Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_715.4729729715660.0
KLLA0F27489g29729713010.0
YER055C (HIS1)29729712841e-180
CAGL0L00759g30630611971e-167
ADL081C29729711581e-161
Kwal_23.577924824810771e-149
KLLA0A11814g302146710.47
Kwal_27.12536258110652.9
YKL028W (TFA1)48235636.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_715.47
         (297 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_715.47                                                           607   0.0  
KLLA0F27489g 2544518..2545411 highly similar to sp|P00498 Saccha...   505   0.0  
YER055C (HIS1) [1484] chr5 complement(264891..265784) ATP phosph...   499   e-180
CAGL0L00759g 93848..94768 highly similar to sp|P00498 Saccharomy...   465   e-167
ADL081C [1660] [Homologous to ScYER055C (HIS1) - SH] (540943..54...   450   e-161
Kwal_23.5779                                                          419   e-149
KLLA0A11814g 1021526..1022434 highly similar to sp|P20459 Saccha...    32   0.47 
Kwal_27.12536                                                          30   2.9  
YKL028W (TFA1) [3227] chr11 (385401..386849) RNA polymerase II t...    29   6.0  

>Scas_715.47
          Length = 297

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/297 (100%), Positives = 297/297 (100%)

Query: 1   MDLVNHLNDRLLFAIPKKGRLYEKSVTILNGSDIKFHRSQRLDIALCTTLPIALIFLPAA 60
           MDLVNHLNDRLLFAIPKKGRLYEKSVTILNGSDIKFHRSQRLDIALCTTLPIALIFLPAA
Sbjct: 1   MDLVNHLNDRLLFAIPKKGRLYEKSVTILNGSDIKFHRSQRLDIALCTTLPIALIFLPAA 60

Query: 61  DIPMFVGEGRCDLGITGVDQVREAKMDVDLPIDLKFGSCKLQVQVPVNGPYTKPEQLIGK 120
           DIPMFVGEGRCDLGITGVDQVREAKMDVDLPIDLKFGSCKLQVQVPVNGPYTKPEQLIGK
Sbjct: 61  DIPMFVGEGRCDLGITGVDQVREAKMDVDLPIDLKFGSCKLQVQVPVNGPYTKPEQLIGK 120

Query: 121 TIVSSFTNLTEEYFAKLEGVPAEKMTTKVKYVGGSVEASCALGVADAIVDLVESGETMRA 180
           TIVSSFTNLTEEYFAKLEGVPAEKMTTKVKYVGGSVEASCALGVADAIVDLVESGETMRA
Sbjct: 121 TIVSSFTNLTEEYFAKLEGVPAEKMTTKVKYVGGSVEASCALGVADAIVDLVESGETMRA 180

Query: 181 AGLIDIATVLETSAHVIESKNPRSDKDLIETIKSRIEGVITAQRYVCCNYNAPEDKLSQL 240
           AGLIDIATVLETSAHVIESKNPRSDKDLIETIKSRIEGVITAQRYVCCNYNAPEDKLSQL
Sbjct: 181 AGLIDIATVLETSAHVIESKNPRSDKDLIETIKSRIEGVITAQRYVCCNYNAPEDKLSQL 240

Query: 241 LTITPGRRGPTISKIDSDGWVAVNSMIERSKKGEIMDELKKKGAADIMVFEISNCRV 297
           LTITPGRRGPTISKIDSDGWVAVNSMIERSKKGEIMDELKKKGAADIMVFEISNCRV
Sbjct: 241 LTITPGRRGPTISKIDSDGWVAVNSMIERSKKGEIMDELKKKGAADIMVFEISNCRV 297

>KLLA0F27489g 2544518..2545411 highly similar to sp|P00498
           Saccharomyces cerevisiae YER055c HIS1 ATP
           phosphoribosyltransferase singleton, start by similarity
          Length = 297

 Score =  505 bits (1301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/297 (80%), Positives = 271/297 (91%)

Query: 1   MDLVNHLNDRLLFAIPKKGRLYEKSVTILNGSDIKFHRSQRLDIALCTTLPIALIFLPAA 60
           MDLVNHLND+LLFAIPKKGRLYEKSV+IL GSDIKFHRS RLDIA+ T +P+ALIFLPAA
Sbjct: 1   MDLVNHLNDKLLFAIPKKGRLYEKSVSILKGSDIKFHRSARLDIAISTNMPVALIFLPAA 60

Query: 61  DIPMFVGEGRCDLGITGVDQVREAKMDVDLPIDLKFGSCKLQVQVPVNGPYTKPEQLIGK 120
           DIPMFVGEGRCDLGITGVDQVRE+++DV+LPIDL+FG+CKLQVQVPV G YT PEQLIGK
Sbjct: 61  DIPMFVGEGRCDLGITGVDQVRESEVDVNLPIDLQFGTCKLQVQVPVAGEYTSPEQLIGK 120

Query: 121 TIVSSFTNLTEEYFAKLEGVPAEKMTTKVKYVGGSVEASCALGVADAIVDLVESGETMRA 180
           TIVSSF NLT++YFA+LEGVP  +M T+VKYVGGSVEASCALGVADAIVDLVESGETMRA
Sbjct: 121 TIVSSFVNLTKKYFAQLEGVPESEMVTRVKYVGGSVEASCALGVADAIVDLVESGETMRA 180

Query: 181 AGLIDIATVLETSAHVIESKNPRSDKDLIETIKSRIEGVITAQRYVCCNYNAPEDKLSQL 240
           AGL  IATVL+TSAH+IESKNP+ D +L+ TIKSRIEGV+TAQ+YV C+YNAPE+KL +L
Sbjct: 181 AGLTAIATVLDTSAHLIESKNPKGDVELLRTIKSRIEGVMTAQKYVSCSYNAPENKLPEL 240

Query: 241 LTITPGRRGPTISKIDSDGWVAVNSMIERSKKGEIMDELKKKGAADIMVFEISNCRV 297
           L ITPGRR PTIS+I+  GWVAV+SMIER  KG+IMD+LKK GA DIMVFEISNCRV
Sbjct: 241 LKITPGRRAPTISQINDSGWVAVSSMIERKNKGDIMDDLKKNGAEDIMVFEISNCRV 297

>YER055C (HIS1) [1484] chr5 complement(264891..265784) ATP
           phosphoribosyltransferase, first step in histidine
           biosynthesis pathway [894 bp, 297 aa]
          Length = 297

 Score =  499 bits (1284), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 236/297 (79%), Positives = 266/297 (89%)

Query: 1   MDLVNHLNDRLLFAIPKKGRLYEKSVTILNGSDIKFHRSQRLDIALCTTLPIALIFLPAA 60
           MDLVNHL DRLLFAIPKKGRLY KSV+ILNG+DI FHRSQRLDIAL T+LP+AL+FLPAA
Sbjct: 1   MDLVNHLTDRLLFAIPKKGRLYSKSVSILNGADITFHRSQRLDIALSTSLPVALVFLPAA 60

Query: 61  DIPMFVGEGRCDLGITGVDQVREAKMDVDLPIDLKFGSCKLQVQVPVNGPYTKPEQLIGK 120
           DIP FVGEG+CDLGITGVDQVRE+ +DVDL IDL+FG+CKLQVQVPVNG Y KPEQLIGK
Sbjct: 61  DIPTFVGEGKCDLGITGVDQVRESNVDVDLAIDLQFGNCKLQVQVPVNGEYKKPEQLIGK 120

Query: 121 TIVSSFTNLTEEYFAKLEGVPAEKMTTKVKYVGGSVEASCALGVADAIVDLVESGETMRA 180
           TIV+SF  L E+YFA LEG   EKMTT++K+V GSVEASCALG+ DAIVDLVESGETMRA
Sbjct: 121 TIVTSFVKLAEKYFADLEGTTVEKMTTRIKFVSGSVEASCALGIGDAIVDLVESGETMRA 180

Query: 181 AGLIDIATVLETSAHVIESKNPRSDKDLIETIKSRIEGVITAQRYVCCNYNAPEDKLSQL 240
           AGL+DIATVL TSA++IESKNP+SDK LI TIKSRIEGV+TAQR+V C YNAPEDKL +L
Sbjct: 181 AGLVDIATVLSTSAYLIESKNPKSDKSLIATIKSRIEGVMTAQRFVSCIYNAPEDKLPEL 240

Query: 241 LTITPGRRGPTISKIDSDGWVAVNSMIERSKKGEIMDELKKKGAADIMVFEISNCRV 297
           L +TPGRR PTISKID +GWVAV+SMIER  KG ++DELK+ GA+DIMVFEISNCRV
Sbjct: 241 LKVTPGRRAPTISKIDDEGWVAVSSMIERKTKGVVLDELKRLGASDIMVFEISNCRV 297

>CAGL0L00759g 93848..94768 highly similar to sp|P00498 Saccharomyces
           cerevisiae YER055c HIS1, start by similarity
          Length = 306

 Score =  465 bits (1197), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 226/306 (73%), Positives = 265/306 (86%), Gaps = 9/306 (2%)

Query: 1   MDLVNHLNDRLLFAIPKKGRLYEKSVTILNGSDIKFHRSQRLDIALCTTLPIALIFLPAA 60
           MD VNHLNDRLLFA+PKKGRLYEK+  +LNGSDIKF+RS RLDIALCTTLPIALIFLPAA
Sbjct: 1   MDFVNHLNDRLLFAVPKKGRLYEKTKQLLNGSDIKFNRSNRLDIALCTTLPIALIFLPAA 60

Query: 61  DIPMFVGEGRCDLGITGVDQVREAKMD-VDLPIDLKFGSCKLQVQVP-VNGPYTKPEQLI 118
           DIP FVGEG+CDLGITG+DQV+E+ ++ +DL +DL FG CKLQVQVP  +  YT P+QL+
Sbjct: 61  DIPTFVGEGKCDLGITGLDQVKESGIEEIDLLMDLGFGGCKLQVQVPEKDRKYTDPKQLV 120

Query: 119 GKTIVSSFTNLTEEYFAKLE----GVPAEKMTTKVKYVGGSVEASCALGVADAIVDLVES 174
           GKTIVSSF  L+ +YF +LE    G P +K++TK+KYVGGSVEASCALGV DAIVDLVES
Sbjct: 121 GKTIVSSFVKLSRDYFQQLEEEVLGKPVDKLSTKIKYVGGSVEASCALGVGDAIVDLVES 180

Query: 175 GETMRAAGLIDIATVLETSAHVIESKNPRSDK---DLIETIKSRIEGVITAQRYVCCNYN 231
           GETMRAAGLIDIATVLETSA++I+++ P+ DK   +LIE IKSRI+GV+TAQRYVCC+YN
Sbjct: 181 GETMRAAGLIDIATVLETSAYLIQARRPQQDKSREELIEVIKSRIQGVLTAQRYVCCSYN 240

Query: 232 APEDKLSQLLTITPGRRGPTISKIDSDGWVAVNSMIERSKKGEIMDELKKKGAADIMVFE 291
            PE  L +LL +TPGRR PTISK+D DGWVAVNSMIER +K +IMDELK+KGA+DIMVFE
Sbjct: 241 TPEGNLKELLKVTPGRRAPTISKLDDDGWVAVNSMIERKRKADIMDELKRKGASDIMVFE 300

Query: 292 ISNCRV 297
           ISNCRV
Sbjct: 301 ISNCRV 306

>ADL081C [1660] [Homologous to ScYER055C (HIS1) - SH]
           (540943..541836) [894 bp, 297 aa]
          Length = 297

 Score =  450 bits (1158), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 217/297 (73%), Positives = 246/297 (82%)

Query: 1   MDLVNHLNDRLLFAIPKKGRLYEKSVTILNGSDIKFHRSQRLDIALCTTLPIALIFLPAA 60
           MDLV  LNDRLLFA+PKKGRLYEKSV +LNG+DI FHRS RLDIAL T+ P+ALIFLPAA
Sbjct: 1   MDLVRQLNDRLLFAVPKKGRLYEKSVALLNGADILFHRSHRLDIALSTSTPVALIFLPAA 60

Query: 61  DIPMFVGEGRCDLGITGVDQVREAKMDVDLPIDLKFGSCKLQVQVPVNGPYTKPEQLIGK 120
           DIP FVGEGRCDLGITGVDQVRE+ ++V+L  DL FG C+LQVQVP  GPY++PEQLIGK
Sbjct: 61  DIPTFVGEGRCDLGITGVDQVRESGVNVELLQDLDFGRCQLQVQVPAGGPYSQPEQLIGK 120

Query: 121 TIVSSFTNLTEEYFAKLEGVPAEKMTTKVKYVGGSVEASCALGVADAIVDLVESGETMRA 180
           TIV+SFT L  EYFA+LEGV    MTT+VKYVGGSVEA+CALGVADAIVDLVESGETMRA
Sbjct: 121 TIVTSFTRLAREYFARLEGVDEAAMTTRVKYVGGSVEAACALGVADAIVDLVESGETMRA 180

Query: 181 AGLIDIATVLETSAHVIESKNPRSDKDLIETIKSRIEGVITAQRYVCCNYNAPEDKLSQL 240
           AGL  I TVL TSAH+I S NP+S   L++T+++RIEGV+ AQ YV C YNA  D L  L
Sbjct: 181 AGLTPIGTVLSTSAHLICSPNPKSSLALLDTVRARIEGVLAAQHYVYCTYNAHADALPAL 240

Query: 241 LTITPGRRGPTISKIDSDGWVAVNSMIERSKKGEIMDELKKKGAADIMVFEISNCRV 297
           L ITPGRR PTISK+D D W AV+SMI R +KG I+D+LK  GA DIMVFEISNCRV
Sbjct: 241 LRITPGRRAPTISKLDDDNWYAVSSMIIRREKGRILDDLKASGAEDIMVFEISNCRV 297

>Kwal_23.5779
          Length = 248

 Score =  419 bits (1077), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 200/248 (80%), Positives = 227/248 (91%)

Query: 50  LPIALIFLPAADIPMFVGEGRCDLGITGVDQVREAKMDVDLPIDLKFGSCKLQVQVPVNG 109
           +PIALIFLPAADIPMFVGEG+CDLGITGVDQV+E+ +DV LP+DL FGSCKLQVQVP  G
Sbjct: 1   MPIALIFLPAADIPMFVGEGKCDLGITGVDQVQESDVDVLLPMDLNFGSCKLQVQVPNAG 60

Query: 110 PYTKPEQLIGKTIVSSFTNLTEEYFAKLEGVPAEKMTTKVKYVGGSVEASCALGVADAIV 169
           PY KPEQLIGKTIVSSFTNLT++YFAKLEGVP EK+TTK++YVGGSVEASCALG+ADAIV
Sbjct: 61  PYEKPEQLIGKTIVSSFTNLTKQYFAKLEGVPVEKITTKIRYVGGSVEASCALGIADAIV 120

Query: 170 DLVESGETMRAAGLIDIATVLETSAHVIESKNPRSDKDLIETIKSRIEGVITAQRYVCCN 229
           DLVESGETMRAAGL DIATVLETSAH+IESKNP+ D +L++TIKSRIEGV+TAQ+YV CN
Sbjct: 121 DLVESGETMRAAGLKDIATVLETSAHLIESKNPKGDPELLQTIKSRIEGVMTAQKYVNCN 180

Query: 230 YNAPEDKLSQLLTITPGRRGPTISKIDSDGWVAVNSMIERSKKGEIMDELKKKGAADIMV 289
           YNAP   L ++L ITPGRR PTISKID +GWVAV++MI+R +KG IMD+LKK GAADIMV
Sbjct: 181 YNAPVTALEKVLKITPGRRAPTISKIDDEGWVAVSAMIDRKQKGTIMDDLKKNGAADIMV 240

Query: 290 FEISNCRV 297
           FEISNCRV
Sbjct: 241 FEISNCRV 248

>KLLA0A11814g 1021526..1022434 highly similar to sp|P20459
           Saccharomyces cerevisiae YJR007w SUI2 translation
           initiation factor eIF2, alpha chain singleton, start by
           similarity
          Length = 302

 Score = 32.0 bits (71), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 64/146 (43%), Gaps = 13/146 (8%)

Query: 91  PIDLKFGSCKLQVQVPVNGPYTKPEQLIGKTIVSSFTNLTEEYFAKLEGVPAEKMTTKVK 150
           P+  K+G      ++ +  P           +     ++++E F +L+G    ++T +  
Sbjct: 133 PLSRKYGHAYDAYKMSIVDP----------NVWDGIESISDEIFQELKGQITRRLTPQAV 182

Query: 151 YVGGSVEASC-ALGVADAIVDLVESGETMRAAGLIDIATVLETSAHVIESKNPRSDK--D 207
            +   VE SC +    DAI + ++S E +    +     ++    +VI +++   D+   
Sbjct: 183 KIRADVEVSCFSYEGIDAIKEALKSAEELSTEQMQIKVKLVAAPLYVITTQSLDKDQGVQ 242

Query: 208 LIETIKSRIEGVITAQRYVCCNYNAP 233
           L+ET  ++IE VI     VC    AP
Sbjct: 243 LLETAIAKIEEVILKYNGVCNVTMAP 268

>Kwal_27.12536
          Length = 258

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 49/110 (44%), Gaps = 23/110 (20%)

Query: 11  LLFAIPKKGRLYEKSVTILNGSDIKFHRSQRLDIALCTTLPIA---------------LI 55
           LLF   KK R+ E S+ +++  D  F   + ++     T+P A               L 
Sbjct: 101 LLFEDTKKDRISEYSLKLMD-IDADFLDIEGMEYDTIITMPSAEFAKVVRDLNQLSDSLN 159

Query: 56  FLPAADIPMFVGEGRCDLGI------TGVDQVREA-KMDVDLPIDLKFGS 98
            L   D   FV EG    G       T +D+ +E+ K+++D P+DL FGS
Sbjct: 160 ILVTKDTVKFVAEGDIGSGSVIVKPHTDMDKPQESVKVELDKPVDLTFGS 209

>YKL028W (TFA1) [3227] chr11 (385401..386849) RNA polymerase II
           transcription initiation factor TFIIE (factor a), 66 kDa
           subunit [1449 bp, 482 aa]
          Length = 482

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 234 EDKLSQLLTITPGRRGPTISKIDSDGWVAVNSMIE 268
           ED L QLL+I     GP I+++ SD  ++++   E
Sbjct: 40  EDDLKQLLSINKTELGPLIARLRSDRLISIHKQRE 74

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.136    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,967,965
Number of extensions: 363980
Number of successful extensions: 982
Number of sequences better than 10.0: 10
Number of HSP's gapped: 978
Number of HSP's successfully gapped: 10
Length of query: 297
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 196
Effective length of database: 13,099,691
Effective search space: 2567539436
Effective search space used: 2567539436
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)