFVLGEGAGLVVLESLEHAQRRGARIYAEIEGYGLTSDAHHITAPSENGEGA 283

Query: 301 RRAMDMAINSSSISRDEIDYVNAHATSTPVGDITEVKAIYSSFINENIFDKSNTRTKPLY 360
           RRAM+MA+ +    +  +DY+NAHATST +GD  E +AI S      +F   N  T  L 
Sbjct: 284 RRAMEMALKNHDPRK--VDYINAHATSTVLGDRAESQAISS------LFSTPNPST--LK 333

Query: 361 VSSNKGSIGHLLGAAGAVESIFTIMSLREKIIPHTLNL-----AHPIXXXXXXXXXXXMD 415
           VSSNKG+IGHLLGAAGAVESIFTI SL+E IIPHTLNL     A               D
Sbjct: 334 VSSNKGAIGHLLGAAGAVESIFTIKSLQEGIIPHTLNLSNIGGAKGDEADTFNSLDLVRD 393

Query: 416 EPASPKQVNSALCNSFGFGGVNTALLFSKYN 446
           +PA    +  AL NSFGFGG+N++LLF K+N
Sbjct: 394 KPAV-HDIQLALNNSFGFGGINSSLLFRKWN 423

>ADL072C [1669] [Homologous to ScYER061C (CEM1) - SH]
           (554605..555906) [1302 bp, 433 aa]
          Length = 433

 Score =  430 bits (1105), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 227/454 (50%), Positives = 296/454 (65%), Gaps = 30/454 (6%)

Query: 1   MSRRVVVTGLGCATPLGNTLRESWKNLLKSKSGIVPITSLENYESDYEPFAKHIPRTISV 60
           M  RVVVTG+GC TPLG +L +SWK LL+  SG+V +  L  YE DY+P ++ I   + V
Sbjct: 1   MHPRVVVTGIGCYTPLGPSLAQSWKELLRGTSGLVRLQDLAEYEGDYKPLSRLISGDLRV 60

Query: 61  GRIPTPTESDQQELDQLFTSQEERRYSKFIKLAIQSTYEALKSANLLTHKSSPSNPEIDI 120
           G++    E+  QEL    +SQE+RR S+  +LA+ +  EAL+ A LL+           +
Sbjct: 61  GKVGF--EARDQEL---LSSQEQRRTSRAAQLAMVTAEEALRHAGLLSGSHL-------V 108

Query: 121 THCNMEKFGCVXXXXXXXXXDIYSTTLQFQNGKK--ISPYFVPKILTNMAAGNVSIKFNL 178
              +  + GC+         DI   T    + ++  +SP+F+PK+L NMAAGNV+IKF L
Sbjct: 109 ASVDRNRAGCIIGAGLPSMEDISQATASLSSARRPSVSPFFIPKMLNNMAAGNVAIKFQL 168

Query: 179 RGLSHSVSTACATGNNSIGDAYNFIRLGMQDICVAGASEASIHPLSLAGFLRAKSITTDG 238
           RG S+  STACA+GNN+IGDAYNFIRLG  D+ VAGASE S+HPL+LAGF++AKSI+  G
Sbjct: 169 RGASNCPSTACASGNNAIGDAYNFIRLGYSDVIVAGASELSVHPLALAGFVKAKSISASG 228

Query: 239 ISRPFDLERSGFVLGEGAGMVVLESLEHAKKRNAKIFCEIKGYGLSSDAYHITSPPSDGN 298
           ISRPFD  R GFVLGEG G++VLESLEHA+ R A+I  E+ GYG+ SDA+HITSP   G+
Sbjct: 229 ISRPFDARRDGFVLGEGCGLLVLESLEHARHRGAEIIAEVVGYGVCSDAHHITSPSEGGD 288

Query: 299 GARRAMDMAINSSSI--SRDEIDYVNAHATSTPVGDITEVKAIYSSFINENIFDKSNTRT 356
           GARRAM MA+  + I  +RD++ YVNAHATSTP+GD  E +AI + F          T T
Sbjct: 289 GARRAMHMALQDAGIWDTRDQVGYVNAHATSTPLGDRAEARAIQAVF--------GATGT 340

Query: 357 KPLYVSSNKGSIGHLLGAAGAVESIFTIMSLREKIIPHTLNL-----AHPIXXXXXXXXX 411
               VSSNKG +GHLLGAAGAVE++FT+ SLRE I+PHTLNL                  
Sbjct: 341 GSTLVSSNKGHMGHLLGAAGAVEAVFTVQSLREGIVPHTLNLQTVGEGLADKKDGFGGIT 400

Query: 412 XXMDEPASPKQVNSALCNSFGFGGVNTALLFSKY 445
              D P  P  +  A+ NSFGFGG+N++LLF K+
Sbjct: 401 FVQDNPV-PAPLTYAMNNSFGFGGINSSLLFKKW 433

>KLLA0C08239g 723077..724366 similar to sp|P39525 Saccharomyces
           cerevisiae YER061c CEM1 beta-keto-acyl-ACP synthase,
           mitochondrial singleton, start by similarity
          Length = 429

 Score =  349 bits (895), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 195/446 (43%), Positives = 272/446 (60%), Gaps = 21/446 (4%)

Query: 3   RRVVVTGLGCATPLGNTLRESWKNLLKSKSGIVPITSLENYESDYEPFAKHIPRTISVGR 62
           +RVVVTGLG  TPLG+T+ +SW  LL +K  ++P+ +  N E D+    K +P   +V R
Sbjct: 4   KRVVVTGLGAYTPLGSTVSKSWAGLLAAKQSLIPLDAFYNRE-DFAKVKKLVPLDTAVSR 62

Query: 63  IPTPTESDQQELDQLFTSQEERRYSKFIKLAIQSTYEALKSANLLTHKSSPSNPE-IDIT 121
           +          LD  F   ++RR +   ++ ++ T EAL  ANL+  ++  +  E ID T
Sbjct: 63  L------HADPLDT-FPEYDQRRMTPAHQIVLEKTKEALLQANLIADENLNTLTEDIDKT 115

Query: 122 HCNMEKFGCVXXXXXXXXXDIYSTTLQFQNGKKISPYFVPKILTNMAAGNVSIKFNLRGL 181
                K GCV         D+ ST        K+SP+ +P++L NMA GNV IK+ ++G 
Sbjct: 116 -----KVGCVIGTGMPSMPDLESTISTLFTKPKVSPFLIPRVLPNMAMGNVMIKYGIQGP 170

Query: 182 SHSVSTACATGNNSIGDAYNFIRLGMQDICVAGASEASIHPLSLAGFLRAKSITTDGISR 241
           S   STACATGN+SI + +N I+LG+ D+ + G+ E SI P+S+AGF R+K+I+    +R
Sbjct: 171 SSCPSTACATGNSSIIEGFNSIQLGLADVMICGSYEFSIDPISIAGFYRSKTISKKHQTR 230

Query: 242 PFDLERSGFVLGEGAGMVVLESLEHAKKRNAKIFCEIKGYGLSSDAYHITSPPSDGNGAR 301
           PFD+ER GF++GEG G++ LESLE A KR + I  EI G GLS+D YHITSP  DG+G +
Sbjct: 231 PFDVERDGFIMGEGCGILTLESLESALKRGSPILAEISGVGLSNDGYHITSPLPDGSGGK 290

Query: 302 RAMDMAINSSSISRDEIDYVNAHATSTPVGDITEVKAIYSSFINENIFDKSNTRTKPLYV 361
            AM  A+  ++I+  ++ Y+NAHATST +GD+ E  AI        +F   +T T P YV
Sbjct: 291 LAMQNALKRANIAPQQVGYINAHATSTQLGDVAESTAI------TELFGTKSTGTAP-YV 343

Query: 362 SSNKGSIGHLLGAAGAVESIFTIMSLREKIIPHTLNLAHPIXXXXXXXXXXXMDEPASPK 421
           SSNKG IGHLLGA+G+VESIFT++SL+    PHTLNL                +E     
Sbjct: 344 SSNKGHIGHLLGASGSVESIFTVLSLKYGRFPHTLNLKTVDETSIINELNLIKNESMIDN 403

Query: 422 QVNSALCNSFGFGGVNTALLFSKYNN 447
            +  AL NSFGFGGVNT++LF KY+ 
Sbjct: 404 SIEYALTNSFGFGGVNTSILFRKYHQ 429

>Kwal_23.4862
          Length = 1731

 Score = 32.7 bits (73), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 50/122 (40%), Gaps = 11/122 (9%)

Query: 188  ACATGNNSIGDAYNFIRLGMQDICVAGA-SEASIHPLSLAGFLRAKSITTDGIS------ 240
            ACAT   S+  A   I  G   IC+AG   +   H     G + A S     +       
Sbjct: 1321 ACATAVESLDYAVETILSGKAKICIAGGYDDFEEHVAYEFGNMGATSNHQKEVECGRDPR 1380

Query: 241  ---RPFDLERSGFVLGEGAGMVVLESLEHAKKRNAKIFCEIKGYGLSSDAYHITSPPSDG 297
               RP    R+GF+  +GAG+ VL S + A +    I+  +     +SD     S P+ G
Sbjct: 1381 EMCRPATTSRNGFMESQGAGIQVLMSAQLAIRMGVPIYGIVGMTSTASDKIG-KSLPAPG 1439

Query: 298  NG 299
             G
Sbjct: 1440 KG 1441

>CAGL0E06138g complement(611598..617249) highly similar to sp|P19097
            Saccharomyces cerevisiae YPL231w FAS2, start by
            similarity
          Length = 1883

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 43/98 (43%), Gaps = 10/98 (10%)

Query: 188  ACATGNNSIGDAYNFIRLGMQDICVAGASEASIHPLSLA-GFLRAKSITTDG-------- 238
            ACAT   S+      I  G   IC+ G  +      S   G ++A S T +         
Sbjct: 1303 ACATSVESVDIGVETILSGKAKICIVGGYDDFQEEGSYEFGNMKATSNTLEEFEHGRTPA 1362

Query: 239  -ISRPFDLERSGFVLGEGAGMVVLESLEHAKKRNAKIF 275
             +SRP    R+GF+  +GAG+ V+ + + A K    I+
Sbjct: 1363 EMSRPATTSRNGFMEAQGAGIQVIMNADLALKMGVPIY 1400

>YPL231W (FAS2) [5218] chr16 (108652..114315) Fatty-acyl-CoA synthase,
            alpha chain, contains acyl carrier protein, beta-ketoacyl
            reductase, and beta-ketoacyl synthase in a single
            polypeptide chain [5664 bp, 1887 aa]
          Length = 1887

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 51/122 (41%), Gaps = 11/122 (9%)

Query: 188  ACATGNNSIGDAYNFIRLGMQDICVAGASEASIHPLSLA-GFLRAKSITTDG-------- 238
            ACAT   S+      I  G   IC+ G  +      S   G ++A S T +         
Sbjct: 1304 ACATSVESVDIGVETILSGKARICIVGGYDDFQEEGSFEFGNMKATSNTLEEFEHGRTPA 1363

Query: 239  -ISRPFDLERSGFVLGEGAGMVVLESLEHAKKRNAKIFCEIKGYGLSSDAYHITSPPSDG 297
             +SRP    R+GF+  +GAG+ ++   + A K    I+  +     ++D     S P+ G
Sbjct: 1364 EMSRPATTTRNGFMEAQGAGIQIIMQADLALKMGVPIYGIVAMAATATDKIG-RSVPAPG 1422

Query: 298  NG 299
             G
Sbjct: 1423 KG 1424

>AFL138W [3057] [Homologous to ScYPL231W (FAS2) - SH]
            complement(171276..176951) [5676 bp, 1891 aa]
          Length = 1891

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 50/124 (40%), Gaps = 15/124 (12%)

Query: 188  ACATGNNSIGDAYNFIRLGMQDICVAGA-----SEASIH-------PLSLAGFLRAKSIT 235
            ACAT   S+      I  G   IC+ G       E S           SL  F   +  T
Sbjct: 1307 ACATAVESMDIGVETILSGKAKICIVGGYDDFQEEGSFEFGSMNATSNSLEEFEHGR--T 1364

Query: 236  TDGISRPFDLERSGFVLGEGAGMVVLESLEHAKKRNAKIFCEIKGYGLSSDAYHITSPPS 295
               +SRP    RSGF+  +GAG+ ++ + + A K    I+  +     ++D     S P+
Sbjct: 1365 PAEMSRPTTTTRSGFMEAQGAGIQIIMNADLALKMGVPIYGIVALTATATDKIG-RSVPA 1423

Query: 296  DGNG 299
             G G
Sbjct: 1424 PGQG 1427

>YOR221C (MCT1) [5013] chr15
           complement(756476..757536,757738..757831) Malonyl
           CoA:acyl carrier protein transferase [1155 bp, 384 aa]
          Length = 384

 Score = 30.0 bits (66), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 50/107 (46%), Gaps = 6/107 (5%)

Query: 288 YHITSPPSDGNGARRAMDMAINSSSISRDEIDYVNAHATSTPVGDITEVKAIYSSFINEN 347
           Y I S PSD           I+S     +E  Y+  H+    +G++T + ++ S F  ++
Sbjct: 92  YQILSNPSDPQDQAPKNMTKIDSPDKKDNEQCYLLGHS----LGELTCL-SVNSLFSLKD 146

Query: 348 IFDKSNTRTKPLYVSSNKGSIGHLLGAAGAVESIFTIMSLREKIIPH 394
           +FD +N R K +  S+ K  + H +  +   E ++ + S R   +P 
Sbjct: 147 LFDIANFRNKLMVTSTEKYLVAHNINRSNKFE-MWALSSPRATDLPQ 192

>Kwal_27.11783
          Length = 397

 Score = 29.6 bits (65), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 5/66 (7%)

Query: 181 LSHSVSTACATGNNSIGDAYNFIRLGMQDICVAGASEASIH-----PLSLAGFLRAKSIT 235
           ++ +V+  CA+G  +I  A   I+ G  DI VAG +E+  +     P +  G     +  
Sbjct: 83  VATTVNKVCASGMKAIICAAQTIKCGNADIVVAGGAESMTNTPYYMPAARGGAKFGPTTL 142

Query: 236 TDGISR 241
            DG+ R
Sbjct: 143 VDGVQR 148

>KLLA0C15983g 1389936..1395617 highly similar to sp|P19097
            Saccharomyces cerevisiae YPL231w FAS2 fatty-acyl-CoA
            synthase, alpha chain singleton, start by similarity
          Length = 1893

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 10/98 (10%)

Query: 188  ACATGNNSIGDAYNFIRLGMQDICVAGASEASIHPLSLA-GFLRAKSITTDG-------- 238
            ACAT   S+      I      IC+ G  +      S   G ++A S T +         
Sbjct: 1304 ACATAVESLDIGVETILSNKAKICIVGGYDDFQEEGSYEFGNMKATSNTLEEYENGRTPA 1363

Query: 239  -ISRPFDLERSGFVLGEGAGMVVLESLEHAKKRNAKIF 275
             +SRP    R+GF+  +GAG+ V+ + + A K    I+
Sbjct: 1364 EMSRPTTTTRNGFMEAQGAGIQVIMTADLALKMGVPIY 1401

>CAGL0L12364g complement(1334642..1335838) highly similar to
           sp|P41338 Saccharomyces cerevisiae YPL028w acetyl-CoA
           C-acetyltransferase, start by similarity
          Length = 398

 Score = 29.6 bits (65), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 7/85 (8%)

Query: 164 LTNMAAGNVSIKFNLRG--LSHSVSTACATGNNSIGDAYNFIRLGMQDICVAGASEASIH 221
           L   AA  V++   L+   ++ SV+  CA+   SI      I+ G  D+ +AG  E+  +
Sbjct: 64  LGQNAARQVALGAGLKNGIVATSVNKVCASAMKSIILGAQAIKCGTADVVIAGGCESMTN 123

Query: 222 -----PLSLAGFLRAKSITTDGISR 241
                P + AG    ++   DGI R
Sbjct: 124 APYYMPAARAGARFGETKMVDGIQR 148

>ADR165C [1907] [Homologous to ScYPL028W (ERG10) - SH]
           (991934..993127) [1194 bp, 397 aa]
          Length = 397

 Score = 29.3 bits (64), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 5/66 (7%)

Query: 181 LSHSVSTACATGNNSIGDAYNFIRLGMQDICVAGASEASIH-----PLSLAGFLRAKSIT 235
           ++ +V+  CA+G  ++  A   I+ G  DI VAG +E+  +     P +  G    ++  
Sbjct: 82  VATTVNKVCASGMKALILAAQAIKCGTADIVVAGGAESMTNTPYYMPAARGGARFGEAKL 141

Query: 236 TDGISR 241
            DGI R
Sbjct: 142 IDGIQR 147

>Kwal_56.24248
          Length = 877

 Score = 29.3 bits (64), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 41/98 (41%), Gaps = 10/98 (10%)

Query: 188 ACATGNNSIGDAYNFIRLGMQDICVAGASEASIHPLSLA-GFLRAKSITTDG-------- 238
           ACAT   S+      I  G   IC+ G  +      S   G + A S + D         
Sbjct: 293 ACATAVESLDVGVETILSGKAKICIVGGYDDFQEEGSYEFGNMGATSNSLDEFDHGRTPA 352

Query: 239 -ISRPFDLERSGFVLGEGAGMVVLESLEHAKKRNAKIF 275
            +SRP    R+GF+  +G+GM V+ + + A      I+
Sbjct: 353 EMSRPATTSRNGFMEAQGSGMQVIMNADLALNMGVPIY 390

>CAGL0G05445g complement(514769..515833) similar to sp|P35197
           Saccharomyces cerevisiae YDL226c GCS1 ADP-ribosylation
           factor GTPase-activating protein, start by similarity
          Length = 354

 Score = 28.9 bits (63), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 49/120 (40%), Gaps = 22/120 (18%)

Query: 268 KKRNAKIFCEIKGYGLSSDAYHITSPPSDGN----------GARRAMDMAINSSSISRDE 317
           K++N + F ++   G  +D+     PPS G             R A D + N+ S+   +
Sbjct: 174 KEKNEEYFAQL---GKKNDSKPDHLPPSQGGKYQGFGNTPVNNRNATDPSTNTMSLENLQ 230

Query: 318 IDYVNAHATSTPVGDITEVKAIYSSFINENIFDKSNTRTKPLYVSSNKGSIGHLLGAAGA 377
            D         P+G +T+   ++SS + ++  D + T  KP     N G +      A A
Sbjct: 231 TD---------PLGTLTKGWGLFSSAVAKSFDDVNETYIKPNVQQWNTGELSEETKRAAA 281

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,688,326
Number of extensions: 557416
Number of successful extensions: 1682
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1678
Number of HSP's successfully gapped: 34
Length of query: 448
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 343
Effective length of database: 12,961,219
Effective search space: 4445698117
Effective search space used: 4445698117
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)