Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_715.47d53353328020.0
Scas_715.4953252520410.0
Scas_704.3654553719980.0
CAGL0L00671g54353019790.0
YER056C (FCY2)53353319550.0
YER060W (FCY21)52852518540.0
Sklu_1893.251352918340.0
CAGL0J02948g51553418340.0
YER060W-A (FCY22)53049218310.0
Kwal_23.581951652917070.0
KLLA0C08283g51953316810.0
Scas_715.47d152348916660.0
Kwal_34.1573051852815970.0
CAGL0C00231g54052215510.0
ADL074W52449314830.0
Scas_715.54d2322056115e-76
KLLA0D05060g5235255946e-70
Kwal_47.172165425175949e-70
YGL186C (TPN1)5795454875e-54
CAGL0L06138g6314624483e-48
Scas_710.305844504332e-46
Scas_701.168682507e-26
Scas_690.1*636722708e-25
CAGL0F07293g72469770.25
Scas_636.161554126701.9
Kwal_47.18919640258702.1
CAGL0D02662g56468674.5
CAGL0D02640g56468674.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_715.47d
         (533 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_715.47d                                                         1083   0.0  
Scas_715.49                                                           790   0.0  
Scas_704.36                                                           774   0.0  
CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomy...   766   0.0  
YER056C (FCY2) [1485] chr5 complement(266511..268112) Cytosine/p...   757   0.0  
YER060W (FCY21) [1490] chr5 (274565..276151) Protein with simila...   718   0.0  
Sklu_1893.2 YER056C, Contig c1893 1725-3266                           711   0.0  
CAGL0J02948g 282559..284106 highly similar to sp|P40039 Saccharo...   711   0.0  
YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine p...   709   0.0  
Kwal_23.5819                                                          662   0.0  
KLLA0C08283g complement(725563..727122) similar to sp|P17064 Sac...   652   0.0  
Scas_715.47d1                                                         646   0.0  
Kwal_34.15730                                                         619   0.0  
CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces cer...   602   0.0  
ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH] complement(...   575   0.0  
Scas_715.54d                                                          239   5e-76
KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces c...   233   6e-70
Kwal_47.17216                                                         233   9e-70
YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of ...   192   5e-54
CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces c...   177   3e-48
Scas_710.30                                                           171   2e-46
Scas_701.1                                                            100   7e-26
Scas_690.1*                                                           108   8e-25
CAGL0F07293g complement(710050..712224) highly similar to sp|P53...    34   0.25 
Scas_636.16                                                            32   1.9  
Kwal_47.18919                                                          32   2.1  
CAGL0D02662g complement(278099..279793) highly similar to sp|P23...    30   4.5  
CAGL0D02640g 274285..275979 highly similar to sp|P23585 Saccharo...    30   4.5  

>Scas_715.47d
          Length = 533

 Score = 1083 bits (2802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/533 (100%), Positives = 533/533 (100%)

Query: 1   MSSLSDKNVYEIQDLEMDLERNSEFSNLPNDKKIDLGPTFSNEPASFIEITEETGSKFSF 60
           MSSLSDKNVYEIQDLEMDLERNSEFSNLPNDKKIDLGPTFSNEPASFIEITEETGSKFSF
Sbjct: 1   MSSLSDKNVYEIQDLEMDLERNSEFSNLPNDKKIDLGPTFSNEPASFIEITEETGSKFSF 60

Query: 61  FNRLASQLNAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFG 120
           FNRLASQLNAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFG
Sbjct: 61  FNRLASQLNAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFG 120

Query: 121 TCVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGV 180
           TCVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGV
Sbjct: 121 TCVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGV 180

Query: 181 VNSVASSQLLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFL 240
           VNSVASSQLLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFL
Sbjct: 181 VNSVASSQLLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFL 240

Query: 241 VIIARLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFK 300
           VIIARLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFK
Sbjct: 241 VIIARLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFK 300

Query: 301 IFFSLVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGE 360
           IFFSLVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGE
Sbjct: 301 IFFSLVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGE 360

Query: 361 FCCVLLALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFD 420
           FCCVLLALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFD
Sbjct: 361 FCCVLLALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFD 420

Query: 421 GFMEDFMNSIGYYLAIYSATALAEHFIFRRGFKGYNVEDWDDNSKLPMGIAGCAALFVGA 480
           GFMEDFMNSIGYYLAIYSATALAEHFIFRRGFKGYNVEDWDDNSKLPMGIAGCAALFVGA
Sbjct: 421 GFMEDFMNSIGYYLAIYSATALAEHFIFRRGFKGYNVEDWDDNSKLPMGIAGCAALFVGA 480

Query: 481 FGVALGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPLEIKYIGR 533
           FGVALGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPLEIKYIGR
Sbjct: 481 FGVALGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPLEIKYIGR 533

>Scas_715.49
          Length = 532

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/525 (72%), Positives = 439/525 (83%), Gaps = 10/525 (1%)

Query: 10  YEIQDLEMD-LERNSEFSNLPNDKKIDLGPTFSNEPASFIEITEETGSKFSFFNRLASQL 68
           YE+ DLE +  +  S   NL +D  +D+    S E            +K + FNR+A+ L
Sbjct: 17  YEMNDLERNSKDLKSPSKNLSSDYYVDIDSHASEEVLE---------TKLNLFNRIAAGL 67

Query: 69  NAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFGTCVLTIIF 128
           +AETKGIE ITDEEK D S+L+A SMWFSANMVI+AY +GG+GPLV+GLNFGT  L IIF
Sbjct: 68  SAETKGIEPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIF 127

Query: 129 FSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGVVNSVASSQ 188
           F+ILGLLPVAFFSIFGAK GLRQMVLSRFLIGNSTARI +VIN ++ VGWG+VN+VASSQ
Sbjct: 128 FNILGLLPVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQ 187

Query: 189 LLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFLVIIARLHM 248
           LLNMVNQG H CPLWAGC++IIGATIL+TFFGY  IH++E+W WVPNFA FLVIIARL  
Sbjct: 188 LLNMVNQGPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARLAK 247

Query: 249 SGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFKIFFSLVGG 308
           SGNFS GEWTSGPTTAGNVLSFG A+FGFATGWT YAADYTVYMPR+TNKFKIFFSLV G
Sbjct: 248 SGNFSNGEWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFSLVAG 307

Query: 309 LSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGEFCCVLLAL 368
           LSFPLFF +ILGAASAMGAVNNP W +YY  NGMGG+TYAILVP+SLHGFGEFCCV+L++
Sbjct: 308 LSFPLFFVMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCVVLSI 367

Query: 369 STIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFDGFMEDFMN 428
           S +ANN+PNMY+I L+VQAIW PLAK+PR  WT+AGN ATL I+IPACY+FD FME FM+
Sbjct: 368 SIVANNVPNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFMEYFMD 427

Query: 429 SIGYYLAIYSATALAEHFIFRRGFKGYNVEDWDDNSKLPMGIAGCAALFVGAFGVALGMS 488
           SI YYLAIY + AL+EHFI+RR F+ YNVEDWDDNSKLP+GIAGC A  VG  GVALGM 
Sbjct: 428 SIAYYLAIYISIALSEHFIYRRSFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMC 487

Query: 489 QTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPLEIKYIGR 533
           QTYW G+I R IGEYGGD+GFELGAGW+F+VY ++RPLE+KY GR
Sbjct: 488 QTYWTGQIGRLIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532

>Scas_704.36
          Length = 545

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/537 (70%), Positives = 447/537 (83%), Gaps = 25/537 (4%)

Query: 16  EMDLERNSE-----------FSNLPNDKKIDLGPTFSN--------EPASFIEITEETGS 56
           ++DLERN++           F    +   I + P   +        EP +++E T     
Sbjct: 15  DIDLERNTDLERETGYEMNSFGEKASSADIKVIPGVPDYDEYESIQEPETYMEET----- 69

Query: 57  KFSFFNRLASQLNAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYG 116
           K SFFNR  + LNAETKG+E +TDEEKTD SI++A SMWFSAN+VI++Y LGG+GP+V+ 
Sbjct: 70  KLSFFNRFVASLNAETKGVEPVTDEEKTDDSIINAASMWFSANLVIASYALGGLGPIVFN 129

Query: 117 LNFGTCVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSV 176
           LNFGT VL IIFF+ILGLL +AFFS+FGA+FGLRQM+LSR+L+GN TARI A+IN+I+ V
Sbjct: 130 LNFGTSVLVIIFFNILGLLSIAFFSVFGAEFGLRQMILSRYLLGNITARIFAIINIIACV 189

Query: 177 GWGVVNSVASSQLLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNF 236
           GWGVVN+VASSQLLNMVN   ++CPLWAGC+II+G T+LVTFFGY+ IHAYE+WSWVPNF
Sbjct: 190 GWGVVNTVASSQLLNMVNT-PNNCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPNF 248

Query: 237 AVFLVIIARLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDT 296
           AVFLVIIARL MSG F+GGEWTSGPTTAGNVLSFG A+FGFA GWT YAADYTVYMPR T
Sbjct: 249 AVFLVIIARLKMSGAFTGGEWTSGPTTAGNVLSFGGAVFGFAAGWTTYAADYTVYMPRST 308

Query: 297 NKFKIFFSLVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLH 356
           NK+ IFFSL  GLS PLFF +ILGAASAMGAVNNP W +YY++NGMGGVTYAILVPDSLH
Sbjct: 309 NKYTIFFSLTAGLSLPLFFTMILGAASAMGAVNNPDWMNYYKSNGMGGVTYAILVPDSLH 368

Query: 357 GFGEFCCVLLALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPAC 416
           GFG+FCCVLLA+ST+ANNIPNMY+I L+VQA+++P +KVPR  WT+AGNA TL ISI AC
Sbjct: 369 GFGQFCCVLLAMSTVANNIPNMYTIALSVQALYQPFSKVPRVAWTMAGNAFTLGISIAAC 428

Query: 417 YYFDGFMEDFMNSIGYYLAIYSATALAEHFIFRRGFKGYNVEDWDDNSKLPMGIAGCAAL 476
           YYF GFME+FMNSIGYYLAIY A +L+EHFI+R+GF+GYNVEDW+  SKLP+GIAG +AL
Sbjct: 429 YYFQGFMENFMNSIGYYLAIYIAISLSEHFIYRKGFQGYNVEDWNTWSKLPIGIAGTSAL 488

Query: 477 FVGAFGVALGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPLEIKYIGR 533
            VGAFGVALGMSQ+YWVGEI + IG++GGDIGFELGA WAF+VY +LRPLEIKY GR
Sbjct: 489 IVGAFGVALGMSQSYWVGEIGKLIGDHGGDIGFELGASWAFIVYNVLRPLEIKYTGR 545

>CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomyces
           cerevisiae YER056c FCY2 purine-cytosine permease or
           sp|P40039 Saccharomyces cerevisiae YER060w FCY21,
           hypothetical start
          Length = 543

 Score =  766 bits (1979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/530 (68%), Positives = 442/530 (83%), Gaps = 3/530 (0%)

Query: 5   SDKNVYEIQDLEMDLERNSEFSNL-PNDKKIDLGPTFSNEPASFIEITEETGSKFSFFNR 63
           S  N YE+ ++E     + + +N+  ND + D G  F+N  +S     EET  K  F +R
Sbjct: 16  SHSNDYELNEVEKQPVEDVKTTNVNTNDFEYDYGDDFTN--SSEAATVEETKLKLGFISR 73

Query: 64  LASQLNAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFGTCV 123
           LA ++NAETKG+E +TDEEKTD S+L+A SMWFSAN+V+++Y LG +GP+V+ LNFGT V
Sbjct: 74  LALKMNAETKGVEPVTDEEKTDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTSV 133

Query: 124 LTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGVVNS 183
           LTI+FF+++GL+ VAFFS+FGA+FGLRQM+LSRFL+GN TAR+ A INV++ VGWGVVN+
Sbjct: 134 LTIVFFNMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVNT 193

Query: 184 VASSQLLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFLVII 243
           V ++QLL++VNQG H  PLW GC++I+G T++VTFFGYS IHAYERWSWVPNFAVFLVII
Sbjct: 194 VVAAQLLHIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVII 253

Query: 244 ARLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFKIFF 303
           ARLH SG FS G WTSG TTAG VLSFG AI+GFA GWT YAADYTVYMPR  NKFKIFF
Sbjct: 254 ARLHKSGQFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYMPRTMNKFKIFF 313

Query: 304 SLVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGEFCC 363
            L  GL+FPL F +ILGAASAMGAVNNP W   Y  + MGG+TYAILVP+SLHGFGEFCC
Sbjct: 314 FLCAGLAFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVPNSLHGFGEFCC 373

Query: 364 VLLALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFDGFM 423
           VLLA+STIANNIPNMY+I L+VQA++EP ++VPR +WTLAGNAA + ISIPA YYF+GF+
Sbjct: 374 VLLAMSTIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGISIPASYYFEGFL 433

Query: 424 EDFMNSIGYYLAIYSATALAEHFIFRRGFKGYNVEDWDDNSKLPMGIAGCAALFVGAFGV 483
           E+FM+SIGYYLAIY A +L+EHFI+RRGFKGYN+EDW++  +LP+GIAGC+ALFVGAFGV
Sbjct: 434 ENFMDSIGYYLAIYIAISLSEHFIYRRGFKGYNIEDWNNWDRLPIGIAGCSALFVGAFGV 493

Query: 484 ALGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPLEIKYIGR 533
           ALGMSQTYW GEI+RHIG++GGDIGFELG  WAF+V+ I+RPLEIKY GR
Sbjct: 494 ALGMSQTYWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRPLEIKYFGR 543

>YER056C (FCY2) [1485] chr5 complement(266511..268112)
           Cytosine/purine permease, member of the purine/cytosine
           permease family of membrane transporters [1602 bp, 533
           aa]
          Length = 533

 Score =  757 bits (1955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/533 (68%), Positives = 440/533 (82%), Gaps = 11/533 (2%)

Query: 7   KNVYEIQDLEMDLERNSEF-SNLPNDKKIDLGPTFS----NEPASFIEITEETGSKFSFF 61
            NVYEIQDLE   +R+    S+L N+KK+    TF+    ++    +E +E T  K S+F
Sbjct: 6   NNVYEIQDLE---KRSPVIGSSLENEKKVAASETFTATSEDDQQYIVESSEAT--KLSWF 60

Query: 62  NRLASQLNAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFGT 121
           ++  + LNAETKG+E +T++EKTD SIL+A SMWFSANMVI++Y LG +GP+V+GLNFG 
Sbjct: 61  HKFFASLNAETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQ 120

Query: 122 CVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGVV 181
            VL IIFF+I+GL+ VAFFS+FGA+ GLRQM+LSR+L+GN TARI ++INVI+ VGWG+V
Sbjct: 121 SVLVIIFFNIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIV 180

Query: 182 NSVASSQLLNMVNQGH-HSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFL 240
           N+  S+QLLNMVN+G  H CP+WAGC+IIIG T+LVTFFGYS IHAYE+WSWVPNFAVFL
Sbjct: 181 NTSVSAQLLNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFL 240

Query: 241 VIIARLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFK 300
           VIIA+L  SG F GGEW  G TTAG+VLSFG +IFGFA GWT YAADYTVYMP+ TNK+K
Sbjct: 241 VIIAQLSRSGKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYK 300

Query: 301 IFFSLVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGE 360
           IFFSLV GL+FPLFF +ILGAASAM A+N+PTW  YY  N MGGV YAILVP+SL+GFG+
Sbjct: 301 IFFSLVAGLAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQ 360

Query: 361 FCCVLLALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFD 420
           FCCVLLALSTIANNIPNMY++ L+ QA+W PLAK+PR +WT+AGNAATL ISIPA YYFD
Sbjct: 361 FCCVLLALSTIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFD 420

Query: 421 GFMEDFMNSIGYYLAIYSATALAEHFIFRRGFKGYNVEDWDDNSKLPMGIAGCAALFVGA 480
           GFME+FM+SIGYYLAIY A + +EHF +RR F  YN++DWD+   LP+GIAG AAL VGA
Sbjct: 421 GFMENFMDSIGYYLAIYIAISCSEHFFYRRSFSAYNIDDWDNWEHLPIGIAGTAALIVGA 480

Query: 481 FGVALGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPLEIKYIGR 533
           FGVALGM QTYWVGEI R IG+YGGDIGFELGA WAF++Y ILRPLE+KY GR
Sbjct: 481 FGVALGMCQTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILRPLELKYFGR 533

>YER060W (FCY21) [1490] chr5 (274565..276151) Protein with
           similarity to Fcy2p, member of the purine/cytosine
           family of secondary active transporters [1587 bp, 528
           aa]
          Length = 528

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/525 (66%), Positives = 417/525 (79%), Gaps = 14/525 (2%)

Query: 10  YEIQDLEMDLERNSEFSNLPNDKKIDLGPTFSNEPASFIEITEE-TGSKFSFFNRLASQL 68
           YE++DLE          +  +D K      F ++  S    TEE   +K SF NR+A+ L
Sbjct: 17  YELKDLE----------SRAHDAKTPSTNEFYDDVES--HGTEELVEAKLSFLNRIAAGL 64

Query: 69  NAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFGTCVLTIIF 128
           +AETKGIE IT++EKTD SIL+A SMWFSANMV+ AY +G +GP+V+ LNFG  V  IIF
Sbjct: 65  SAETKGIEPITEDEKTDDSILNAASMWFSANMVLPAYAIGALGPMVFDLNFGQSVFVIIF 124

Query: 129 FSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGVVNSVASSQ 188
           F++LGL+ VAFFS+FGA+ GLRQM+LSR+L+GN  ARI + IN I+ +GWG+VN+VASSQ
Sbjct: 125 FNLLGLVSVAFFSVFGAELGLRQMILSRYLVGNIAARIFSFINFIACIGWGIVNTVASSQ 184

Query: 189 LLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFLVIIARLHM 248
           +LNMVN GH  CPLWAGC++IIGAT++VTFFGY  IHAYE+W+WVPNFAVFLVIIARL  
Sbjct: 185 VLNMVNPGHQ-CPLWAGCIVIIGATVIVTFFGYGVIHAYEKWAWVPNFAVFLVIIARLAR 243

Query: 249 SGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFKIFFSLVGG 308
           S  F  GEWTSGPTTAGNVLSFG  ++GFA GWT YAADYTVYMPR TNK+KIFFSLV G
Sbjct: 244 SKKFVLGEWTSGPTTAGNVLSFGSTVYGFAAGWTTYAADYTVYMPRKTNKYKIFFSLVVG 303

Query: 309 LSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGEFCCVLLAL 368
           L+ PL+F +ILGAA AM A+ +P W  YY  N +GG+T+A+LVP+S+HGFG+FCCVLL+L
Sbjct: 304 LATPLYFTMILGAAVAMAAIGDPAWKTYYDENSIGGLTFAVLVPNSVHGFGQFCCVLLSL 363

Query: 369 STIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFDGFMEDFMN 428
           STIANN+PNMY+I L+VQA WEPLAKVPR IWTL GNAA L I+IPACYYF  FM  FM+
Sbjct: 364 STIANNVPNMYTIALSVQATWEPLAKVPRVIWTLLGNAAALGIAIPACYYFSTFMNYFMD 423

Query: 429 SIGYYLAIYSATALAEHFIFRRGFKGYNVEDWDDNSKLPMGIAGCAALFVGAFGVALGMS 488
           SIGYYLAIY A A +EHFI+RR F  YNV+DWD   +LP+GIAG AAL VGAFGVALGM 
Sbjct: 424 SIGYYLAIYIAIACSEHFIYRRSFSAYNVDDWDSWERLPIGIAGTAALIVGAFGVALGMC 483

Query: 489 QTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPLEIKYIGR 533
           QTYWVGEI+R IG+YGGDIGFELG  WAF+VY I RP E+KY GR
Sbjct: 484 QTYWVGEISRLIGDYGGDIGFELGLSWAFIVYNIARPFELKYFGR 528

>Sklu_1893.2 YER056C, Contig c1893 1725-3266
          Length = 513

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/529 (66%), Positives = 414/529 (78%), Gaps = 18/529 (3%)

Query: 5   SDKNVYEIQDLEMDLERNSEFSNLPNDKKIDLGPTFSNEPASFIEITEETGSKFSFFNRL 64
           S K  Y IQD+E                 ++L  T   +    +E TE T    SF +R 
Sbjct: 3   SSKEEYAIQDME-------------KQNPLELTET---DSTPVVESTEYT--TVSFIDRW 44

Query: 65  ASQLNAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFGTCVL 124
           A++L AETKGIE ITDEEK D SIL+A SMWFSANMVI+AY LG +G  V+GLNF   VL
Sbjct: 45  AAKLKAETKGIEPITDEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVL 104

Query: 125 TIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGVVNSV 184
           TIIFFS LGL+PVAFFS+FGA+ G+RQMVLSRFL+GN TARI A+INVI+ VGWG VN++
Sbjct: 105 TIIFFSFLGLIPVAFFSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTI 164

Query: 185 ASSQLLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFLVIIA 244
           AS+ LL+M+N G   CP WA C+II+ +TI+VTFFGY  IHAYE+WSWVPNFAVFLVIIA
Sbjct: 165 ASASLLHMINPGGAQCPPWAACLIIVFSTIIVTFFGYRVIHAYEKWSWVPNFAVFLVIIA 224

Query: 245 RLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFKIFFS 304
           RL +SGNFS GEWTSG TTAG VLSFG +IFGFA+GWT YAADYTVYMPR TNK+KIFF+
Sbjct: 225 RLKISGNFSTGEWTSGATTAGGVLSFGGSIFGFASGWTTYAADYTVYMPRSTNKWKIFFA 284

Query: 305 LVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGEFCCV 364
           LV GL+FPL F LILGAAS  G   N  W  YY+++ +GG+ YAILV DSLHGFGEFCCV
Sbjct: 285 LVFGLAFPLCFSLILGAASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCV 344

Query: 365 LLALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFDGFME 424
           LLA+ST+ANNIPNMYSI L  Q++WEPLAKVPR  WT+AGN  TLAI+IPA Y F+ FM 
Sbjct: 345 LLAMSTVANNIPNMYSIALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMS 404

Query: 425 DFMNSIGYYLAIYSATALAEHFIFRRGFKGYNVEDWDDNSKLPMGIAGCAALFVGAFGVA 484
            FM +I YYLAIY A +L+EHF +R+GFKGYNV+DW+   +LP+G AGCAALF+GAFGVA
Sbjct: 405 SFMEAIAYYLAIYIAISLSEHFFYRKGFKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVA 464

Query: 485 LGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPLEIKYIGR 533
            GMSQTYW G+IARHIGEYGGDIGFELG G++F+ Y ILRPLEIKY GR
Sbjct: 465 FGMSQTYWEGQIARHIGEYGGDIGFELGMGFSFITYNILRPLEIKYTGR 513

>CAGL0J02948g 282559..284106 highly similar to sp|P40039
           Saccharomyces cerevisiae YER060w or sp|P17064
           Saccharomyces cerevisiae YER056c FCY2, hypothetical
           start
          Length = 515

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/534 (64%), Positives = 422/534 (79%), Gaps = 20/534 (3%)

Query: 1   MSSLSDKNVYEIQDLEMDLERNSEFSNLPNDKKIDLGPTFSNEPASFIEITEETGSKFSF 60
           MS    K++Y   D+EM +E ++  S++  D   D         A+ +E      +K S 
Sbjct: 1   MSYEDKKDLY---DMEMQVESSAN-SHVETDGYND---------ATVLE------TKLSL 41

Query: 61  FNRLASQLNAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFG 120
            NRLA+ ++AETKGIE ITD+EK D S+++A SMWFSANMV+ A  +GG+GPLV+GLNFG
Sbjct: 42  LNRLAAMISAETKGIEPITDDEKNDDSLINAASMWFSANMVLPALAIGGLGPLVFGLNFG 101

Query: 121 TCVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGV 180
             VLTI+FF+ILGL  VAFFS+FGAKFGLRQMVLSR+L+GN TARI A+IN ++ VGWG+
Sbjct: 102 VSVLTIVFFNILGLFAVAFFSVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGI 161

Query: 181 VNSVASSQLLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFL 240
           VN+VA+SQLLN +N G H  PLW GC++IIGATILV+FFGY  IH YE++SWVPNFAVFL
Sbjct: 162 VNTVAASQLLNEINPGSHQLPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFL 221

Query: 241 VIIARLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFK 300
           V+IARL +SG F  G W SGPTTAG+VLSFG A+FGFA+GWT YAADYTVYMPR+TN +K
Sbjct: 222 VLIARLKISGKFHNGAWGSGPTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYK 281

Query: 301 IFFSLVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGE 360
           IFF+LV GL+FPLFF +ILG+A A  AV+   W ++Y  NGMGG+T+AILVPDSLHGFG+
Sbjct: 282 IFFALVAGLAFPLFFTMILGSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQ 341

Query: 361 FCCVLLALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFD 420
           FCCV+LA+STIANN+PNMY+I L+ Q++W+P AK+PR +WT+ GN A L ISIPACYYF 
Sbjct: 342 FCCVVLAMSTIANNVPNMYTIALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFS 401

Query: 421 GFMEDFMNSIGYYLAIYSATALAEHFIFRR-GFKGYNVEDWDDNSKLPMGIAGCAALFVG 479
            FM+ FM+SI YYL+IY + AL EH I+R   F  YNVEDW++  KLP+GIAG  +L VG
Sbjct: 402 TFMQYFMDSIAYYLSIYISIALCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVG 461

Query: 480 AFGVALGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPLEIKYIGR 533
           AFGVALGMSQ+YWVGEIARHIGEYGGDI  ELGAGWAF+ Y I RPLE+KY GR
Sbjct: 462 AFGVALGMSQSYWVGEIARHIGEYGGDIAIELGAGWAFIAYNICRPLELKYFGR 515

>YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine
           permease with similarity to Fcy2p, member of the
           purine/cytosine subfamily of the nucleobase:cation
           symporter-1 (NCS1) family [1593 bp, 530 aa]
          Length = 530

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/492 (67%), Positives = 402/492 (81%), Gaps = 1/492 (0%)

Query: 43  EPASFIEITEETGSKFSFFNRLASQLNAETKGIERITDEEKTDGSILDATSMWFSANMVI 102
           E        E   +K SFFNR+A+ LNAETKGIE +T++EK D SIL+A ++WFSANMVI
Sbjct: 39  EGVELHRTNEFIDNKPSFFNRIAAALNAETKGIEPVTEDEKNDDSILNAATIWFSANMVI 98

Query: 103 SAYTLGGIGPLVYGLNFGTCVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNS 162
            AY++G +GPLV+GLNFG  VL IIFF+ILGL+PVA FS+FG + GLRQM+LSR+L GN 
Sbjct: 99  VAYSVGALGPLVFGLNFGQSVLVIIFFNILGLIPVALFSLFGVELGLRQMILSRYLAGNI 158

Query: 163 TARIIAVINVISSVGWGVVNSVASSQLLNMVNQGH-HSCPLWAGCVIIIGATILVTFFGY 221
           TAR  +++NVI+ VGW V+N   S+QLLNMVN+G  H+CP+WAGC+II G T+LVTFFGY
Sbjct: 159 TARFFSLVNVIACVGWCVLNISVSAQLLNMVNEGSGHNCPIWAGCLIIAGGTVLVTFFGY 218

Query: 222 SYIHAYERWSWVPNFAVFLVIIARLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGW 281
           S +HAYE+WSWVPNFA FLVIIA+L  SG F GGEW  G TTAG VLSFG ++FG A GW
Sbjct: 219 SVVHAYEKWSWVPNFAAFLVIIAQLSRSGKFKGGEWVGGATTAGGVLSFGSSVFGSAAGW 278

Query: 282 TVYAADYTVYMPRDTNKFKIFFSLVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNG 341
             YAADYTVYMP+ T+K+KIFFS+V GL+FPLFF +ILGAA  M A+N+PTW  YY  N 
Sbjct: 279 ATYAADYTVYMPKTTSKYKIFFSVVAGLAFPLFFTMILGAACGMAALNDPTWKSYYDKNA 338

Query: 342 MGGVTYAILVPDSLHGFGEFCCVLLALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIWT 401
           MGGV YAILVP+SL+GFG+FCCVLLALST+ANN+P MY++ L+ QA+W PLAK+PR +WT
Sbjct: 339 MGGVIYAILVPNSLNGFGQFCCVLLALSTVANNVPGMYTVALSAQALWAPLAKIPRVVWT 398

Query: 402 LAGNAATLAISIPACYYFDGFMEDFMNSIGYYLAIYSATALAEHFIFRRGFKGYNVEDWD 461
           +AGNAATL ISIPA YYFDGFME+FM+SIGYYLAIY A A +EHFI+RR F  YN++DWD
Sbjct: 399 MAGNAATLGISIPATYYFDGFMENFMDSIGYYLAIYIAIACSEHFIYRRSFSAYNIDDWD 458

Query: 462 DNSKLPMGIAGCAALFVGAFGVALGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYV 521
           +   LP+GIAG AAL  GAFGVALGM QTYWVGEI+R IGEYGGDIGFELG  WAF++Y 
Sbjct: 459 NWEHLPIGIAGTAALIAGAFGVALGMCQTYWVGEISRLIGEYGGDIGFELGGSWAFIIYN 518

Query: 522 ILRPLEIKYIGR 533
           I+RPLE+KY GR
Sbjct: 519 IVRPLELKYFGR 530

>Kwal_23.5819
          Length = 516

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/529 (60%), Positives = 405/529 (76%), Gaps = 17/529 (3%)

Query: 6   DKNVYEIQDLEMDLERNSEFSNLPNDKKIDLGPTFSNEPASFIEITEETGSKFSFFNRLA 65
            K  YEIQD+E  L    E S+              ++    +E TE T  K S  +R+A
Sbjct: 4   QKEEYEIQDVEKRLNSRFEISD--------------DDSQPVVESTEYT--KLSIVDRIA 47

Query: 66  SQLNAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFGTCVLT 125
           + L AETKGIE +T+EEK D SI +A SMWFSANMVI+A++LG +GP+V+GLNF  CVL 
Sbjct: 48  ASLRAETKGIEPVTEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLA 107

Query: 126 IIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGVVNSVA 185
           ++ FS LG++PVA++S+FGA+ GLRQMVLSRFL+GN TARI A+IN+I+ VGWG VN++A
Sbjct: 108 VVLFSALGVIPVAYYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIA 167

Query: 186 SSQLLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFLVIIAR 245
           S+QLL+M+N G   CP WAGC+II+ +TILVTFFGY  IHAYE+WSW+PNFAVFLVIIAR
Sbjct: 168 SAQLLHMINPGGARCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIAR 227

Query: 246 LHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFKIFFSL 305
           L + G+FS GEW SG   A  VLSFG  IFGFA+GWT YAADYTVYMPR TNK K+FF++
Sbjct: 228 LKIDGSFSSGEWISGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAV 287

Query: 306 VGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGEFCCVL 365
           + GL FPL F +ILGAA+AM + NN  +   + + G+GG+ YAILV +SLHGFG+FCCVL
Sbjct: 288 IFGLMFPLCFSIILGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVL 347

Query: 366 LALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFDGFMED 425
           LA+ST+ANNIPNMYSI L  QA+WEPLAK+PR  WT+AGN  TLAI+IPA Y F+ FM +
Sbjct: 348 LAMSTVANNIPNMYSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTN 407

Query: 426 FMNSIGYYLAIYSATALAEHFIFRR-GFKGYNVEDWDDNSKLPMGIAGCAALFVGAFGVA 484
           FM++I YYL+IY   +L+EH  FR+  F+ YNV+DW+   KLP+G AGC ALFVGA GVA
Sbjct: 408 FMDAIAYYLSIYIGISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYAGCCALFVGAVGVA 467

Query: 485 LGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPLEIKYIGR 533
           +GM QTYW G+IAR IG+YG DIGFE+G  ++ +VY ILRPLE+KY+GR
Sbjct: 468 VGMEQTYWTGQIARKIGDYGADIGFEIGFCFSVIVYNILRPLELKYVGR 516

>KLLA0C08283g complement(725563..727122) similar to sp|P17064
           Saccharomyces cerevisiae YER056c FCY2 purine-cytosine
           permease, start by similarity
          Length = 519

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/533 (62%), Positives = 401/533 (75%), Gaps = 14/533 (2%)

Query: 1   MSSLSDKNVYEIQDLEMDLERNSEFSNLPNDKKIDLGPTFSNEPASFIEITEETGSKFSF 60
           MSS S K  Y + D+E      ++F  +  ++ +             +E TE T  K S+
Sbjct: 1   MSSSSSKEEYVLHDVEKQELSKTQFDEVLEEEPV------------IVETTEVT--KLSW 46

Query: 61  FNRLASQLNAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFG 120
            + LAS+L+AETKGIE ITD+EK D  IL+A SMW SAN+VI+A++LG IG  V+GLNFG
Sbjct: 47  VDHLASKLHAETKGIEPITDDEKDDDDILNAASMWLSANLVIAAFSLGCIGTSVFGLNFG 106

Query: 121 TCVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGV 180
             VL I+FFS LGLLPVAFFS+FGA+ GLRQ+VLSRFL+GN TARI   IN+I+ VGWG 
Sbjct: 107 EAVLVIVFFSFLGLLPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACVGWGA 166

Query: 181 VNSVASSQLLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFL 240
           VN++AS+ LL++VN     CP WAGC+III  TI+VTFFGY  IHAYE+WSWVPNFAVFL
Sbjct: 167 VNTIASASLLHIVNPSGPDCPPWAGCLIIIFGTIIVTFFGYRVIHAYEKWSWVPNFAVFL 226

Query: 241 VIIARLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFK 300
           VIIARL  +G F+ G W SG TTAG VLSFG ++FGFATGWT YA+DYTVYMPR TNK K
Sbjct: 227 VIIARLAKAGTFTAGSWGSGSTTAGGVLSFGSSVFGFATGWTTYASDYTVYMPRTTNKKK 286

Query: 301 IFFSLVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGE 360
           +F ++V GL+FPL F +ILGAA+  G   N  W + Y    +GG+ YAIL+ DSL GFG 
Sbjct: 287 VFAAIVLGLAFPLCFSMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLWGFGS 346

Query: 361 FCCVLLALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFD 420
           FCCV+LALSTI+NNIPNMYSI L  QA++EPLAKVPR  WT+ GN  TLAI+IPA Y F+
Sbjct: 347 FCCVVLALSTISNNIPNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFE 406

Query: 421 GFMEDFMNSIGYYLAIYSATALAEHFIFRRGFKGYNVEDWDDNSKLPMGIAGCAALFVGA 480
            FM  FM+SIGYYLAIYSA AL+EHFI+R GFKGYNV+DWD   KLP+G AG  ALF+GA
Sbjct: 407 TFMTTFMDSIGYYLAIYSAIALSEHFIYRGGFKGYNVDDWDRWDKLPIGYAGTFALFIGA 466

Query: 481 FGVALGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPLEIKYIGR 533
           FGVA GM+Q YW G+I R IGE GGDIGFELGAG+AF+ Y I RPLE KY+GR
Sbjct: 467 FGVAFGMNQIYWQGQIGRLIGENGGDIGFELGAGFAFITYNIFRPLEKKYVGR 519

>Scas_715.47d1
          Length = 523

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/489 (61%), Positives = 375/489 (76%), Gaps = 1/489 (0%)

Query: 46  SFIEITEETGSKFSFFNRLASQLNAETKGIERITDEEKTDGSILDATSMWFSANMVISAY 105
            F +      S  +F  ++A++LNAET+GIE + D+EKTD +I +   +WFSAN VISAY
Sbjct: 35  DFSKTVSSEASNIAFLQKIATRLNAETRGIEPVRDDEKTDANIWNPCMLWFSANFVISAY 94

Query: 106 TLGGIGPLVYGLNFGTCVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTAR 165
            +G +GP+V+GLNFG   LTI+FF+I+G++PVA+FS+FG + GLRQMVLSR+L+GN   R
Sbjct: 95  AVGALGPMVFGLNFGITSLTIVFFNIIGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGR 154

Query: 166 IIAVINVISSVGWGVVNSVASSQLLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIH 225
             + IN I+ VGW V+NS+ S+QLLNMVN   H CP WAG ++++  TILVTFFG   I 
Sbjct: 155 FFSFINCIACVGWCVLNSICSAQLLNMVNLHGHRCPFWAGIMVVVLGTILVTFFGIKVIT 214

Query: 226 AYERWSWVPNFAVFLVIIARLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYA 285
           A+ERWSWVPN AVFLVIIARLH SG FSGG+WTSGPTTAGNVLS GC  +G+A  W  Y+
Sbjct: 215 AFERWSWVPNLAVFLVIIARLHKSGQFSGGKWTSGPTTAGNVLSLGCVAYGYAGAWATYS 274

Query: 286 ADYTVYMPRDTNKFKIFFSLVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGV 345
           ADYTVYMPR+TNK K+FF L   L+ PL F +ILGAA  MG VNN TW  YY +NG+GG+
Sbjct: 275 ADYTVYMPRNTNKVKLFFGLCVALTVPLCFTMILGAAVGMGGVNNATWAKYYSSNGIGGL 334

Query: 346 TYAILVPDSLHGFGEFCCVLLALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGN 405
           TY +LVP+S+HGFGEFCCVLLALSTIANN PNMY++G + QAIWEPLA+VPRA  TL GN
Sbjct: 335 TYEVLVPNSVHGFGEFCCVLLALSTIANNTPNMYTLGFSFQAIWEPLARVPRAFCTLFGN 394

Query: 406 AATLAISIPACYYFDGFMEDFMNSIGYYLAIYSATALAEHFIFRR-GFKGYNVEDWDDNS 464
           AA   +   ACYYFD FME FM+++ YY AIY +  +AEH IFR+  FK Y+V+DW   S
Sbjct: 395 AAVFVVGCCACYYFDSFMEKFMDTLAYYGAIYISLGMAEHLIFRKCSFKAYDVKDWKTFS 454

Query: 465 KLPMGIAGCAALFVGAFGVALGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILR 524
           KLP+GIAG    FV AFGVALGM Q+YWVGEI R IG+ GGD+GFE+GA W F+ YV++R
Sbjct: 455 KLPIGIAGGVGFFVAAFGVALGMCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVR 514

Query: 525 PLEIKYIGR 533
           PLE+KY GR
Sbjct: 515 PLELKYFGR 523

>Kwal_34.15730
          Length = 518

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/528 (57%), Positives = 396/528 (75%), Gaps = 13/528 (2%)

Query: 7   KNVYEIQDLEMDLERNSEFSNLPNDKKIDLGPTFSNEPASFIEITEETGSKFSFFNRLAS 66
           K+ YE+QDLE+++          N    D     S  P          G   +  NRLA 
Sbjct: 3   KDKYEVQDLELNVYSQE------NTSADDATRGSSQAPEKL------NGGGMAVLNRLAK 50

Query: 67  QLNAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFGTCVLTI 126
           +L AETKGIE +T++EK D SI +A  +WFSANMVI+A+++G +GPLV+ LNF  CV++I
Sbjct: 51  KLRAETKGIEPVTEDEKDDSSIWNAAFVWFSANMVIAAFSVGMLGPLVFSLNFWGCVVSI 110

Query: 127 IFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGVVNSVAS 186
           + F+ +G+LPV  +S+FG +  LRQMVLSRFL+GN TARI A+INVI+ +GWGVVN+V S
Sbjct: 111 VIFTFIGVLPVCLYSVFGVQLSLRQMVLSRFLLGNVTARIFALINVIACIGWGVVNTVTS 170

Query: 187 SQLLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFLVIIARL 246
           +QLL+M+N     CP WAGC+II+ +TI VTFFGY  IH + ++SW+PNF VF+VIIARL
Sbjct: 171 AQLLHMINPTGGRCPPWAGCLIIVFSTIFVTFFGYRVIHTFGKYSWIPNFIVFIVIIARL 230

Query: 247 HMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFKIFFSLV 306
            + G+FS G+W SG TTAG++LS G  +FGFATGWT YAAD+TVYMPR  N+ ++FF+++
Sbjct: 231 KIDGSFSVGKWESGSTTAGSILSLGGIVFGFATGWTTYAADFTVYMPRTVNRAEVFFAVM 290

Query: 307 GGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGEFCCVLL 366
            GL FPL F +ILGAA+   A+NNP ++++Y+++  GG+ YAILVP SLHGFG+FCCVLL
Sbjct: 291 LGLVFPLCFTIILGAAAGCAALNNPVYHEFYESDHAGGLVYAILVPRSLHGFGQFCCVLL 350

Query: 367 ALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFDGFMEDF 426
           A+ST+AN +PNMYSI L  QA+WEPLAKVPR  WTLAGN  TLAI+IPA Y F+ FM +F
Sbjct: 351 AMSTVANMVPNMYSIALGTQALWEPLAKVPRVFWTLAGNLITLAIAIPAYYRFEAFMTNF 410

Query: 427 MNSIGYYLAIYSATALAEHFIFRRG-FKGYNVEDWDDNSKLPMGIAGCAALFVGAFGVAL 485
           M+SI YYL+IY   +L+EHFIFR+  F  Y+  +W+D  +LP+G AGCAALFVGA GVAL
Sbjct: 411 MDSIAYYLSIYIGVSLSEHFIFRQNKFSNYDTSEWNDWHRLPLGYAGCAALFVGAIGVAL 470

Query: 486 GMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPLEIKYIGR 533
           GM QTYW GEI R IGE+GGDIGFELG  ++ +VY  LRPLEIK++GR
Sbjct: 471 GMHQTYWTGEIGRLIGEFGGDIGFELGLAFSMIVYTALRPLEIKFVGR 518

>CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces
           cerevisiae YER060w or sp|P17064 Saccharomyces cerevisiae
           YER056c, hypothetical start
          Length = 540

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/522 (56%), Positives = 381/522 (72%), Gaps = 15/522 (2%)

Query: 13  QDLEM-DLERNSEFSNLPNDKKIDLGPTFSNEPASFIEITEETGSKFSFFNRLASQLNAE 71
           +DLE+ D+    +F+ L N          S E        +ET  K  F   L   LNAE
Sbjct: 33  EDLELKDITFKEKFNELDNK---------STETDK-----DETCFKSPFIIWLKRTLNAE 78

Query: 72  TKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFGTCVLTIIFFSI 131
           TKG+E I + EK D +I  ++ +WFSAN+V++AY +G +GP VY LNF   VLTI+FF+I
Sbjct: 79  TKGVEPINENEKNDTNIFGSSFVWFSANLVLAAYGVGSLGPTVYHLNFAISVLTIVFFNI 138

Query: 132 LGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGVVNSVASSQLLN 191
           LGL+ V+FFS+FGA+ GLRQM++SR+L+GN TARI A +N I  VGW V+N   +++L  
Sbjct: 139 LGLVSVSFFSVFGAELGLRQMIISRYLVGNVTARIFAALNCIGCVGWDVLNIYLAAKLFA 198

Query: 192 MVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFLVIIARLHMSGN 251
           ++  G +  PLW GC++I+G+T+ +   GY +IH YE+WSW+PN AVFL+II+R+ +S  
Sbjct: 199 IIKTGGNHLPLWGGCIVIVGSTVFIAALGYKFIHIYEKWSWIPNLAVFLIIISRIKISRE 258

Query: 252 FSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFKIFFSLVGGLSF 311
           FS G WTSG TTAGNVLSFG AIFG A GW  Y+ADYTVYMPR TNKF+IFF    GL+F
Sbjct: 259 FSNGPWTSGSTTAGNVLSFGSAIFGSAAGWVTYSADYTVYMPRRTNKFRIFFFNSIGLAF 318

Query: 312 PLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGEFCCVLLALSTI 371
            L F +I+GAA+ + AVNN  W + Y    +GGVTYA+LVP+SLHGFG+FCCV+LA+ST+
Sbjct: 319 SLIFTMIVGAAAGICAVNNSKWMELYNEFQIGGVTYALLVPNSLHGFGKFCCVILAMSTV 378

Query: 372 ANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFDGFMEDFMNSIG 431
           ANN+P+MY+I L+VQA+WEPL  VPRAIWT+  N   L ISIPACY+F  FM++FM SIG
Sbjct: 379 ANNVPSMYTIALSVQALWEPLTSVPRAIWTIFANIVVLGISIPACYFFQSFMQNFMGSIG 438

Query: 432 YYLAIYSATALAEHFIFRRGFKGYNVEDWDDNSKLPMGIAGCAALFVGAFGVALGMSQTY 491
           Y+ A+Y   +LAEH +FRR F  YNV D  +  KLP+G AGC AL VG+FGVALGM+QTY
Sbjct: 439 YFYALYIGISLAEHCVFRRKFGNYNVNDHSNWEKLPIGFAGCIALIVGSFGVALGMAQTY 498

Query: 492 WVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPLEIKYIGR 533
           WVGEIAR IG YGGDIGFELG  WAF+ Y+I+RP+EIKY GR
Sbjct: 499 WVGEIARKIGTYGGDIGFELGMSWAFLTYIIIRPIEIKYYGR 540

>ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH]
           complement(551981..553555) [1575 bp, 524 aa]
          Length = 524

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/493 (55%), Positives = 365/493 (74%), Gaps = 4/493 (0%)

Query: 41  SNEPASFIEITEETGSKFSFFNRLASQLNAETKGIERITDEEKTDGSILDATSMWFSANM 100
           + EP +  ++ E   +  S+ NR A++LNAETKG+  +T++E  D S+L+A SMWFSAN+
Sbjct: 36  AEEPVT-PQVDETEYTTLSWVNRWAARLNAETKGVSPVTEDECHDSSLLNAASMWFSANL 94

Query: 101 VISAYTLGGIGPLVYGLNFGTCVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIG 160
           VI+A+ +G +   V+ LN    VL  + FS +G+L VAFFS+FGA+FGLRQM+LSR+L+G
Sbjct: 95  VIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVAFFSVFGAEFGLRQMILSRYLMG 154

Query: 161 NSTARIIAVINVISSVGWGVVNSVASSQLLNMVNQGHHSCPLWAGCVIIIGATILVTFFG 220
           N+TARI  +INVI+ VGW  VN++AS+ LL+M+N     CP WA  +II+ +T+ +TFFG
Sbjct: 155 NTTARIFCLINVIACVGWSSVNTIASTTLLHMINPTGARCPPWAASLIIVLSTVFITFFG 214

Query: 221 YSYIHAYERWSWVPNFAVFLVIIARLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATG 280
           Y  IHAYE+WSWVPN  VFL+IIARL ++GNF+ G    G  TAG+ LS+G  +FGFA+G
Sbjct: 215 YRVIHAYEKWSWVPNLVVFLIIIARLAIAGNFTAGSSLGGKATAGSFLSYGSVVFGFASG 274

Query: 281 WTVYAADYTVYMPRDTNKFKIFFSLVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNN 340
           WT YAADYTVYMP+++NK++IFF ++ GL+ PL F LILGAA+      NPTW +YY+ +
Sbjct: 275 WTTYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFTLILGAAAGRCVHTNPTWGEYYKKH 334

Query: 341 GMGGVTYAILVPDSLHGFGEFCCVLLALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIW 400
            +GG+ +AIL  ++L GFG+FCCV+LA+ST+ANNIPNMYSI L+ QA+W   A+VPR  W
Sbjct: 335 SVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIPNMYSIALSTQALWSRFARVPRVFW 394

Query: 401 TLAGNAATLAISIPACYYFDGFMEDFMNSIGYYLAIYSATALAEHFIFRRGFKGYNVEDW 460
           TL GNA +L I+I A Y F+ FM  FM+SIGYYL+IY    + EHF+FR+GF+GY+V  W
Sbjct: 395 TLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYIVICVTEHFVFRKGFRGYDVSHW 454

Query: 461 DDNSKLPMGIAGCAALFVGAFGVALGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVY 520
           D    LP G AGCAAL VGA GVA+GMS  Y+ G IA+     GGDIGF L AG++F+VY
Sbjct: 455 DRPDLLPAGYAGCAALCVGAVGVAMGMSHEYYTGPIAKLA---GGDIGFLLAAGFSFIVY 511

Query: 521 VILRPLEIKYIGR 533
           +  RPLE+KY GR
Sbjct: 512 ICCRPLELKYTGR 524

>Scas_715.54d
          Length = 232

 Score =  239 bits (611), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 114/205 (55%), Positives = 151/205 (73%), Gaps = 3/205 (1%)

Query: 41  SNEPAS---FIEITEETGSKFSFFNRLASQLNAETKGIERITDEEKTDGSILDATSMWFS 97
           SN+  S   F +      S  +F  ++A++LNAET+GIE + D+EKTD +I +   +WFS
Sbjct: 28  SNDTTSEDDFSKTVSSEASNIAFLQKIATRLNAETRGIEPVRDDEKTDANIWNPCMLWFS 87

Query: 98  ANMVISAYTLGGIGPLVYGLNFGTCVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRF 157
           AN VISAY +G +GP+V+GLNFG   LTI+FF+I+G++PVA+FS+FG + GLRQMVLSR+
Sbjct: 88  ANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVVPVAYFSLFGPELGLRQMVLSRY 147

Query: 158 LIGNSTARIIAVINVISSVGWGVVNSVASSQLLNMVNQGHHSCPLWAGCVIIIGATILVT 217
           L+GN   R  + IN I+ VGW V+NS+ S+QLLNMVN   H CP WAG ++++  TILVT
Sbjct: 148 LVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNLHGHRCPFWAGIMVVVLGTILVT 207

Query: 218 FFGYSYIHAYERWSWVPNFAVFLVI 242
           FFG   I A+ERWSWVPN AVFLVI
Sbjct: 208 FFGIKVITAFERWSWVPNLAVFLVI 232

>KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, hypothetical start
          Length = 523

 Score =  233 bits (594), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 165/525 (31%), Positives = 250/525 (47%), Gaps = 42/525 (8%)

Query: 46  SFIEITEET-----GSKFSFFNRLASQLNAETKGIERITDEEK-TDGSILDATSMWFSAN 99
           S +E+TE +      S    F+     L  E +GI+RI   E+ T         +W SA 
Sbjct: 4   SEVEVTERSIFVRSASSIRQFSDKLDALGVEARGIQRIQPYERGTAKQFWHVAGLWLSAA 63

Query: 100 MVISAYTLGGIGPLVYGLNFGTCVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLI 159
             +S+ +   +GP+V+ L F  C+++ +    +G    A+ S+ G + G RQ+V +R+L 
Sbjct: 64  GGLSSMSSYFLGPMVFQLTFNQCLVSGLISMWIGCGVAAYCSVMGPQSGCRQIVTARYLF 123

Query: 160 GNSTARIIAVINVISSVGWGVVNSVASSQLLNMVNQGHHSCPLWAGCVIIIGATILVTFF 219
           G    + IA+  ++  +GW +VN V   Q+L  V+ G    PLW G +I+   ++LV+ F
Sbjct: 124 GWWFVKFIALAAIVGVMGWSIVNCVVGGQMLASVSDGK--VPLWVGIIIVTVVSLLVSIF 181

Query: 220 GYSYIHAYERWSWVPNFAVFLVIIA----RLHMSGNFSGGEWTSGPTTAGNVLSFGCAIF 275
           G   +   E    VP    FL++      +      FS  +  S  T  G  LSF    +
Sbjct: 182 GIKQVLKVETLFAVPVLTSFLLLYISASDKFKYLYEFSNSDIDS-LTVKGCWLSFFSLCY 240

Query: 276 GFATGWTVYAADYTVYMPRDTNKFKIFFSLVGGLSFPLFFCLILGAASAMGAVNNPTWND 335
              + W    ADY +  P DT + ++F     G + P  F  +LG   A  +++   W  
Sbjct: 241 SITSTWGSITADYYILFPEDTPQIQVFLLTFFGTAVPTTFVGVLGLLLASCSLSYEPWQA 300

Query: 336 YYQNNGMGGVTYAILVPDSLHGFGEFCCVLLALSTIANNIPNMYSIGLAVQAIWEPLAKV 395
            Y   GMGG+  A       +GFG+F  V+L LS I+NNI N YS   ++Q     LAKV
Sbjct: 301 AYDEYGMGGLMNAGF--SRWNGFGKFLVVVLILSLISNNIVNTYSAAFSIQLSSVMLAKV 358

Query: 396 PRAIWTLAGNAATLAISIPACYYFDGFMEDFMNSIGYYLAIYSATALAEHFIFR------ 449
           PR IW +      L  ++     F   + +F+  IGY++++Y    + E+ IFR      
Sbjct: 359 PRWIWAIGCTIFYLVCALVGRNSFSTILGNFLPMIGYWISMYFILLVEENVIFRNWFHHL 418

Query: 450 ---------------------RGFKGYNVEDWDDNSKLPMGIAGCAALFVGAFGVALGMS 488
                                R    YN ++WD++  +  G+A  AA  +G  GV LGM 
Sbjct: 419 YKLEFPNDIEVKPHHKLRKLPRHIHRYNWDEWDNSEVITRGLAASAAFCIGVAGVVLGMC 478

Query: 489 QTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPLEIKYIGR 533
           QTY+VG +A  IGEYGGD+G  LG G+A V Y  LR  E+K  GR
Sbjct: 479 QTYYVGPLAAKIGEYGGDLGMWLGMGFAGVSYPPLRYCELKKFGR 523

>Kwal_47.17216
          Length = 542

 Score =  233 bits (594), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 153/517 (29%), Positives = 243/517 (47%), Gaps = 44/517 (8%)

Query: 56  SKFSFFNRLASQLNAETKGIERITDEEK-TDGSILDATSMWFSANMVISAYTLGGIGPLV 114
           +K S  ++    L  E +GI+RI   E+ T    L    +W SA   +S+ +   +GPL+
Sbjct: 31  NKLSVASKRLDALGVEIRGIQRIPAYERGTSKQFLSVAGLWLSAAGGLSSMSSYFLGPLL 90

Query: 115 YGLNFGTCVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVIS 174
           + L F   +++ +    +G    A+ S  G + G RQMV +R+L G    + +++ ++I 
Sbjct: 91  FELTFRQSLVSGLVSMAIGCAVAAYLSTMGPQSGCRQMVTARYLFGWYFVKFVSLASIIG 150

Query: 175 SVGWGVVNSVASSQLLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVP 234
            +GW +VN V   Q+L  ++      PLW G +I+   + +V  FG   +   E +  VP
Sbjct: 151 VMGWSIVNCVVGGQMLAAISNS--KIPLWVGIIIVTAVSFIVAIFGIKQVLRVETFLSVP 208

Query: 235 NFAVFLVIIA----RLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTV 290
               FL++      + ++   F   +     T  GN LSF    +   + W    ADY +
Sbjct: 209 VLTCFLLLYIAASDKYYLLDTFKNDD-IDPLTIKGNWLSFFSLCYSITSTWGSITADYYI 267

Query: 291 YMPRDTNKFKIFFSLVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAIL 350
             P DT  +K+F     G   P  F  +LG   A  A +   W   Y   GMGG+ ++  
Sbjct: 268 LFPEDTAHYKVFLLTFFGTLIPTTFVGVLGLILASCAASYEPWKAAYHKYGMGGLLFSGF 327

Query: 351 VPDSLHGFGEFCCVLLALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLA 410
             +  +GFG+FC V+L  S I+NNI N YS    +Q     +A+VPR +W +A     L 
Sbjct: 328 --ERWNGFGKFCVVVLIFSLISNNIINTYSAAFNIQLSSVHMARVPRWLWAIACTIFYLV 385

Query: 411 ISIPACYYFDGFMEDFMNSIGYYLAIYSATALAEHFIFRRGFK----------------- 453
            ++    +F   + +F+  IGY++++Y    L E+ IFR  F+                 
Sbjct: 386 CALVGRNHFSEILGNFLPMIGYWISMYFIILLEENLIFRSHFRHLYTEEFPPHPVEEGES 445

Query: 454 -----------------GYNVEDWDDNSKLPMGIAGCAALFVGAFGVALGMSQTYWVGEI 496
                             YN E W++   L  G A   A  VG  GVAL M+Q YW+G I
Sbjct: 446 PRALRDIKNKKVSSRKHAYNWEMWNNAEVLTHGYAATFAFLVGVGGVALSMAQAYWIGPI 505

Query: 497 ARHIGEYGGDIGFELGAGWAFVVYVILRPLEIKYIGR 533
           ARH G++GGD+G  +  G++  VY  LR  E+++ GR
Sbjct: 506 ARHFGDFGGDLGMWVSMGFSGTVYPALRYWELRHYGR 542

>YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of the
           purine/cytosine permease family of membrane transporters
           [1740 bp, 579 aa]
          Length = 579

 Score =  192 bits (487), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 160/545 (29%), Positives = 248/545 (45%), Gaps = 66/545 (12%)

Query: 51  TEETGSKFSFFNRLASQ----------LNAETKGIERITDEEK--TDGSILDATSMWFSA 98
           TE+  S  S   R+ ++          +  E+ GI+RI+  E+  +    L    +W SA
Sbjct: 39  TEKANSSPSILRRIINRAAWLSKKVDAMGVESTGIQRISPYERGTSKKQFLHVAGLWLSA 98

Query: 99  NMVISAYTLGGIGPLVYGLNFGTCVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFL 158
              +S+ +   +GPL++GL+F   V + +    +G L  A+ SI G + G RQMV +R+L
Sbjct: 99  TGGLSSMSSFLLGPLLFGLSFRESVASSLISVTIGCLIAAYCSIMGPQSGCRQMVTARYL 158

Query: 159 IGNSTARIIAVINVISSVGWGVVNSVASSQLLNMVNQGHHSCPLWAGCVIIIGATILVTF 218
            G    +++A+ ++I  +GW VVNSV   ++L  ++  +   PLW G VI+   + LV  
Sbjct: 159 FGWWFVKLVALASIIGVMGWSVVNSVVGGEMLAAIS--NDKVPLWVGIVIVTVCSFLVAI 216

Query: 219 FGYSYIHAYERWSWVPNFAVFLVIIARLHMSGNFSGGEWTSG----PTTAGNVLSFGCAI 274
           FG   +   E +  VP    FL++        +F     + G     T  GN +SF    
Sbjct: 217 FGIKQVIKVETYLSVPVLTAFLLLYISSSDKYSFVNAYVSKGNLDSSTRKGNWMSFFSLC 276

Query: 275 FGFATGWTVYAADYTVYMPRDTNKFKIFFSLVGGLSFPLFFCLILGAASAMGAVNNPTWN 334
           +     W    ADY +  P DT   +IF     G   P  F  ILG   A  A++   W+
Sbjct: 277 YSITATWGSITADYYILFPEDTPYIQIFCLTFFGTFLPTCFVGILGLLLASVAMSYKPWS 336

Query: 335 DYYQNNGMGGVTYAILVPDSLHGFGEFCCVLLALSTIANNIPNMYSIGLAVQAIWEPLAK 394
             Y ++GMGG+ +A       +GFG+FC V+L  S ++NNI N YS   ++Q      AK
Sbjct: 337 VEYDSHGMGGLLWAGF--QRWNGFGKFCVVVLVFSLVSNNIINTYSAAFSIQLSSVFCAK 394

Query: 395 VPRAIWTLAGNAATLAISIPACYYFDGFMEDFMNSIGYYLAIYSATALAEHFIFRRGF-- 452
           +PR  W++      L  ++    +F   + +F+  IGY++++Y      E+ +FRR F  
Sbjct: 395 IPRWFWSIVCTIICLVCALIGRNHFSTILGNFLPMIGYWISMYFILLFEENLVFRRFFLH 454

Query: 453 --------------------------------------------KGYNVEDWDDNSKLPM 468
                                                         YN + W+D   L  
Sbjct: 455 LYTKEFPTVTGEINGPELVGSSKEVEKDAVTNIHLLKRKHKVTKHRYNWDKWEDYEVLTH 514

Query: 469 GIAGCAALFVGAFGVALGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPLEI 528
           G A   A  VG  GV +GM+Q YW+G IA   GEYGGD+   L   ++ VVY   R LE+
Sbjct: 515 GYAATFAFIVGVAGVVVGMAQAYWIGPIAAKFGEYGGDVAMWLSMAFSGVVYPPCRYLEL 574

Query: 529 KYIGR 533
           +  GR
Sbjct: 575 RKFGR 579

>CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, start by similarity
          Length = 631

 Score =  177 bits (448), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 133/462 (28%), Positives = 218/462 (47%), Gaps = 32/462 (6%)

Query: 8   NVYEIQDLEMDLERNSEFSNLP-------NDKKIDLGPTFSNEPASFIEITEETGSKFSF 60
            V  + + + DLE+ S     P       N K  DL     ++P   I +        ++
Sbjct: 25  EVQSVDNSDYDLEKRSTHKTDPDSRTNRRNKKLFDLD---RHDPNLNIFM-----KGLAY 76

Query: 61  FNRLASQLNA---ETKGIERITDEEK-TDGSILDATSMWFSANMVISAYTLGGIGPLVYG 116
              L+ +L++   ET GIER+   E+ T    L    +W SA   +S+ +   +GPL++ 
Sbjct: 77  LLWLSDKLDSFGVETSGIERVPPYERGTKKQFLHVAGLWLSATGGLSSMSSFLLGPLLFE 136

Query: 117 LNFGTCVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSV 176
           L+F   + + +    +G L  A+ SI G + G RQMV +R+L G    + +A+  +I  +
Sbjct: 137 LSFQQALTSSMISVTVGCLVAAYCSIMGPQSGCRQMVTARYLFGWWFVKFVALAAIIGVM 196

Query: 177 GWGVVNSVASSQLLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNF 236
           GW V NSV   ++L  ++  +   PLW G VI+   + +V  FG   +   E +  VP  
Sbjct: 197 GWSVTNSVVGGEMLAAIS--NDRVPLWVGIVIVTVCSFVVAIFGIKQVLRIETYISVPVL 254

Query: 237 AVFLVIIA----RLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYM 292
             FL++      R ++   +   +     T  GN +SF    +   + W    ADY +  
Sbjct: 255 TSFLLLYISSGNRDYLVREYKPID-VPSKTIKGNWISFFSLCYSITSTWGSITADYYILF 313

Query: 293 PRDTNKFKIFFSLVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVP 352
           P DT  +++F   + G   P  F  ILG   A  A +   + + Y  +GMGG+ +A    
Sbjct: 314 PEDTPHYQVFLLTLAGTLIPTTFVGILGLTLASIAKSYQPYGEEYDTHGMGGLLWAGF-- 371

Query: 353 DSLHGFGEFCCVLLALSTIANNIPNMYSIGLAVQ--AIWEPLAKVPRAIWTLAGNAATLA 410
              +GFG+F  V+L LS I+NNI N YS    +Q  A+W   A+VPR  W +      L 
Sbjct: 372 SRWNGFGKFLVVVLILSLISNNIINTYSAAFGIQLSAVWA--ARVPRWFWCIVCTIVYLV 429

Query: 411 ISIPACYYFDGFMEDFMNSIGYYLAIYSATALAEHFIFRRGF 452
            ++    +F   + +F+  IGY++++Y      E+ IFRR F
Sbjct: 430 CALVGRNHFATILGNFLPMIGYWISMYFILLFEENVIFRRYF 471

 Score = 67.8 bits (164), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 47/80 (58%), Gaps = 1/80 (1%)

Query: 455 YNVEDWDDNSKLPMGIAGCAALFVGAFGVALGMSQTYWVGEIARHI-GEYGGDIGFELGA 513
           YN ++WD+   L  G A   A   G  GV +GM+QTYWVG IAR + G YGGDI   L  
Sbjct: 552 YNWDEWDNPDVLTHGYAATFAFLCGVAGVVVGMAQTYWVGPIARKLGGPYGGDIAMWLSM 611

Query: 514 GWAFVVYVILRPLEIKYIGR 533
           G++ +VY  LR  E+   GR
Sbjct: 612 GFSGIVYPWLRYWELVRYGR 631

>Scas_710.30
          Length = 584

 Score =  171 bits (433), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 134/450 (29%), Positives = 215/450 (47%), Gaps = 17/450 (3%)

Query: 29  PNDKKIDLGPT-FS--NEPASFIEITEETGSKFSFFNRLASQLNAETKGIERITDEEK-- 83
           P  +KI++  T F+   +  S++     T +  S   +    L  E  GIERI+  E+  
Sbjct: 4   PTIEKIEVAETEFTTVKKSPSYLRRLLHTANLLS---KKLDSLGVEATGIERISPYERGS 60

Query: 84  TDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFGTCVLTIIFFSILGLLPVAFFSIF 143
                +     W +A   +S+ +   +GPL++GL F   +++ I    +G L  A+ SI 
Sbjct: 61  KRKQFIHVAGYWLAATGSLSSMSSFLLGPLLFGLTFNESMVSGIVSMAIGCLVAAYCSIM 120

Query: 144 GAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGVVNSVASSQLLNMVNQGHHSCPLW 203
           G + G RQMV +R+L G    + +A+  +I  +GW VVNSV   ++L  ++  +   PLW
Sbjct: 121 GPQSGCRQMVTARYLFGWWFVKFVALAAIIGVMGWSVVNSVVGGEMLASIS--NDKVPLW 178

Query: 204 AGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFLVIIA----RLHMSGNFSGGEWTS 259
            G +I+   + LV  FG   +   E +  +P + +F+++      + H   +F       
Sbjct: 179 VGVLIVTLFSFLVAVFGIKQVLKVETYLSIPVWLMFILLYISSSDKYHYIDDFKSPI-PD 237

Query: 260 GPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFKIFFSLVGGLSFPLFFCLIL 319
             T  GN LSF    +     W    ADY +  P DT+KF++F     G   P  F  +L
Sbjct: 238 RLTLKGNWLSFFSLCYSITATWGSITADYYILFPEDTSKFQVFMLTFLGTVVPTLFVGVL 297

Query: 320 GAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGEFCCVLLALSTIANNIPNMY 379
           G   +  A     WND Y   GMGG+ +A       +GFG+FC V+L LS I+NNI N Y
Sbjct: 298 GLCLSTVAATYEPWNDDYNKYGMGGLLHAGF--KRWNGFGKFCVVVLLLSLISNNIINTY 355

Query: 380 SIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFDGFMEDFMNSIGYYLAIYSA 439
           S   +VQ      AKVPR  W++      L  ++    +F   + +F+  IGY++++Y  
Sbjct: 356 SAAFSVQLASVKAAKVPRWFWSIVCMIICLVCALVGRNHFSTILGNFLPMIGYWISMYFI 415

Query: 440 TALAEHFIFRRGFKGYNVEDWDDNSKLPMG 469
             L E+ IFR  F     +++ +  K   G
Sbjct: 416 LLLEENVIFREYFHHLYYKEFPEFDKSKSG 445

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 421 GFMEDFMNSIGYYLAIYSATALAEHFIFRRGF---KGYNVEDWDDNSKLPMGIAGCAALF 477
               +F N+     +   AT    H + RR       YN   WDD   L  G A   A  
Sbjct: 469 ALQNNFENNKDKTDSTKEATITNIHLLKRRHLATSHKYNWNKWDDPEVLTHGYAATFAFL 528

Query: 478 VGAFGVALGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPLEIKYIGR 533
            G  GV +GM+Q YW+G +AR  GE GGDI   L   ++ +VY  LR  E++  GR
Sbjct: 529 CGVAGVVVGMAQAYWIGPLARKFGETGGDIAMWLSMAFSGLVYPPLRYWELRRYGR 584

>Scas_701.1
          Length = 68

 Score =  100 bits (250), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 46/68 (67%), Positives = 55/68 (80%)

Query: 466 LPMGIAGCAALFVGAFGVALGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRP 525
           LP+GIAG    FV AFGVALGM Q+YWVGEI R IG+ GGD+GFE+GA W F+ YV++RP
Sbjct: 1   LPIGIAGGVGFFVAAFGVALGMCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVRP 60

Query: 526 LEIKYIGR 533
           LE+KY GR
Sbjct: 61  LELKYFGR 68

>Scas_690.1*
          Length = 636

 Score =  108 bits (270), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (77%)

Query: 462 DNSKLPMGIAGCAALFVGAFGVALGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYV 521
           D   LP+GIAG    FV AFGVALGM Q+YWVGEI R IG+ GGD+GFE+GA W F+ YV
Sbjct: 565 DGHSLPIGIAGGVGFFVAAFGVALGMCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYV 624

Query: 522 ILRPLEIKYIGR 533
           ++RPLE+KY GR
Sbjct: 625 LVRPLELKYFGR 636

>CAGL0F07293g complement(710050..712224) highly similar to sp|P53134
           Saccharomyces cerevisiae YGL114w, start by similarity
          Length = 724

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 10/69 (14%)

Query: 137 VAFFSIFGAKFGLRQMVLSR----FLIGNSTARIIAVINVISSVGWGVVNSVASSQLLNM 192
           + +F IF A   LR+ V+ R    F  GN+TA +IAV+N     G  ++  V+  ++L M
Sbjct: 145 LTYFGIFFA-VPLRKQVIVREKLPFPSGNATATLIAVLN-----GTEIIQEVSKKEVLQM 198

Query: 193 VNQGHHSCP 201
             +    CP
Sbjct: 199 RRRRLEQCP 207

>Scas_636.16
          Length = 1554

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 50/126 (39%), Gaps = 24/126 (19%)

Query: 255 GEWTSGPTTAGNVLSFGCAIFG--FATGWTVYAADYTVYM------PRDTNKF--KIFFS 304
           G+  + P T  N+L  GC +    +A G  V+  D T  M      P   ++   ++ FS
Sbjct: 472 GQTHNEPITINNMLLRGCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTKKSRISRELNFS 531

Query: 305 LVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGG--------------VTYAIL 350
           ++    F    CLI G A+       P   D+++   + G              + Y  L
Sbjct: 532 VLINFVFLFILCLIAGVANGAYYRKKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSL 591

Query: 351 VPDSLH 356
           VP SL+
Sbjct: 592 VPISLY 597

>Kwal_47.18919
          Length = 640

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 55/258 (21%), Positives = 93/258 (36%), Gaps = 56/258 (21%)

Query: 61  FNRLASQLNAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFG 120
             R A++L  ET   + +T++E    S+ +  +       V+    L    P++  + F 
Sbjct: 382 LKRRAAKLRRETGNPKIMTEQEAQGLSVGEMVNA-----CVLRPLYLAVTEPVLDLMCFY 436

Query: 121 TCVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGV 180
            C++  + ++     PV F  ++G K  L  ++L   LIG S A  +A  +   +    +
Sbjct: 437 VCLIYSLLYAFFFAYPVIFGELYGYKDNLIGLMLIPILIGASVA--LATTSFCETQYLKI 494

Query: 181 V---NSVASSQLLN-MVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNF 236
               N     +LL  M+     +  LW     I+GAT            AY    WV   
Sbjct: 495 TKRRNPTPEDRLLGAMIGAPFAAIALW-----ILGAT------------AYHHIIWV--- 534

Query: 237 AVFLVIIARLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDT 296
                                  GP ++G V  +G  +  ++     Y  D         
Sbjct: 535 -----------------------GPASSGLVFGYGMVLIYYSLN--NYIIDCYAMYASSA 569

Query: 297 NKFKIFFSLVGGLSFPLF 314
              K+F    GG +FPLF
Sbjct: 570 LATKVFLRSAGGAAFPLF 587

>CAGL0D02662g complement(278099..279793) highly similar to sp|P23585
           Saccharomyces cerevisiae YMR011w HXT2 high-affinity
           hexose transporter, start by similarity
          Length = 564

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 32/68 (47%), Gaps = 4/68 (5%)

Query: 235 NFAVFLVIIARLHMSGNFSGGEWTSGPTTAGNVL-SFGCA-IFGFATGW--TVYAADYTV 290
             AV +VI A + +   +  G+     TTAGNV+  F C  IF FAT W  T Y      
Sbjct: 393 TMAVCMVIFASVGVKSLYPNGKDQPSSTTAGNVMIVFTCLYIFCFATTWAPTAYVIVAET 452

Query: 291 YMPRDTNK 298
           Y  R  N+
Sbjct: 453 YPLRVKNR 460

>CAGL0D02640g 274285..275979 highly similar to sp|P23585
           Saccharomyces cerevisiae YMR011w HXT2 high-affinity
           hexose transporter, start by similarity
          Length = 564

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 32/68 (47%), Gaps = 4/68 (5%)

Query: 235 NFAVFLVIIARLHMSGNFSGGEWTSGPTTAGNVL-SFGCA-IFGFATGW--TVYAADYTV 290
             AV +VI A + +   +  G+     TTAGNV+  F C  IF FAT W  T Y      
Sbjct: 393 TMAVCMVIFASVGVKSLYPNGKDQPSSTTAGNVMIVFTCLYIFCFATTWAPTAYVIVAET 452

Query: 291 YMPRDTNK 298
           Y  R  N+
Sbjct: 453 YPLRVKNR 460

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.140    0.442 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,089,776
Number of extensions: 731149
Number of successful extensions: 2501
Number of sequences better than 10.0: 43
Number of HSP's gapped: 2529
Number of HSP's successfully gapped: 47
Length of query: 533
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 427
Effective length of database: 12,926,601
Effective search space: 5519658627
Effective search space used: 5519658627
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)